GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.3

Based on 656 opinions finded in 2 websites

site_photo4

Nº 262 in 581 in Warwick

Nº 9 of 16 Asian in Warwick

CUSTOMERS TALK ABOUT DISHES WITH..prawnnoodlescookedmeatsoupchillicurryorientalprawnsramenricespicyeggfriedporkchickenduckribs

comment_iconOpinions

Fast. Cheerful. Unpretentious. Meat undercooked.

site_logo

Jon Pyne . 2024-12-14

MORE AT Google

Not your typical Chinese restaurant. They have a small mixed menu, mostly noodles. Food was okay but nothing impressive, ended up there as other local Chinese closes early for lunch. Menu can be confusing and communication with staff is challenging…

site_logo

W T . 2024-12-08

MORE AT Google

Very quick and delicious! The food arrived in less than 10 minutes. Great value for the price, very satisfied.

site_logo

Eugen “Kam3rad” . 2024-11-06

MORE AT Google

Wo talot of Fun with great pork katsu and noodles.

site_logo

John Williams . 2024-11-05

MORE AT Google

Great noodle place, seems very authentic and decent prices too.

site_logo

Ben Jaggard-Smith . 2024-10-30

MORE AT Google

AWFUL. had hoped to come here for a cute meal with my friend however it had turned out the complete opposite. as walking up to the building we had seen the chefs smoking a cigarette out the front right next to the building which is very unprofessional. midway through eating our meals, we had then clocked on and realised that the blue gloves the chefs had been wearing to smoke a cigarette were the same gloves they were cooking in which is a MASSIVE health and safety bazaars. When entering the restaurant we had got seated to our table. the server was staring us down like a hawk and felt as if we were being heavily judged and watched. don’t want to make it sound like a race thing but considering we were the only white people in there and we’re the only ones being stared down by all the waitresses, seemed a bit bias. i had called the waitress over and had asked if she would be able to describe what each sauce tasted like due to her not knowing what they tasted like, the waitress has proceeded to describe them but in a very angry and annoyed tone. she had then rushed us when we were ordering. starters had came out, disappointed on the king tempura prawns, and the mains were brought out midway during we were eating our starters. when she had placed the mains down she had told us to move our starter places out of the way. in the end we had got one of the soup noodles taken off the bill due to none of it being eaten, however when asked to they had been awfully rude and disrespectful after. not 100% sure if it’s down to the language barrier, but when asking to take one of the meals off the bill multiple times, it felt as if they had purposely ignored us due i had tried my best to make it clear about 5 times to both staff members who had come over but they had proceeded to ask if we wanted to take it home. felt completely ignored and neglected. When coming over with the bill, mints and the printed receipt had been chucked and slammed on the table. we were paying separately one by card and one in cash, she had seemed very annoyed and angry at the fact i had asked for a meal to be taken off and when paying. overall i would not reccomend coming here at all, food was awful aswell as service, did not feel comfortable at all from arrival. will NOT be returning.

site_logo

Tia C . 2024-10-29

MORE AT TripAdvisor

This is one of our favourite places to eat in Leamington Great service and really great food, really good value for money

site_logo

Clare Buckley . 2024-10-20

MORE AT Google

Lovely food but very cold inside. Basic eating areas. Friendly staff. £15 ph including drink.

site_logo

Jo H . 2024-10-12

MORE AT Google

Even level 1 spice was so incredibly spicy that I couldn’t fully enjoy or finish my tom yum. Can’t imagine what 2 or 3 must be like. Other than that, the soup was delicious from what I could taste :’)

site_logo

Birce Deren Sezegen . 2024-10-06

MORE AT Google

I absolutely love the food here.

site_logo

divya baranwal . 2024-09-26

MORE AT Google

Authentic Hong Kong food, delicious.

site_logo

Stanley Yau . 2024-09-21

MORE AT Google

It provides excellent food, Hong Kong style taste, attentive service and reasonable prices. It is recommended that if you go to Royal Leamington Spa for vacation or work, please try dining here if you have time. It may bring you unexpected surprises.

site_logo

Wc koo . 2024-09-14

MORE AT Google

Good hearty food at amazing prices. No frills. I would eat there every day if I lived in Leamington!

site_logo

Jonathan Fletcher . 2024-09-12

MORE AT Google

This place is an inspiration to others chinese/Asian restaurants trying to make it in the UK... it's authentic, delicious and affordable, the chefs actually care about the food they serve. I haven't ordered a starter for ages in other restaurants because of the price, I ordered two here and nearly a third (luckily I didn't because I was soo full by the end 😅), they were both cooked perfectly and had bags of flavour. I might eat at other restaurants once every few months, if that, but here I will be returning regularly and hope everybody else does too. Everything they are doing here is spot on and I could go on about it but just go and try for yourself 🙏

site_logo

Danny Healion . 2024-09-05

MORE AT Google

Was enjoying the food then to my horror two chefs aprons hats on smoking out the drink with blue plastic gloves still on. Food not ate. Left. Why on earth would you light a cigarette out the front with your plastic gloves still on…. I tell you why because you’re not going to charge them. It’s unhygienic I’ll pass on to council but they’re clueless to it as well. If your outside your “ Disposable “ gloves should be taken off and put in bin. Won’t use the place again and I’ll photo next time I see this. It’s wrong, against health and safety rules and disgusting

site_logo

Bozzy Y . 2024-09-04

MORE AT TripAdvisor

Such good value for money! Staff were super hardworking and hospitable and the the food was great. We’ll definitely be coming back :)

site_logo

Emma Buckley . 2024-08-19

MORE AT Google

Great food as always and they were really helpful with dishes going the extra mile too serve rice at last minute 😋, friendly service as always and great atmosphere 😀 ♥️💜💚X

site_logo

Jonny cash . 2024-07-21

MORE AT Google

One of the best places in Leamington for tasty food at a decent price point

site_logo

Discrepio . 2024-07-12

MORE AT Google

The food is v nice but the waitress awful. She refused to give us a extra cup with the tea for my little girl. We were regulars and have spent lots of money on the lovely food but we ll not be returning.

site_logo

Mihaela Burcan . 2024-07-01

MORE AT Google

We were staying in Leamington Spa for the International Bowls event and walked past Wofon the first night. After a quick search on tripadvisor, we decided to try it, and hand on heart, one of the best food related decisions I've ever made. The service is very quick, the staff are very smiley and helpful (recommending dishes from the menu to us) and the food is first class, genuinely the best chinese food I've had on these shores. Price wise, this place blows most local food places out of the water, we had 2 starters, 2 main meals and 2 drinks........ £35. So So Impressed with the quality of food here, if it wasnt 330 miles away from here, I'd be back instantly!!

site_logo

Craig A . 2024-07-01

MORE AT TripAdvisor

Had ordered Katzu Chicken with Rice. Absolutely delicious. They also added some broth/soup in my delivery bag, it was divine.

site_logo

Amac Sgt . 2024-06-26

MORE AT Google

I had been meaning to go here for ages and it didn’t disappoint. Service was great and the staff were very helpful. I had the Wofon house special noodles, and Wowsers, it was delish! Can’t wait to go back again as all there dishes looked tasty. Great value too

site_logo

Jonathan Ridyard . 2024-06-18

MORE AT Google

The finest noodles in the Midlands does it justice. Incredible value for the quality of food you get. A really varied menu. Fully customisable dishes to your taste. Our go to place in Leamington!

site_logo

Nathan Sanders . 2024-06-15

MORE AT Google

Traditional Hong Kong cafe style food! We all love the staff and the food.

site_logo

Shugs Barker . 2024-06-12

MORE AT Google

Friendly staff. Delicious Food. Taste of Hong Kong~🥰🥰

site_logo

Ck Tam . 2024-06-03

MORE AT Google

Good food. Nice staff. Drinks and a main is under £15 together Definitely recommend getting a starter!! Such as the chilli salt wings Any issues the staff will always help you out. All the staff are great !! Recommend the prawn crackers for any dish you get. Theyre fresh and hot.

site_logo

Amber . 2024-05-21

MORE AT Google

First time I thought my fault as chose a dish way too hot I sent it back. Although I make the same dish and it’s not that hot.? Starters were very greasy. As I was in Leamington I Thought I would try it again as a take away. I asked for non spicy so advised on what to have. I have just tried it and It is so bland I will have to cook it again adding more seasoning's . Not something you should need to do at home after buying take away food and if I was there it would have gone back again. I can cook better Chinese than what I have had here twice now.

site_logo

Steve Simmons . 2024-05-21

MORE AT Google

Food is great 🔥 This place has the best Tom Yum Soup I have ever tried. With different levels of spicy (I like spicy) and full of flavour. I attached a picture of my Tom Yum Soup. It is so delicious that really makes you happy. The service is great and the attention is quick.

site_logo

Kiara Guzmán . 2024-05-15

MORE AT Google

Great food and I go try to go often! All dishes are good but for me is FER, fried rice. The only down is in my opinion it was nicer when no soy sauce was added and it was white rice 🤤🤤🤤

site_logo

Rick M . 2024-05-02

MORE AT Google

I love this restaurant I'm a regular customer. The noodles are fantastic 😻

site_logo

Kitty Kaur . 2024-04-19

MORE AT Google

Always excellent. Our favourite.

site_logo

Jeremy Ley . 2024-04-08

MORE AT Google

Amazing! Hong Kong food style of hawker stalls. Iconic HK wok frying!

site_logo

Aa Kw . 2024-04-08

MORE AT Google

Lovely spare ribs and main courses- soup with noodles delicious. £90 for all five with drinks-excellent value and staff were great too. We shall return soon

site_logo

747jap . 2024-04-07

MORE AT TripAdvisor

Lovely tasting food, very authentic. Our greeter wasn’t the best, the rest of the staff were nice though. Portion sizes were large, I struggled to finish my rice. Best thing is pretty much all meals are £10 give or take a £. Starters are around £3-5. Drinks were reasonably priced too. They have a couple of beers or wine to choose from if you fancy an alcoholic beverage too. Overall a good experience but mainly because the food was so delicious.

site_logo

Kate Sinscou . 2024-04-05

MORE AT Google

Could have been better. I asked something with a bit of spice and ended up not eating the meal it was so spicy hot. I love spice but this was hotter than anything I had ever eaten. Maybe you may like this. But this was not for me. Service was ok but the waitress disappeared as soon as I had my food. Maybe the rest is ok and this was a one off but (pun not intended) it left a bad taste for me. I hope this is just me!

site_logo

Dave Humphrys . 2024-04-04

MORE AT Google

Very good food with great prices. The staff is super friendly and we really enjoy going there.

site_logo

Lisa . 2024-03-29

MORE AT Google

Bit of a wait for food, however great price and food quality was good. Menu was a little confusing it first, however pictures provided of some options to help

site_logo

Kevin Smith . 2024-03-29

MORE AT Google

Good Asian food for a weekday night out, the prices are very good and the food is very tasty. The service can be slow and sometimes we have had issues with our orders, particularly with large groups, but the food is worth it, especially if you are looking for something casual and tasty food. Great value for money.

site_logo

Juan Sebastián Moncayo . 2024-03-21

MORE AT Google

Brilliant food and service, unpretentious, authentic and delicious. The brisket of beef obviously cooked for hours and melted in the mouth

site_logo

scott williams . 2024-03-21

MORE AT Google

This place is awesome! Every time I visit Leamington spa I try to fit in a lunch or dinner here!

site_logo

nrooneydc . 2024-03-15

MORE AT Google

Great place to eat. Service is good, the staff is very friendly. Enormous portions for a great price. Would definitely recommend!

site_logo

Miguel Valenzuela . 2024-03-08

MORE AT Google

Took my children for a meal here. The surroundings are a bit utilitarian but this just adds to the authenticity. The menu is not massive but covers all tastes. The food was excellent and generous in portions. I had the duck salad to start which was very good, followed by thin rice noodles with roast pork and vegetables that was also excellent. My two had the crispy chicken wings and crispy fried chicken to start and then one had udon noodles with prawns and the other had rice with chicken in a very spicy sauce. All very good and three starters, three mains and drinks came to a fraction over £50. Excellent value for money. Will definitely go again.

site_logo

Adrian Ray . 2024-03-03

MORE AT Google

Food was really good and value for money

site_logo

GUNDAPANENI VAMSHI . 2024-02-17

MORE AT Google

Although the name is "Japanese style", the most attractive thing is the Hong Kong style taste. I ordered Hong Kong style curry beef brisket rice and scallion oil yakisoba, which are the same as those in Hong Kong. I’ve also tried Japanese coffee, rice, and ramen, which are also good. It would be perfect if you have Hong Kong style milk tea

site_logo

ka lung cheung . 2024-02-17

MORE AT Google

Very high quality dishes despite the busy environment. Waited for more than 30mins, but it's totally understandable since it's lunar new year, and I tell you it's totally worth the wait! We ordered Tom Yum Soup noodles with roast duck. The soup brought me back to Thailand at once, so flavorful, right amount of spiciness and sourness, exactly the same as what I had in Thai. Lots of veg in there as well, all cooked perfectly! Another dish was stir fried noodles with Wonfon special toppings (highly recommend!). There's prawns, char siu (roast pork), chicken and beef (super tender), very generous amount, so good!!! The noodles were filled with wok-hei, very aromatic. I will really revisit this city just for this restraurant!!

site_logo

Chloe HT . 2024-02-10

MORE AT Google

We enjoyed the starters but unfortunately found our mains very bland. Service was great just wouldn't recommend the food.

site_logo

Melanie Goode . 2024-01-30

MORE AT Google

So authentic! If you want a really Chinese or Asian restaurant experience then Wofon is the place for you. It's also well established, been going for many years

site_logo

Craig Colledge . 2024-01-28

MORE AT Google

This place is always our go to, if we fancy something cheap but delicious! Service is quick, efficient and friendly. Their ramen style noodle soups are always a winner!

site_logo

Sim . 2024-01-19

MORE AT TripAdvisor

Amazing noodle soup, packed with flavour, protein and vegetables. Will definitely be back.

site_logo

Stephanie . 2024-01-19

MORE AT Google

Huge compliments to the chef. Best ever Chinese food I had recently. We will be definitely be a regulars here.

site_logo

Janos Selmeci . 2024-01-13

MORE AT Google

On a overnight stay in Leamington Spa we decided to try Wofon noodles restaurant. Trust me and my other half have decided you will not find a better place to eat your noodles or rice. Starters are sublime. Mains are delicious. We ordered twice as much so we could take their delicious food home with us. My partner sat and watched our food being cooked in a spotless open kitchen. Whilst waiting we were given a glass of water each to drink, which was appreciated by us. On leaving our server, and all the people cooking said goodbye as we left. Support a family business rather than the bland expensive big franchises. Eat fresh cooked food. Thank you Wonfo for our delicious food, we will be back. 😁😁😁

site_logo

Donna Weston . 2024-01-08

MORE AT Google

My favourite Tomyum soup noodles Thai style ⭐️⭐️⭐️⭐️⭐️

site_logo

Jira Chairat . 2023-12-26

MORE AT Google

Casual place, food tastes amazing for the price point. No protein source for vegan/veggie options though.

site_logo

İpek Şahbazoğlu . 2023-12-05

MORE AT Google

Great find in Leamington with new chefs and main meals have become more choice and very tasty for good value!

site_logo

James Sinkinson . 2023-12-03

MORE AT Google

Absolutely love this place! Authentic, cosy, and friendly! I visit every time I’m back from Hawaii or mainland US, visiting family, and it never disappoints. The food is amazing, the atmosphere great, and the staff very friendly. Love love love it!! (just make sure to order extra spicy, cos the spice levels are tailored for my fellow white folks). I highly recommend this place to any Asian/Hawaiian peeps that are wanting a taste of home.

site_logo

Christopher . 2023-11-24

MORE AT TripAdvisor

Super delicious, irresistible! I ordered a Dong Yum Kung noodles with Wofon Special ingredients. It was another level above Thai style. Super hot and spicy. I just tried Level 1. Fresh food and the soup were great matching. Must try.

site_logo

Tony . 2023-11-18

MORE AT Google

Best Tom Tom Soup in the UK! This is real, they really know how to do it. Amazing food!

site_logo

David Bautista . 2023-11-14

MORE AT Google

Affordable and delicious restaurant and takeaway, they have rotating specials and the food is delicious

site_logo

wyatt powell . 2023-11-10

MORE AT Google

Absolutely outstanding. Tasty, fresh, well priced food and excellent service. Quite simply faultless. By no means a fancy restaurant, but if you are after delicious Chinese food at a great price, then you’ve come to the right place!

site_logo

Adam B . 2023-11-07

MORE AT TripAdvisor

Fabulous find on a chilly Monday evening. We wanted a difficult off-menu request (bean sprouts, vegetarian and not spicy) and we were cooked a wonderful starter of gyozas followed by noodles with amazing vegetables and lots of bean sprouts in a very tasty sauce. A great formula - simple decoration, friendly staff, and quickly cooked food. Will definitely be returning again soon and will heartily recommend.

site_logo

CazK321 . 2023-10-16

MORE AT TripAdvisor

This is a great new addition to leamingtons restaurant scene, whilst only a small restaurant, its food is fantastic and a lot of choices to choose from, it gets very busy, and staff are going as quickly as they can, so please be patient if things are taking a little longer. Price are excellent, and suitable dor most budgets.

site_logo

Gary McCarthy . 2023-10-14

MORE AT Google

Nice food and service but nothing that special. The atmosphere is dark and loud as it's an open kitchen with large extractors which sound like they are on full blast all the time.

site_logo

Hejie He . 2023-10-10

MORE AT Google

Girls and I went for a meal last night it was amazing food service was great lovely people definitely be back to try 3 more different dishes as what we had was lovely thanku

site_logo

Sharon Neal . 2023-09-29

MORE AT Google

Nice Asian restaurant. Went for lunch, quick to serve, very friendly, great food and not too expensive. I'll come back 😊

site_logo

Michael G. . 2023-09-13

MORE AT Google

This lovely restaurant provides authentic Hong Kong style cuisine - with good quality of food & tasty dishes!!!

site_logo

Sandy Yuen . 2023-08-28

MORE AT Google

香港好口味! 廚師是米芝連級數的,食物品質及味道就係香港地道,必吃乾炒牛河,星洲炒米,自家特製辣椒醬亦是一絕!

site_logo

Sandy Yuen . 2023-08-26

MORE AT Google

Best and most affordable place in Leamington Spa. Not disappointed. Came back four years later, still delicious!

site_logo

J B . 2023-08-22

MORE AT Google

this place is me and my boyfriends go to now. affordable and absolutely delicious food. never fail to impress. proper authentic dishes and super friendly staff. not too busy either.

site_logo

gowwf . 2023-08-16

MORE AT Google

Delicious food, super friendly service and at a really good price. They were helpful with the menu, showing us the gluten free options and the chef double checking the order with us, very attentive all round.

site_logo

Unapologetic Me . 2023-08-13

MORE AT Google

I love this place. I have been coming to Wofon for about four years now and it just gets better and better the current staff there are so friendly and polite the food it’s absolutely incredible and a bargain for the price. I have never been disappointed by a meal here. It’s my go to place for a meal I know I will enjoy that won’t break the bank and for a good atmosphere strongly, recommend

site_logo

Seb Apostol . 2023-08-05

MORE AT Google

The best Hong Kong food in town! Can get quite busy but the food is worth the wait.

site_logo

Paing Paing . 2023-07-26

MORE AT Google

Instead of going to Wagamama, go to Wofon ! It is one of my favourite chinese places in Leamington. It is cheap and cheerful ! Most of the starters are under a fiver. I recommend the ribs and the pork cutlets. They have new dishes on their special board that are really good value. The pork with curry sauce is a winner!

site_logo

Camille . 2023-07-25

MORE AT Google

I cannot believe I can enjoy Hong Kong Style food in Leamington spa ! Yes very traditional taste from my home city, Hong Kong. Really love it!

site_logo

Caleb Chu . 2023-07-10

MORE AT Google

Called in as our original plans had to change. Good menu, great value, lovely staff, what’s not to like. Don’t miss the specials.

site_logo

Charollaischris . 2023-07-01

MORE AT TripAdvisor

Always busy for a reason! Great value freshly cooked; we’ve always found the service prompt - even when busy The selection of little starter plates are delicious😍 Can be a bit cold inside when dining in during the winter but just bring a jacket - it’s not supposed to be fine dining! For as long as they let us in we’ll always keep coming back.

site_logo

Ollie de Savigny . 2023-06-29

MORE AT Google

It’s rare these days to get such an excellent meal which combines quality, good value and a generous serving but that’s what we got at hofun. I had duck noodle soup on thin egg noodles and my wife had the Tom yum. My dish was very tasty, but next time I will have the Tom yum. It was packed with seafood, sweet tomatoes and fresh veg. The soup base had a lovely body with a sweet spicy depth. Our waitress was friendly and attentive. Looking forward to going back next time we visit.

site_logo

Edward H . 2023-06-20

MORE AT TripAdvisor

The ulitimate taste sensation. Bowls brimming with fresh food cooked to perfection. Extra good service.

site_logo

T B . 2023-06-17

MORE AT Google

A Gastronomic Delight at Wofon Restaurant: Exquisite Cuisine and Exceptional Service I recently had the pleasure of dining at Wofon Restaurant, and I am delighted to share my extraordinary experience. From the exceptional flavors of the cuisine to the impeccable service, Wofon truly excels in providing a remarkable dining experience that leaves a lasting impression. At Wofon, the culinary journey is a true feast for the senses. The menu offers a wide array of tantalizing dishes, but two standout options, in particular, captured my taste buds: the succulent Sweet and Sour Pork and the flavorful Shredded Pork Noodles. The Sweet and Sour Pork, or "Gu Lou Yok" as it is popularly known, was a masterpiece of culinary delight. The crispy yet tender pork, coated in a mouthwatering sweet and tangy sauce, created an explosion of flavors that danced on my palate. The balance of textures, with the pork's exterior crunchiness and its juicy interior, was a testament to the chef's expertise. Another culinary gem at Wofon is the Shredded Pork Noodles. The delicate strands of noodles perfectly complemented the savory shredded pork, creating a harmonious blend of taste and texture. The dish was beautifully seasoned, highlighting the natural flavors of the ingredients. Each bite was a delightful interplay of savory goodness and satisfying noodle texture. In addition to the exceptional cuisine, the service at Wofon Restaurant was truly commendable. From the moment I stepped through the doors, I was greeted with genuine warmth and hospitality. The attentive staff ensured that every need was met promptly and with a smile. Their knowledge of the menu and willingness to offer personalized recommendations enhanced my dining experience. The waitstaff at Wofon exhibited professionalism and attention to detail, making me feel valued as a guest. They went above and beyond to ensure that my dining experience was nothing short of exceptional. Their efficient service and friendly demeanor added an extra layer of enjoyment to the overall experience. I highly recommend Wofon Restaurant to all food enthusiasts seeking a remarkable dining experience. The dedication of the chefs and the attentive service provided by the staff create an atmosphere of excellence that sets Wofon apart. Whether you're craving the iconic Gu Lou Yok or the satisfying Shredded Pork Noodles, Wofon is sure to exceed your expectations.

site_logo

英國新時代冇乜主意特色頻道(No Idea in New Era) . 2023-06-17

MORE AT Google

A restaurant we used to use frequently before lockdown we visited yesterday with our grandchildren having told them how good it was we had recommended it before to our friends but last night the service was poor the food was awful having asked for a smaller portion for our granddaughter we were told we had to share an adult meal with no extra plate or cutlery was provided but not being used to order to this type of menu we would have liked some help but being busy we were wasting our time we will not recommended this restaurant again!

site_logo

Colin Hawkins . 2023-06-04

MORE AT Google

Great food served fast, friendly staff, great experience.

site_logo

Guillaume Honore . 2023-06-02

MORE AT Google

Authentic Hong Kong comfort food

site_logo

Candy C WONG . 2023-05-28

MORE AT Google

We arrived in Leamington Spa for an afternoon visit and saw this place while looking for a parking space. My Yunnanese companion couldn’t wait to try it! The fried spring rolls were the best I’ve had anywhere; fresh, hot and delicious! We both had rice noodle soup - obviously, if you know Yunnanese cuisine - one seafood and one beef. Both excellent! Mine had plenty of seafood and her beef was tender and succulent. Apparently not as good as you’ll find in Yunnan but she still said it was very good, which is praise, indeed, from her. With two teas, the total came to £26.40, which was exceptional value. And the service was friendly and very quick. The place is Spartan but very clean and nicely decorated. Highly recommended.

site_logo

PeteM760 . 2023-05-20

MORE AT TripAdvisor

Nice restaurant atmosphere. High quality food. Friendly. The ribs and chefs specials are fantastic

site_logo

Tom Boulet . 2023-05-12

MORE AT Google

Very helpful in choosing menu Tasty Reasonable price

site_logo

Moji Akintola . 2023-05-05

MORE AT Google

Good value Asian food. Wine menu could do with an upgrade

site_logo

Tommy Roberts . 2023-04-29

MORE AT Google

Very good restaurant. Not very busy, so the environment is calm. The lady that served us was very lovely, and i would recommend you to listen to her advices because they’re great. The service was very fast, and the food was delicious. The prices are pretty good for the amazing quality of the food. I would truthfully recommend. 多谢!!

site_logo

Romeo . 2023-04-27

MORE AT Google

Had salt & chilli ribs & tom yam soup seafood authentic Asian food with wonderful taste but lack in seafood shrimps were small just poor really fish would be nice in a seafood dish with more noodles to give the dish more texture good attempt, many thanks for your hospitality , I was preceded with a dirty class so I drank out of the can & had delivered a straw wich I decided, the chef was a bit over exuberance he took the roll of waiter

site_logo

Nicholas jasonlove . 2023-04-21

MORE AT Google

The best noodle restaurant I’ve ever been to, huge portions with affordable prices. Every single dish including starters are cooked fresh. Also incredibly friendly staff. This place deserves more than 5 stars 😍😍

site_logo

Holly Bowater . 2023-04-19

MORE AT Google

Super good Cantonese food in Leamington. The price is reasonable and staff are friendly. Food cured my homesickness.

site_logo

J W . 2023-04-18

MORE AT Google

It a great little place to eat noodles.

site_logo

Jay Jaboogle . 2023-04-11

MORE AT Google

Have been coming to this place for about 4++ years now. I can honestly say that they’ve been very consistent in their food, service, and price (although they’re a bit more than they used to be now but, for the quality of food they offer, it still feels cheap). I’m so glad to have them in Leam. So far the best Asian/Chinese/Noodle menu I’ve had, which is why I always go to them whenever I miss food from back home. If you haven’t tried them yet, you’re missing out!

site_logo

Yuni Situmorang . 2023-04-01

MORE AT Google

Great tasting, well presented meals at a very reasonable price.

site_logo

Thomas Wilson . 2023-03-30

MORE AT Google

Super chef cooks delicious food, add more Hong Kong -style food, reasonable price and good service.

site_logo

Wendy Chan . 2023-03-23

MORE AT Google

Casual Asian reataurant/restaurant in Regent Grove. Food is really good value for money, while also very good quality. The service is fast and attentious, in spite of the ever so slight language barrier (which adds to the charm of the place, in my opinion). If you prefer substance over form, this is the place for you!

site_logo

Giovanni Garaldi Biasi . 2023-03-21

MORE AT Google

I'd been meaning to go here for about three years but have never got round to it. The simply and very reasonably priced menu of interesting but simple dishes attracted me. The place inside is the height of an aircraft hanger and interestingly decorated. The service was fast and efficient and the staff were very polite. A credit to the place. I expected, for the price, that the food would be average and the portions small. For starter I had tempura vegetables. Three onion rings and three other veg for £3.50. The BEST onion rings I've had anywhere by quite a way. Main course I had ramen noodles with king prawn and chefs sauce. The serving was much bigger than I thought (enough but not *too* much). I am sure I had about 8 prawns which is a lot for a dish that was £8.50. A few veg chucked in for balance and the sauce had a delicate flavour that made the noodles interesting without overpowering the juicy prawns. That lots with a cranberry juice was £14. I'm going back again for sure.

site_logo

cls14 . 2023-02-14

MORE AT TripAdvisor

Siemple comfort food but delicious. So welcoming. The staffs were so friendly and helpful. Highly recommended!

site_logo

Tess Lam . 2023-02-13

MORE AT Google

Nice little eatery, we've been here a few times and the staff are very friendly and greet you as you enter, they serve you quickly and the food comes quickly also. The food tastes very nice and the servers provide you with chop sticks but also offer you a fork. It is a little difficult to choose what you want if you don't know the different types of noodles but I'm sure if you asked the staff would explain for you.

site_logo

Chris Bowen . 2023-02-03

MORE AT Google

Lovely fresh, tasty food cooked to order!! Great selection of starters and mains, and they’re happy to adapt if you want to change/alter any ingredients for you. Cheap, satisfying good food. Staff are very welcoming and friendly aswell.

site_logo

Jayne Z . 2023-01-31

MORE AT Google

Friendly staff and the food was great. Probably more authentic than your average Chinese restaurant; take your time working out the menu - you have to choose rice or noodles (various types), then a topping and finally a sauce. Prices are very reasonable. I only gave them a 4 star because the main course took a while, but it wasn't really anything to complain about.

site_logo

Andrew Rush . 2023-01-28

MORE AT Google

Great place for noodles! Friendly staff.

site_logo

Theodora Francis . 2023-01-27

MORE AT Google

Similary restaurants in West Midlands

restaurant_img
4.2

933 Opinions

location-icon140-142 The Parade
Asian
outdoor_seating_322611takeaway_322611delivery_322611

Fab venue for relaxing cup of Karak Chai. Decent sized portions of food, which is truly excellent and great to try new dishes.

restaurant_img
4.4

669 Opinions

location-icon38-40, Regent St
Asian
outdoor_seating_184385takeaway_184385delivery_184385

We came here as a party of 15 on a busy Friday night and the food and service was exceptional.

restaurant_img
4.4

106 Opinions

location-icon65 Coten End
Asian
outdoor_seating_195145takeaway_195145delivery_195145

As good as a takeaway can get no grease on food and even though I'm a michellin star chef I still like to order a Chinese every now and then and it's always greasy but these guys nailed it I shall return

restaurant_img
4.5

635 Opinions

location-icon85-87 Abbey End
Asian
outdoor_seating_186807takeaway_186807delivery_186807

Went here tonight with my husband. Food extremely fresh - Staff very friendly and couldn’t do enough to make you welcome. Prices very reasonable Would highly recommend

restaurant_img
4.0

53 Opinions

location-icon16A High Street
Asian
outdoor_seating_184484takeaway_184484delivery_184484

If you suddenly decide to put meat in your dal - TELL YOUR CUSTOMERS! Every time I had it before it was vegetarian..