GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.2

Based on 957 opinions finded in 2 websites

site_photo4

Nº 292 in 521 in Shepway

Nº 41 of 80 British in Shepway

CUSTOMERS TALK ABOUT DISHES WITH..fishbaconoldroastvegetablesporkcookedpieonionchickenlivermeatsteakladypaypotatoescurry

comment_iconOpinions

What a hidden gem, finding gluten free food with choice is always difficult so accommodating in dietary need. I had the most amazing gluten free fish and chips with onion rings. Most menu choices weee available I. Gluten free.

site_logo

Liz P . 2025-04-18

MORE AT TripAdvisor

Very pleasant first visit to this little gem. Very friendly team who sneaked us in on a busy Sat night. Atmosphere & staff were very good. We shared a starter and then our main courses turned up. We then parted company on culinary experiences with my Liver and bacon being very nice but my wife’s lasagne not so. Very dry, limited mince and not real taste to it. That said the rest of the visit was very pleasant

site_logo

Jay J . 2025-04-13

MORE AT TripAdvisor

We travelled to meet with family who were visiting from France and stayed on the campsite opposite. This was the perfect location in walking distance, very convenient. How lucky we were as the food, service and atmosphere was exemplary. It is dog friendly and all the staff were so welcoming and very obviously care so much about what they do. Our server was Toby who has to have a special mention as he was attentive and looked after us amazingly all evening, knowledgeable of the menus and friendly. This has been a memorable night and one we will be revisiting. Thanks to you all.

site_logo

jasondavidsmith . 2025-04-12

MORE AT TripAdvisor

Lovely atmosphere, lovely food, really tasty!! Attentive waitress sorry didn’t catch her name! Clean and welcoming! Michelle you are the hostess with mostest! Thank you for making us feel so welcome! Like mum I shall be back soon! X

site_logo

James C . 2025-04-03

MORE AT TripAdvisor

What an amazing find !! The food was so good !!! They have a nice open fire we sat Infront of. My dog was welcome as well. Will definitely be going back as everone so friendly.

site_logo

mark hounsell . 2025-03-28

MORE AT Google

Was amazing.staff were very friendly, portion sizes great, doggy bag after sunday lunch. Landlady lovely, also dog friendly. Also very reasonably priced

site_logo

Cheryl Boyle . 2025-03-23

MORE AT Google

Peter D was not part of our group and has taken a review and distorted it to make out he was there that evening. I can only believe this is for a personal vendetta and to have a dig at the pub. Please ignore his comments.

site_logo

Robert G . 2025-03-20

MORE AT TripAdvisor

Awful experience tonight. Had a table booked for 5 with 2 dogs. Upon arriving was only allowed in the door once we told what our booking was, was showed to our table which was behind the tv with the rugby blasting so loud I couldn’t hear anyone speak and the tables was so small you’d be lucky to fit 2 dinner plates on. We asked if we could move to one of the other tables that was free and the man replied I’m so sorry but we’ve had a bigger booking than yours so we’ve had to sit you here. That’s fine but when I asked again to get moved to another table he replied again and said sorry the tables are only big enough for 4 people, the tables we was sat on were only suitable for 2 people so we decided to leave after our drinks as we wasn’t able to physically eat dinner on the such small tables they put us on. Ruined my fathers birthday unfortunately, won’t be returning.

site_logo

Emma Tanner . 2025-03-15

MORE AT Google

Very hospitable food and drinks amazing recommended all the time a big plus dog friendly

site_logo

Steve Hussey . 2025-03-14

MORE AT Google

Wowzers . What can I say ?!?! Was staying at motorhome park Opposite and went to pub 2 nights running . Michele the pub lady is awesome, she gave us an itinerary to our trip to Folkestone and it didn’t disappoint . She is amazing. The food and service at the pub is amazing too . The steak pie is sublime x thank you Michele for making us and our dogs so welcome

site_logo

Sarah Hill . 2025-03-08

MORE AT Google

Very nice Sunday lunch but very disappointed when we ordered roast beef to be told they had run out of Yorkshire pudding. Perhaps we should have been told when booking a table, which they said we could have at 3.00pm because they were busy, that they may have sold out of some dishes. Might I suggest that when the chef makes them he always has some in the freezer! That said we did enjoy the roast and the live music was outstanding from the 2 young men from London. We will go again but book a lunch table for much earlier. Good atmosphere and very nice staff.

site_logo

2011foodlover . 2025-03-05

MORE AT TripAdvisor

Good straight forward pub food, good value. Friendly atmosphere, country pub feeling.

site_logo

Steve Kenton . 2025-03-02

MORE AT Google

A lovely traditional pub with an open fire. Amazing food and a real nice atmosphere. Bar staff are all very friendly. Parking out the back and front. Friendly well behaved dogs also welcome.

site_logo

Marc Bates . 2025-02-26

MORE AT Google

A lovely little country pub , make you feel welcome. Food is amazing., staff are fantastic. The Best landlady really goes out her way to make you feel welcome.

site_logo

Mariah P . 2025-02-26

MORE AT TripAdvisor

went with friend for a dinner out, four meals came out cold and were sent back four times each time only being microwaved, eventually the meals were so congealed we returned them which brought down the vile lady owner who insisted everything was hot (which it wasn't) she did not offer any replacement or indeed an apology but instead shouted at us that no one needed to pay and then stormed off. we were not looking for this only a decent meal, those who's meals were edible paid for theirs, all the time we were sorting this out at the bar the lady owner just blanked us and when we left not even a thank you. The staff were friendly and polite in this difficult situation maybe the vile owner can have some lessons from them along with customer management and anger issues.

site_logo

Peter D . 2025-02-17

MORE AT TripAdvisor

1 out of 5 Booked a table for 12 to eat here. We pre ordered our food and had to pay a £10 deposit each so nothing should have gone wrong. How wrong were we!!! Four of the twelve main meals came out so cold they had to be sent back, after a few minutes in a microwave they were returned to us but still cold. This happened 4 times. On the fifth attempted of re-microwaving we decided enough was enough and we was not accepting the same meal again. This brought down the lady owner who can only be said to have an angry attitude. She promptly told us the the food was hot and it had been probed and we had been given freshly made meals. Despite the fact that the mustard I had put on my dinner was still on it. On explaining this she through her teddy bears out of her pram and declared that none of us had to pay for our meals and then stormed off. We requested our deposit back as well to which she sent a junior member of staff out to refund the deposit but she was keeping the cost of the starter. Our group not being out for a free meal decided to pay for all of the meals that we’re okay, all the time we were sorting this out the owner did not once acknowledge us or return to apologise. Four of us left hungry and made to feel it was our fault. There was no issues with the staff who were friendly and polite and did try to sort out the situation. Unfortunately four members of our group are locals of the village and use the pub regularly, you would hoped the owner would have tried a bit harder to sort out the issue for them. We will not return !!!

site_logo

Kerry C . 2025-02-16

MORE AT TripAdvisor

Food was so bad I'm not sure I would've eaten it if I was starving to death.

site_logo

Frances “Franni Bobani” . 2025-01-22

MORE AT Google

Just what a good pub should be , cozy , roaring fire , good food, fantastic service. Special mention to poppy our service, a credit to you

site_logo

Paul the baker . 2025-01-12

MORE AT Google

Perfect spot to stop after walking the dogs around the near by army training. Lots of parking and dog friendly. Had a great bowl of chips and a delicious Guinness. Very friendly staff

site_logo

Ed Roberts . 2025-01-04

MORE AT Google

After being let down by another pub on the day of my daughter’s 21st birthday the black horse accommodated 18 people for a lovely meal at such short notice. The staff here went above and beyond to make sure that we had a lovely evening. The food was one of the best meals we have had and very reasonably priced. I want to thank you again for turning a disaster into a lovely evening to help us celebrate and we will definitely be back for a roast dinner in the new year

site_logo

Lucy Langley . 2024-12-22

MORE AT Google

1st time at the Black Horse for me. Excellent food, great portion sizes & presentation, amazing service and very comfortable experience. I highly recommend this warm friendly pub for dining or just a drink. Well done to all the team at the Black Horse!

site_logo

Clinton P . 2024-12-21

MORE AT TripAdvisor

Love this pub Cosy, warm, friendly staff and nice beer

site_logo

scott stretton . 2024-12-15

MORE AT Google

Stayed at the Caravan site over the road, popped in for a meal with friends we all had the Steak and Guinness pie. The food and staff were all excellent, will definitely return.

site_logo

richard middleton . 2024-12-14

MORE AT Google

This pub is so lovely, such a lovely ambiance with such friendly people, a real old school vibe of the pubs we used to know but with an elegant tough. Staff so attentive and the food was amazing I can honestly say the best fish & chips I’ve ever had, batter was so light and fluffy….. Thank you for your hospitality, will definitely return Teresa

site_logo

Teresa B . 2024-12-11

MORE AT TripAdvisor

Dog & I are really enjoying our visits here, both lunchtime and evening. The food is far better and more substantial than I expected. The bar staff are very friendly and helpful. One small criticism is that they have none of the many excellent Kentish ales - however the house Merlot is very pleasant. The open log fire makes such a difference to the ambience.

site_logo

WB52 . 2024-12-10

MORE AT Google

When we walked in we fell in love with the place. Very warm and welcoming even before talking to anyone. We were served by Toby. He was excellent told us about the food the Sunday roast and what was his favourite. Speaking with another customer he advised the steak and Guinness pie was the best he has had in years. We tried a the Halomi fries which we very tasty.

site_logo

Don Wilson . 2024-11-30

MORE AT Google

Booked for a large 'significant' birthday meal. Landlady was really good together with staff. Food and service was great, considering dietry/allergy needs. Really positive experience and highly recommended.

site_logo

Gregory D . 2024-11-17

MORE AT TripAdvisor

This is the third time we’ve visited this wonderful pub/restaurant and every time it’s an enjoyable experience We stayed at The Black Horse Farm caravan and camping site just across the road with our dogs for a weekend break. Lovely dog walks around this area and this pub is a gem. Extremely dog friendly, wonderful Landlady and helpful staff. The dogs roamed around as happy as Larry enjoying the fuss, treats and company of other pooches. A must visit, highly recommend.

site_logo

SwiftlyDoesIt . 2024-11-17

MORE AT TripAdvisor

We stayed at the caravan park opposite, booked a table after messaging Michelle to see if gluten free was available. What an amazing place! Great food, great choice of gluten free, felt safe as the owner is gluten free too, highly recommend!

site_logo

Jo Drury . 2024-11-11

MORE AT Google

What an excellent little pub with some lovely comfortable seating and a friendly atmosphere. We ate at lunchtime and although a limited menu what we had was very good quality. Clearly some effort and care had clearly been put into the preparation. It isn't the biggest of pubs so in busier times it could be well advisable to book. Definitely recommend and we would certainly go back when in the area.

site_logo

Barry Winter . 2024-11-02

MORE AT Google

Amazing welcome and what accommodating staff!! We turned up on Halloween not expecting a special menu and they could not do enough to supports for “off menu” requests. Super dog friendly, accommodating our 4 spaniels and a chihuahua. Will definitely be back when in the area. Amazing food, ambience and staff. Thank you

site_logo

Odyssey45522880409 . 2024-10-31

MORE AT TripAdvisor

Good honest pub grub. Well worth eating. The real ale was OK, sadly when I visited it was at the end of the barrel and was a smidge cloudy - tasted fine though!

site_logo

petethevan . 2024-10-29

MORE AT Google

Thank you for the lovely fish and chips that I had today . I was one of the funeral party celebrating the life of a friend . I will certainly be popping back to enjoy the excellent food again

site_logo

vincent f . 2024-10-21

MORE AT TripAdvisor

Food was excellent and service very friendly we would highly recommend

site_logo

George Escott . 2024-10-17

MORE AT Google

Beer, service and salt beef sandwich good. Ploughman’s OK. Asked if the mushy peas with fish and chips were the real thing, not the minted variety. Answer was “we make our own”. Yes, they do, by mashing garden peas! Not the same at all. Chips and fish were frozen. Parking is now limited due to house building using parking space.

site_logo

Chris Johnson . 2024-10-09

MORE AT Google

Lovely pub inside and friendly polite staff. Unfortunately waited an hour from ordering our meal, and the belly pork was supposed to come with mash but didn't. When checked afterwards the mash was rubbed off the menu board, no explanation or offer to change order or reduce the price.

site_logo

Della Evason . 2024-10-02

MORE AT Google

Fabulous food, lovely pub and excellent waitress. The really sad part is we couldn’t tip the waitress as they couldn’t put it on a card, and we didn’t have any cash with us. The waitress was delightful the pub was really lovely and cosy and the food was excellent. A very welcoming Pub.

site_logo

Jacqui Woodham . 2024-09-30

MORE AT TripAdvisor

Enjoyed a lovely lunch with my great Aunt Dawn Hogben (91), who is a local. Great food and friendly staff

site_logo

Aaron Petersen . 2024-09-27

MORE AT Google

Stayed at the campsite opposite. Had a couple of beers, bottle of Rioja, fish & chips and gourmet burger. Food was fabulous and big portions. Waitress and barman were friendly and professional. Highly recommended!

site_logo

james bardner . 2024-09-23

MORE AT Google

Fantastic afternoon at this little gem of a pub. Very sorry to read the comment of the gentleman we observed being attended to by the landlady.His review claiming his shaving scars took president over a dog that had gone to the loo on the pub grass is so very distorted.The landlady was attending to this gentleman ,offering him cotton wool for theblood that was running down his face and was all over his shirt.His rude manner is totally unjustified and she swiftly attended the garden with a poo bag directly after attending to a customer she obviously felt needed or thought needed help.! We will definitely return again soon

site_logo

Samantha A . 2024-09-22

MORE AT TripAdvisor

Stopped here as a visitor to the area, mainly to eat. A prebooked table for 7.30pm found us arrive at 7.10pm. We were shown to our table and were met by a charming young man who was front of house, waiter, et al. He explained the kitchen was very busy and did we mind waiting until our alloted booking time until he brought menus and took our orders. I liked this, how many other places would have just left us hanging, he then arranged for an equally pleasant lady from behind the bar to come and take our drinks order. At this stage I have to commend the three people who staffed the bar and waited on our table, what an absolute joy you were to deal with, you mixed personality with an efficient and professional approach. Whilst waiting we took the opportunity to look around and found a vibrant, noisy pub, that claims be dog freindly, that's an understatement...I counted at least six dogs of which at least four were just wandering around the pub, I love it, may not be to everyone's liking but I don't know how usual an event this is. What I'm trying to describe is a busy freindly local pub in which I felt entirely at ease. ...The food I had whitebait small well cooked and tasty. Main was pork belly with onion gravy, creamed leeks and apple, outstanding. In summary, the menu is pub fare, of good quality and well cooked and presented. I would highly commend this place for the, staff, food and customers. There is a sign at the back of the bar...'Be nice or leave'...no one left.

site_logo

Andrew H . 2024-09-20

MORE AT TripAdvisor

We were full of hope, the sign outside indicated that food was served every day. Unfortunately, the kitchen was closed for the umpteenth time this holiday and nothing was served. And we can't make the return journey to the mainland on just a few drinks. Missed opportunity for the Black Horse Inn.

site_logo

Jolanda Voetman . 2024-09-16

MORE AT Google

From the time we entered the place the service was excellent and the food was exceptionally good. The character and the decor of the place was very relaxing. Thoroughly enjoyed it and will be going again.

site_logo

Richard Edmonds . 2024-09-14

MORE AT Google

It's a great local pub. Smartened up now. Poppy is a great waitress. Charming and funny. Food is good pub grub..

site_logo

gavin hay . 2024-09-12

MORE AT Google

Had a meal here last night Thai red curry, absolutely no flavour and had to add lots of salt to give it any taste. One waitress was lovely the other was quite rude talking as if we were an inconvenience. Locals are allowed to sit and vape which is apparent legal but never seen this in any other pub I’ve been in . Not somewhere I would recommend.

site_logo

lynda . 2024-09-07

MORE AT TripAdvisor

Stopped by for a quick sandwich, absolutely delicious will definitely go back again.

site_logo

Lloyd . 2024-09-06

MORE AT Google

Great pub, food was really nice. Excellent customer service from all the staff who were friendly and helpful. Will be returning.

site_logo

Ann Tomlin . 2024-09-06

MORE AT Google

Lovely friendly locals pub serving great food. Stayed almost opposite in the campsite so close to the Port of Dover.

site_logo

Gill Rutherford . 2024-09-05

MORE AT Google

Sat outside, lovely patio area at the rear with a parking area that is not obvious from the front but up the side of the pub. Food was excellent and reasonably priced with excellent service. Would recommend.

site_logo

A Wasp . 2024-09-04

MORE AT Google

Arrived late as we had an early morning shuttle....what a find, very dog friendly, lovely food, not too expensive.. Will definitely be back

site_logo

Alison Turner . 2024-09-02

MORE AT Google

What can I say we were bowled over by the fantastic. Staff and landlady the reception and service were 2nd to none ....and the food was fabulous ..finished off by a huge cheese board sharer ...we didn't have a reservation but instead of turning us away as they were fully booked they spoke to the kitchen staff and started their evening service earlier so they could accommodate us ..I can not recommend this place enough it's a 20/10 from us Many thanks Karen and David Heathman ❤️

site_logo

karenle9 . 2024-08-29

MORE AT TripAdvisor

Bit of a shame - the pub was severely reduced in n capacity for an evening meal and couldn’t fit us in. Maybe if we go back it’ll be a better experience.

site_logo

Mark Taggart . 2024-08-27

MORE AT Google

What a pub! Michelle is a fantastic landlady, she is running the place to such a high standard and makes everyone feel so welcomed. It has a lovely vibe about the place, filled with happy people, happy dogs roaming free, delicious food & expertly prepared drinks! There was also a live singer in there and he blew us away! We will absolutely be returning!

site_logo

Jo M . 2024-08-26

MORE AT TripAdvisor

Great pub, very hospitable and great staff!

site_logo

Reade Commins . 2024-08-24

MORE AT Google

Excellent, friendly pub with welcoming staff ( and customers) food was superb, highly recommended

site_logo

John Farrow . 2024-08-22

MORE AT Google

Lovely country pub with a good menu and huge portions!!

site_logo

Alison Quarrell . 2024-08-16

MORE AT Google

Fabulous. From walking in to leaving we were made to feel so welcome. 2 lads front of house were friendly and could not do enough for us. We had been in twice during the week for drinks as we were staying at the caravan site across the road. Thursday night we said we would eat out and wow was just the best decision. Then did quiz after which was so much fun. Fabulous pub, great staff and land lady cannot recommend more highly

site_logo

Alison . 2024-08-15

MORE AT TripAdvisor

the service was very good. And the atmosphere was nice. But the food was horrible. starter (brie wedges) were sir on the outside, cold on the inside. Main course (seafood languid) was inedible. There was really something wrong with this dish, it was not fresh and very badly prepared. My husband was sick all night. On the campsite this pub was not on the list of places to eat in the area. We now understand why. You better walk 30 minutes further. Hopefully they will find a better chef soon.

site_logo

Bet Avetisyan . 2024-08-09

MORE AT Google

4/5 voor gezelligheid en sfeer. 0/5 voor kwaliteit eten. Bij de camping staat het niet bij de suggestielijst pubs. We weten nu waarom.

site_logo

Kigor . 2024-08-08

MORE AT TripAdvisor

Lady owner was clearly drunk as one of the other reviews said I didn’t get the meal I ordered,sausages were like leather,we asked for a partial refund which we received after a big heated discussion when she got other local customers involved, she insulted my Wife who hadn’t even spoken a word to her. Disgusting behaviour from Owner,staff were nice though. She said don’t come back 😀

site_logo

Brian Saunders . 2024-07-31

MORE AT Google

Had the special gammon egg and chips bit what arrived was sliced cold gammon ham, hardly a 'special' very disappointed and won't be returning.

site_logo

John Davey . 2024-07-31

MORE AT Google

When we arrived at the pub, we were greated by the owner who was happy to take our booking for a table. We had a good conversation about a new gin she had and how we should try it, we were told to sit in the garden as we had to wait about 45 mins for a table which was fine, when it was time for our table, my partner went in to ask how long it was going to be, the owner then said who are you, i dont recognise you. (Clearly drunk)She then said that we wouldnt be getting any food as they were fully booked, there was a family that came in after us that got served their food, she said the best she could do would be to give our 8year old some chips as he was starving after sitting there for nearly an hour and a half, that was fine but my 12year old, me and my partner couldnt eat, such a shame we didnt get to try the food as it looked really good. We left with a sour taste and a very hungry family, thanks for our experience

site_logo

paul pfundstein1 . 2024-07-27

MORE AT Google

Warm atmosphere, order taking and good service but be careful of the large quantity of FISH N CHIPS for small appetites.

site_logo

Vincent BIGNON . 2024-07-26

MORE AT Google

A wonderful evening with nice service!

site_logo

Oliver Faßbender . 2024-07-20

MORE AT Google

Local pub, so handy for me to walk to.

site_logo

Andy Lingwood . 2024-07-18

MORE AT Google

Super dog-friendly, nice boss, super nice girls in service. Food great! Real pub atmosphere with cool regulars. We had the perfect last evening before heading back to Germany!

site_logo

Anna Theuerkauf . 2024-07-16

MORE AT Google

Very tasty food and drinks. Nice beer garden. Extremely dog ​​friendly! Super nice staff - Josh is a top waiter!

site_logo

Tanja Roth . 2024-07-08

MORE AT Google

Great pub. Warm welcome, we didn't eat but the food we saw coming out looked really nice. Nice garden area out the back too.

site_logo

shanndy70 . 2024-07-08

MORE AT TripAdvisor

An excellent meal with excellent service! The staff were very friendly and helpful, thank you for a lovely evening! 😊😊

site_logo

helen t . 2024-07-08

MORE AT TripAdvisor

Wouldn’t serve us until 1pm however we were sat down at 12:30pm. Wouldn’t give us a menu until 1pm for some strange reason either. The service was so slow was there for two hours. No bottled water and the food was awful. Chicken was dry. Muscles were rubbery. Nut roast was like slop. Potato’s and carrots were burnt.

site_logo

D . 2024-07-07

MORE AT Google

Excellent welcome and friendly staff, Sunday Roast was lovely. Highly recommend.

site_logo

james hawes . 2024-07-07

MORE AT Google

Top pup, super nice staff and the food is very good.

site_logo

Markus Wunderli . 2024-06-29

MORE AT Google

Great little pub. Perfect stop off in conjunction with the nearby CAMC site for the eurotunnel. Great food and staff

site_logo

Bethany Aston . 2024-06-22

MORE AT Google

A small gathering involving two of my brothers plus wives had an evening meal & drinks. Food served was excellent (belly pork was superb). Staff were attentive and extremely friendly. We decided to enter the pub quiz & won which topped off our evening. We thoroughly enjoyed ourselves so much so that we intend to visit in two weeks for a Sunday roast. Well worth a visit, owners and staff are super friendly. Thank you guys for a great evening.

site_logo

Gary L . 2024-06-21

MORE AT TripAdvisor

First visit to the Black Horse, we were looking for lunch and happened to be passing, great welcome sat in the new garden with our dog and had the best lunch, great food and service, will be back.

site_logo

Glenn Covell . 2024-06-17

MORE AT Google

Went for lunch on Saturday, was delicious. Coleslaw was some of the best I've ever had!! Enjoyed it so much that we went back for Sunday Roast dinner. Beef was so tender, roast potatoes crispy, couldn't fault anything The pub has a lovely friendly, welcoming atmosphere, all the staff were lovely. Would definitely recommend.

site_logo

Eileen Fletcher . 2024-06-17

MORE AT Google

lovely cosy little pub with good food and friendly staff

site_logo

Ali . 2024-06-13

MORE AT Google

What an amazingly friendly pub. The menu was lovely, I chose the Hug in a bowl. This was delicious 😋 My hubby chose sausage and mash, he thoroughly enjoyed it. The waitress Lucy was so lovely. Engaging, friendly and so sweet. There was a motto over the fireplace that stated 'No strangers, just friends you have yet to meet' so true. Ended up chatting with a lovely German couple who had just completed a 2 week holiday in Wales, a couple from London and a couple heading off to France tomorrow. All lovely people and felt like friends by the time we left. This is a dog friendly pub and that obviously draws people in. We had not pre-booked but were able to get a table after about a 40 minute wait. The food was AMAZING! If you are down thus way, book and enjoy the friendly atmosphere.

site_logo

hedgie edwards . 2024-06-12

MORE AT Google

We arrived too late to eat on a Sunday but the young lady behind the bar couldn’t have been more helpful. She gave us takeaway menus then advised us which were best and finally gave us plates and cutlery to enjoy our meal. She also put the TV on so that we could watch the SoccerAid footy match. What a great service and lovely bar staff. Couldn’t fault our experience.

site_logo

Lesley Robinson . 2024-06-09

MORE AT Google

Family gathering, ploughman's lunch with a nice beer very enjoyable

site_logo

Graham Hartney . 2024-06-06

MORE AT Google

Excellent little pub near to campsite. Host very friendly. Never managed to arrive early enough to get food but was allowed to order takeaway. Definately stopping here again

site_logo

Vikki Hackett . 2024-06-03

MORE AT Google

Nice meal in Blackhorse yesterday evening. All staff polite. Young waitress worked very hard. Place was full, so glad we’d booked. Well worth a visit.

site_logo

Elaine Offen . 2024-06-02

MORE AT Google

Incredibly welcoming and hard working staff; food was excellent pub grub. Highly recommended.

site_logo

Hugh Blackman . 2024-05-30

MORE AT Google

Lovely experience. Great food and very nice surroundings with welcoming staff.

site_logo

Tony Bentham . 2024-05-23

MORE AT Google

Dropped in as we were staying nearby and I am so happy we did ! Lovely atmosphere , great friendly staff and fabulous food. Couldn’t be happier

site_logo

fletch . 2024-05-14

MORE AT TripAdvisor

We enjoyed our sunday roast and popped in again in the week very nice..

site_logo

Steve Jaguar . 2024-05-09

MORE AT Google

Always visit on way to France and return. Always had a good meal, this time it was excellent. Lamb & curry were both excellent. What made it, was the excellent and friendly staff. We booked a table and got there early due to ferry it was no problem. The meals came a lot quicker than before. Well done to you all.

site_logo

Pat D . 2024-05-03

MORE AT TripAdvisor

We forgot to book for dinner as we had done before. Turned up at 5.30pm to be told that all the tables for the evening service were full until about 7.30pm. We were starving after a hard days drive. Fortunately the lovely lady said that the chef would feed us before the main service started. We had fish and chips which were excellent. Very many thanks. We’ll book in future!

site_logo

929Birder . 2024-05-01

MORE AT TripAdvisor

What a charming pub restaurant, very friendly and efficient service from all the staff. It felt like you were regular. Good honest pub grub! We will be back,

site_logo

AndyReflect . 2024-04-27

MORE AT TripAdvisor

Lovely pub with good atmosphere and friendly staff. Best Sunday lunch for a long time.

site_logo

john pearson . 2024-04-23

MORE AT Google

Great local pub - lovely food and staff. Recommend the fish and chips and cheesecake.

site_logo

J Lo . 2024-04-22

MORE AT Google

It was our first visit to The Black Horse after many years. We had a Sunday roast which was hot, really tasty, plenty of vegetables and the beef was superb. Service was great and our waitress was friendly and attentive. Good pub atmosphere and very welcoming. Highly recommend.

site_logo

Anne Bensted . 2024-04-15

MORE AT Google

Had a lovely lunch first class service. Food was delicious. Highly recommend. We will be back soon

site_logo

Michelle Dennis . 2024-04-12

MORE AT Google

Really friendly & welcoming pub. Amazing food, thanks chef! Great service too, and always the first choice place to bring our dog.

site_logo

Jeny N . 2024-04-08

MORE AT Google

On one of the websites for the black horse in Folkestone it states that food service on a Sunday is till 9 pm but when we arrived at 4:30 pm we were informed by the bar staff that the kitchen closed at 3pm. This is false advertising and a very early close for a kitchen.

site_logo

Gabrielle Watson . 2024-04-08

MORE AT Google

Had food on Saturday, booked in advance. Food was excellent and friendly staff, however it took 1 and a half hours to get a main course which is not acceptable. I know the chef was new to the establishment, and his food was lovely, but it should not have taken so long from first ordering. I did notice that other people who sat at their table after us got there food before us which was disappointing.

site_logo

Paul Bayliss . 2024-04-04

MORE AT Google

Went for Easter Sunday roast, the meat version was fine however my vegetarian meal was just a plate of vegetables. not even a Yorkshire pudding or stuffing ball. The vegetarian option was overcooked watery cauliflower with a bit of cheese on top.When asked how our meal was I was honest and said that I was disappointed and made a few suggestions on how to make vegetarian roast equivalent to the meat one as it was only £1 cheaper. I suggested adding veggie sausages or quorn fillet as the meal currently had no protein to replace meat. We were polite and friendly in our suggestions. The landlady became very defensive and irate and said 'I don't do protein, I am not a health freak" .She then accused us of trying to get a free meal which was not true, we were simply making suggestions to imake the vegetarian optoon into a roast dinner rather than a plate of plain vegetables. The landlady went back to the bar where she ranted to staff so that the whole pub could hear. We quickly paid and left to get away from the toxic atmosphere.

site_logo

Louise Bartlett . 2024-04-01

MORE AT Google

I read the other reviews and I see this place is obviously liked by many. We went for a roast on Easter Sunday. I think the place has great potential however we had an issue with the vegetarian roast, it was basically us making a suggestion as the roast consisted of vegetables, 3 roast potatoes and some terrible cauliflower cheese which was really watery. The pork roast was actually ok with additional stuffing and crackling. The owner was not very receptive stating we could make requests- is this the norm for customers to make requests? When it was suggested a protein addition was needed for the roast we were told she wasn't a health establishment and she didn't really care about protein. I was shocked by this! She then really took the biscuit when she made a suggestion that we just wanted a free meal so I kindly asked her not to accuse us it was merely a suggestion that the vegetarian roast needed some work. The website also still states it's a vegetarian wellington which we were told was the old website.... Change it then! Overall the owners attitude was disgusting, you discounted the meal by £3.50 which we were told was the cost of the cauliflower cheese... I am lost for words. After speaking to the owner we were so disgusted we went to the bar to pay rather than wait at the table, we overheard the owner speaking to the bar staff about us, extremely unprofessional. When we went to pay the lady at the bar asked how things were despite the owner clearly speaking about us to her, my mum just explained that she had already spoken to the owner. She tried to push for an answer but by this point we had both had enough and just said it's best to leave it and wished her a happy Easter. The owner cannot take criticism, she's nice as pie as long as you don't complain!

site_logo

rosieb712 . 2024-03-31

MORE AT TripAdvisor

We had a lovely lunch there today. Food was very tasty. Service was good. Dog friendly. Could not fault anything.

site_logo

Andrew Simner . 2024-03-29

MORE AT Google

Stopped on a whim for a spot of lunch, so glad we did! A wonderful little pub, dog friendly, lovely locals and staff that made you feel really welcome. Food wise we had scampi and a ploughman's followed by sticky toffee pud and a salted caramel cheesecake - can't fault anything we ate it was all 10/10 and the prices very reasonable. Never been here before but will certainly be going back.

site_logo

House with the Green Door . 2024-03-24

MORE AT Google

Similary restaurants in South East

restaurant_img
4.2

1298 Opinions

location-icon2 High Street
British
outdoor_seating_139850takeaway_139850delivery_139850

Pop in here after walking from Charing across the fields. Lovely friendly staff , lovely seating areas at the front and back of the pub..We shared a meat/cheeses platter and homemade nachos which were the best I've had for a long, long time.

restaurant_img
4.2

520 Opinions

location-icon19-21 Rendezvous Street, Folkestone CT20 1EY England
British
outdoor_seating_258561takeaway_258561delivery_258561

Shout out to the blonde male that served us. Six of us have just been for lunch and all thought his customer service was outstanding. Professional but relaxed, welcoming and attentive. Food was amazing; clean, fresh and well presented. Cocktails tasty.

restaurant_img
4.2

679 Opinions

location-icon124 Sandgate Road
British
outdoor_seating_144259takeaway_144259delivery_144259

Excellent food. Quick and warm service

restaurant_img
4.2

293 Opinions

location-icon3 George Lane
British
outdoor_seating_144379takeaway_144379delivery_144379

wonderful place, came here after tiring and disappointing day of fossil hunting and the service and food just blew new life in me. unforgettable and can't wait to return again.

restaurant_img
4.2

93 Opinions

location-iconThe Parade, Greatstone England
British
outdoor_seating_261540takeaway_261540delivery_261540

Only one in bar and a bar person ignored me for two minutes so I asked if they were open and got told could I wait a minute! Not exactly busy were they and when I did get served she didn’t even say thanks ! The beach at Romney sands is full of litter maybe the holiday camp could get some people to do a litter pick as most of the rubbish was from their children’s stuff they sell in the show bar