GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.1

Based on 2.307 opinions finded in 3 websites

site_photo4

Nº 341 in 603 in New Forest

Nº 85 of 173 British in New Forest

CUSTOMERS TALK ABOUT DISHES WITH..lamboldpuddingcodsteaksaladcreamcheeseprawnsmeatvegetableschickencookedporkroastmustcurryfish

comment_iconOpinions

Beautiful food and drinks lovely place to take the family!

site_logo

Grace . 2025-04-21

MORE AT Google

Just passing through, what a great choice for my stop !

site_logo

Charlie Scalliet . 2025-04-18

MORE AT Google

Came for dinner with my Son, he devoured a burger and said I should give them 10 stars out of 5 for the burger and great service. After he’d had icecream for dessert it had gone up to 15 out of 5 ⭐️

site_logo

Jeremy Horne . 2025-04-09

MORE AT Google

Lovely pub with great food their own ales and lagers

site_logo

John Kirk . 2025-04-07

MORE AT Google

Top quality modern beers brewed on the premises and sold at reasonable prices. Great food and service. Edit! I have become gluten intolerant and delighted to say the Monkey Brewhouse now stock gluten free IPA Siren Lumina. They also have extensive GF options on the menu.

site_logo

Rich T . 2025-04-05

MORE AT Google

Excellent beer. Great food and perfect staff.

site_logo

Derek Reed . 2025-03-31

MORE AT Google

Really impressed with this place, the food is great and well presented. Service friendly and welcoming. Really glad I came.x

site_logo

paula mills . 2025-03-31

MORE AT Google

Great place lovely people food was superb

site_logo

Richard Scott . 2025-03-22

MORE AT Google

Cracking place this, stayed for business but would definitely return on a leisurely vacation, the staff were impeccable, the lad was having his dinner and jumped up to serve without hesitation, so polite and this matters today imo! Room is spot on, heated, lovely bathroom and I can't wait to try the breakfast tomorrow! Great beers brewed on site. Location is good for a short walk into the centre bit and would recommend to friends and family without doubt

site_logo

Phil Smart . 2025-03-10

MORE AT Google

Excellent lunch and beer as usual . The specials board always has some fresh fish which compliment the standard menu . Service is friendly and efficient . Great place for lunch.

site_logo

tractorboy59 . 2025-03-04

MORE AT TripAdvisor

Monkey Brewhouse A great, quaint pub accessible via a few steps down. The roof beams and wooden furniture create a wonderful atmosphere. The staff are friendly and always smiling, which makes the visit more pleasant. The noise level here, as in other pubs, is perfectly acceptable. You can still have a conversation at the table and the food is delicious. So, eating here in the evening is definitely worth it. The entire pub is clean despite the crowds, and the tables are tidy (no sticky residue, etc.), really great! BOTTOM LINE: If you're in the area, you should take the time to stop by!

site_logo

McPaul 75 . 2025-02-28

MORE AT Google

Lively and relaxed atmosphere. Really excellent meal, brilliant and friendly service. 5*

site_logo

hollie scott . 2025-02-16

MORE AT Google

Had a great birthday meal with friends. Beer is brewed on site and it is very good. Food was nice..had a superb venision stake. Other had the curry. They enjoyed it but I felt it was a littke sweet and mild.

site_logo

Jeff H . 2025-02-16

MORE AT TripAdvisor

Always a warm welcome Awaits all. Dog and child friendly

site_logo

David Oxley . 2025-02-11

MORE AT Google

We live not far away and it's always a pleasure to visit. We've been for a drink, and also had Sunday Lunch, very tasty and very popular. GF options

site_logo

Gisela Blee . 2025-02-04

MORE AT Google

A friend and I met up for Sunday lunch here. We both chose roast beef and were disappointed that the beef was machine cut into tough thin slices - probably bought in. The rest of the meal was lovely. Service was excellent, as always.

site_logo

Gourmandsouth . 2025-02-04

MORE AT TripAdvisor

Had an absolutely amazing meal with my husband! Service and food was top notch, the restaurant is beautifully decorated, and really pleased that they are dog friendly. Shame we live so far away or we would definitely be back!

site_logo

Kirsten Williams . 2025-01-18

MORE AT Google

Great pub !! Delicious food and great simple menu!! All of the staff were so friendly and welcoming, would highly recommend a visit to Monkey Brewhouse !

site_logo

Jessica Stephens . 2025-01-16

MORE AT Google

Came here to celebrate the new year with my two husbands and my sister/mum, great service from everyone but the person who stood out to me was 100% mandolin, loved her energy, her bright red hair and that gorjus smile just made our night!! I came back a few more times to try and catch her but sadly haven’t found her again :(

site_logo

bartholomew james watson . 2025-01-11

MORE AT TripAdvisor

Brewhouse built onto a pub with rooms, so right on the road. Adequate parking and excellent staff.

site_logo

Allan Dyke . 2025-01-03

MORE AT Google

After much discussion we decided to go to the Monkey Brewhouse for our NYE meal, so pleased we did! Despite the place being absolutely heaving (great atmosphere) we had a wonderful meal. So impressed with all the staff who were rushed off their feet but still managed to serve everything with a smile. Food was delicious, beautifully cooked and presented. Added bonus of live music so we danced our way into 2025. Thank you to the whole team, it was a lovely way to round off 2024.

site_logo

Jan G . 2025-01-02

MORE AT TripAdvisor

Music on nye but you can’t get to the music because there are people eating, sat down, in the way. Can’t stand at the bar because you’re in the way. Garden vibes were okay though

site_logo

Lollie Groom . 2024-12-31

MORE AT Google

What a fantastic place. Great food, staff and beer. Staff friendly and knowledgeable about the beer they brew and serve

site_logo

fiona . 2024-12-29

MORE AT TripAdvisor

Was there for a Christmas meal with friends , only vegan option was pasta, ! Which was actually taken from the main menu , so no effort made for vegan ! Disappointed!

site_logo

Dee P . 2024-12-17

MORE AT TripAdvisor

Moved to Lymington 8 months ago and the food was delicious. Past 3 times we've been food hasn't been worth the price.

site_logo

Kelby Lusher . 2024-11-20

MORE AT Google

We have recently returned from a two night stay at Monkey Brewhouse.We both enjoyeed our stay very much .Our e enjoyment was helped by all the staff we came in contact with They all were very helpfull and friendly Special mention should be made of SAM who was a credit to the Pub. The standad of food particularly at Dinner was excellent.Romm 3 was comfortable and spotless. Well done to all.

site_logo

Anthony D . 2024-11-18

MORE AT TripAdvisor

Great place lots of atmosphere Live band Sunday fab Chef turns out delicious food

site_logo

Kate Fisher . 2024-11-10

MORE AT Google

Turned up on the off chance. 2 adults and 3 dogs . From taking the call to see if they had space, to getting served was great. The beer was very good "Toll House". The food was also very good, I thoroughly recommend it.

site_logo

Brian Fraser . 2024-11-09

MORE AT Google

Very friendly staff, accommodating towards us and our dogs. Food was really good as was the beer! We only popped in in the off chance and would definitely go back.

site_logo

Keri Powell . 2024-11-09

MORE AT Google

Turned up on the off chance. 2 adults and 3 dogs . From taking the call to see if they had space, to getting served was great. The beer was very good "Toll House". The food was also very good, I thoroughly recommend it.

site_logo

makka_nakka . 2024-11-09

MORE AT TripAdvisor

Great food and service. We had a lovely meal and were able to take the pup with us too

site_logo

Alexis Noble . 2024-11-06

MORE AT Google

Great selection of main meals, service was great too.

site_logo

Shona Hathway . 2024-11-04

MORE AT Google

What a fantastic place. Really fab atmosphere, cool interior and the food was top notch. I would say it’s a must if you are in the area!

site_logo

kerri_jo2003 . 2024-10-05

MORE AT TripAdvisor

Discovered this gem whilst visiting the New Forest. Was recommended to us, and for good reason. We dropped in mid week for dinner and immediately felt welcome. Definitely feels like a pub that's used by locals, but not one where strangers are made to feel unwelcome. Staff were warm, welcoming and professional. Food was great... Lovely balance of quality and just enough to leave us satisfied but without feeling uncomfortable. The vibe is great with a choice of the more restaurant side or the pub side (which is where we positioned ourselves). As we're moving into the area next year, this week certainly be one of our regular places to enjoy an evening. Thanks to all at MB. Bob

site_logo

Bob Kitchin . 2024-10-01

MORE AT Google

Had a meal here tonight. Service was fair , nice place however food wasn’t great. I had John Dory fillets which were extremely small. Our other party had sirloin steak which was overcooked! 3 steaks arrived first and my dish later a bit too late tbh. Mentioned my dish to staff which he agreed was small and said he’d relay to manager. Sadly no response !! Nice place but overpriced and under delivered!! Obviously a busy place so not too bothered about customer’s feedback!

site_logo

David Gregory . 2024-09-29

MORE AT Google

This accommodation is not fit for purpose - we're currently staying at the pub and the noise from the bar below is ATROCIOUS. Half an hour after pub closing time, the noise of raucous patrons singing underneath us prevents any chance of sleep. A certain amount of noise is to be expected at a pub, of course - but if you can't provide a vaguely quiet environment at a reasonable hour, you shouldn't be letting out rooms in the first place. Avoid if you want a good night's sleep.

site_logo

Jennifer C . 2024-09-28

MORE AT Google

Dog friendly, great service, food, and beer (brewed onsite) a fantastic find on our trip to the New Forest 🚙

site_logo

Donna Andrews . 2024-09-27

MORE AT Google

Fantastic and tasty premium burgers accompanied by friendly and efficient service. Good value. Aesthetic environment. Ideal en route to the Isle of Wight ferry.

site_logo

Greenhillsfan . 2024-09-26

MORE AT TripAdvisor

Close to the New Forest, Beaulieu motor museum and Bucklers Hard the Monkey Brewhouse is a great place to stay. Comfy and clean rooms with a decent breakfast. A good pub with excellent ales brewed on site, tasty food and really friendly and attentive staff. We really enjoyed our stay and would happily return. Thank you.

site_logo

michael eustace . 2024-09-25

MORE AT Google

Well worth the visit. Staff are lovely and food is good. Beer is brewed in house.....mmmh

site_logo

Liam Harrington . 2024-09-20

MORE AT Google

Staff were excellent and very friendly and helpful. Food absolutely amazing. Can't find any more words to say but brilliant place to stay eat and drink

site_logo

Claire Forrest . 2024-09-17

MORE AT Google

Great place. Fun pub with own beer 🍺 rooms clean and tidy. Cleaners in the morning can be noisey.

site_logo

Kevin Lowe . 2024-09-16

MORE AT Google

Had a lovely meal - fish stew and risotto special were both very good .. friendly, welcoming staff - would thoroughly recommend 👍

site_logo

Martin B . 2024-09-10

MORE AT TripAdvisor

Great food, Great location! Will definitely go again!!

site_logo

David John Stringfellow . 2024-09-10

MORE AT Google

Service good, food nothing special

site_logo

Keith Harris . 2024-09-08

MORE AT Google

Great beer, food & service as always

site_logo

Mick Harrison . 2024-09-07

MORE AT Google

Ate here on a Bank Holiday Saturday. Nice place but the evening didn't start well when we were told all specials had sold out and some of the regular menu was also unavailable. And it was only 7PM! I guess they were very busy for the bank holiday but it was a bit of a deflating start to the night. We had fish and burger and chips which was good, if a little uninspiring considering we were expecting a bit more. Beer was tasty and the interior of the pub overlooked the brewery which was a way more interesting vista than looking at the wall. The pub was rammed, its a popular place. Evening brightened up when we realised they had some live music outside which we moved onto that with our wine and churros. Was a lot of fun with the outside dancing and a fine end to the evening. I would visit again but would pick my evening when it was quieter and the availability of food was a bit higher!

site_logo

The Bear . 2024-09-02

MORE AT TripAdvisor

Although we regularly go to the Monkey I’m writing this review as a thank you for the excellent meal we enjoyed yesterday. Having eaten recently at several far more expensive places recently the Monkey served better quality food, which was cheaper and with friendlier staff. The muscles were amazing and the gambas out of this world. Thanks guys

site_logo

David R . 2024-08-30

MORE AT TripAdvisor

Amazing food, lovely service, lovely staff. Def recommend. And it has its own brewrey! Very cool

site_logo

Martyn Tillett . 2024-08-28

MORE AT Google

When we walked in, we were happy to know that it was dog friendly, we also discovered that it had lovely seating areas throughout the whole pub and a small but lovely garden! It is also amazing beers on offer, and my dad loved the real ale, which was the seawall,which he gave 9/ 10. The scampi starter were huge pieces. And it was tasty as well! Then, when it got onto the main course,I ordered the jerk chicken burger,which I highly recommend! I another dish I recommend getting the vegetable stack burger. 🍔 😋 TIP: I recommend booking before your arrival!

site_logo

Oliver S . 2024-08-26

MORE AT TripAdvisor

What a great experience - staff were so helpful and friendly and the food was amazing I would highly recommend, definitely going back next time we visit the area

site_logo

Reuben s . 2024-08-24

MORE AT TripAdvisor

Visited here for a family evening and the thing that stood out was the fantastic service from the waiting staff. They were all amazing and nothing was too much trouble. The food was great, served hot and with a smile. Thank you guys for making our evening so memorable.

site_logo

LD . 2024-08-22

MORE AT TripAdvisor

Nice place Popped in for a quick beet.... and Stayed for a few more lol

site_logo

Jamie Hodgson . 2024-08-20

MORE AT Google

Without a doubt, one of the best roast lunches . Great friendly service and very reasonable prices. I will be going there again.

site_logo

Mike Thornton . 2024-07-22

MORE AT Google

Delightful brewery/pub/restaurant/hotel. Family run with friendly and obliging staff. Stayed for two nights with friends and was made to feel at home. Excellent freshly cooked breakfast. Highly recommended.

site_logo

Edwin Courts . 2024-07-20

MORE AT Google

This is so far our best stay in England. Very nice room, very clean. Good bed and a very nice bathroom with a bathtub. Good location just on the edge of town. Excellent food and a very nice selection of on-site brewed beer. Staff was lovely. This is a must stay for brewers.

site_logo

Ole Alvær . 2024-07-19

MORE AT Google

Nice pub with a big outdoor space, and friendly staff. There's a good range of beers and some standard veggie options on the menu.

site_logo

Paul Jauncey . 2024-07-16

MORE AT Google

Excellent! Sunday, 8 of us and kiddies, sun is shining, pork belly best in the area, beef satay ooooof. Food excellent! Guest beer the taddiford wow also the howler. 5 stars!

site_logo

Mario Epsley . 2024-07-07

MORE AT Google

Visited for the beer festival. A great atmosphere and selection of beers. My favourite was Taddiford.

site_logo

Tom Parker . 2024-07-06

MORE AT Google

Been to Lymington and the surrounding areas quite a few times but didn't know about the Monkey Brewhouse until we drove past, ended going two nights running. The staff were welcoming and friendly and the place had a lovely atmosphere . We had the same dishes both nights. I had Portugese Fish Stew and my husband Prawn Curry they were both superb, Served piping hot and full of flavour. We will definitely return on our next visit.

site_logo

ronniepEastbourne . 2024-07-05

MORE AT TripAdvisor

We have just spent an amazing three days at the Monkey Brewhouse, the loveliest friendly helpful staff you could wish for, well done Sam for running such a great pub, and well done Will, the on site brewer/owner, your beers are superb, we can’t wait to come back next year and enjoy another beer & music festival with you all, our room was perfect, the food superb and the whole weekend Magnificent! Thank you all.

site_logo

judith g . 2024-07-01

MORE AT TripAdvisor

the staff were very friendly and welcoming our waitress was extremely helpful and professional assisting me with my food allergy’s our food was served quickly and hot very pleased

site_logo

Jodie Muse . 2024-06-24

MORE AT Google

Stayed 5 nights at the Monkey Brewhouse while exploring the New Forest. Had a great time. Room was very comfortable, the pub food, beer and atmosphere were excellent but the friendly and efficient staff really made it. Thanks to all.

site_logo

Chris B . 2024-06-22

MORE AT TripAdvisor

Had a great meal and good time while passing through new forest. Nothing but good vibes for me.

site_logo

kramer911 . 2024-06-20

MORE AT Google

I took a group of fourteen friends to the MB for an evening meal and of course a beer or two. We pre-booked and pre-ordered our food. The service was excellent from start to finish and the food exceptional. This is our third annual pilgrimage to the Monkey Brewhouse and if my group has anything to say about it this will not be the last. Thank you for a thoroughly enjoyable and memorable evening.

site_logo

Peter M . 2024-06-16

MORE AT TripAdvisor

Sorry Monkey Tree, you had a chance to redeem yourselves but failed. Came away feeling insulted and won't be back. Firstly the meals were not all delivered together. By the time the last one arrived the first 2 had half finished. Last to arrive was my Jerk Chicken with a small pot of Coleslaw & fries. The jerk chicken was a chicken thigh, which was very dark, rather knobbly and just a lump in the middle of the bun. It was underdone and the only slight jerk flavour was a slight sprinkling of jerk seasoning on the chicken. I removed the chicken to try and cut it to lay it flatter.....it neither looked or smelled appetizing. It was warm but everything else, including the toasted bun was cold. I did try but it was not a good look, taste or smell so I just ate the fries. When the table was cleared I explained my issues and they said something about a free drink for my trouble. I assumed I would not pay for the food I didn't eat but No, Monkey Tree, bad form. That was your gesture....... My free cranberry & Soda. The cheapest thing on our £118 bill!! Shocked and insulted. I will not be back. Whatever happened to customer service!

site_logo

Barbara Geary . 2024-06-05

MORE AT Google

The staff were nice and the pub itself has lovely outdoor seating (which also has heating when needed) and the inside had different spots so would imagine wouldn't get too loud out there. The staff were nice and did check in on us a few times but without being too invasive. My friend had a burger which was really tasty. I ordered the fig and blue cheese salad and although the ingredients were nice, there was one fig (cut into 4) that was over ripe and only a little blue cheese. Definitely could have done with more cheese and figs that were in better shape. The churros were nice and came with a few bits of fruit, but felt that there was too much sugar on them. I would still come back as it was a good experience with a nice atmosphere.

site_logo

Jessica W . 2024-06-03

MORE AT TripAdvisor

Tried the Bucklers Howler at the Gun Inn at Keyhaven liked it so popped in to the Monkey Brewhouse to buy a nine pint keg. Good beer.

site_logo

John Torode . 2024-06-03

MORE AT Google

Great food, lovely atmosphere, friendly staff

site_logo

Samantha Young . 2024-05-19

MORE AT Google

Lovely pub just outside Lymington. Great coffee and grub👍💪

site_logo

Simon Walford . 2024-05-17

MORE AT Google

First class service and food. You can't fault it.

site_logo

Ian John Hunt . 2024-04-30

MORE AT Google

Great friendly pub. Lovely staff and great craft beer. Good breakfast and coffee. Evening meals are also very good. Need to book.

site_logo

Phil Reader . 2024-04-21

MORE AT Google

Great place stayed for long weekend staff were great room was fantastic beer brewed on premises was lovely would definitely come back

site_logo

Peter Toghill . 2024-04-14

MORE AT Google

A thoroughly enjoyable evening here. The staff were so friendly and welcoming- nothing was too much trouble. The food was tip top too.

site_logo

Gemma Cadd . 2024-04-09

MORE AT Google

Second visit here for lunch - just as incredible as last time. Really delicious meal, generous portions. Kids meal (fish and chips) was great. Dessert was top notch - the brownie honeycomb sundae was perfect. We will be back again and again. Great service, great food, great location.

site_logo

Amanda M . 2024-04-07

MORE AT Google

Absolutely delicious Sunday lunch. All the ingredients were perfectly cooked with a good amount of vegetables. I decided to go for the nut roast which was really tasty. My husband had roast beef which was amazing quality too.

site_logo

claire . 2024-04-07

MORE AT Google

Nice beer but bang average food. The four of us had a decent selection of the menu and it was all a bit disappointing, apart from pudding which was great. Pretty darn pricey as well for what is standard pub fare.

site_logo

john driver . 2024-04-07

MORE AT Google

Great pub serving its own brewed beer. Food was very good and very friendly service

site_logo

Hamish McVey . 2024-04-04

MORE AT Google

We really enjoyed our meal. The fish in particular was perfectly cooked and very tasty. Good local beer as well. There was also good live music.

site_logo

J6116EVmelanies . 2024-04-02

MORE AT TripAdvisor

Absolutely delicious food, beautifully presented and came piping hot. Staff was so kind and attentive from entering the pub, throughout the whole stay, until departure. I love that food came in order, meaning starters came hot and mains after starters finished. I don’t like if everything comes at the same time and food gets cold. So plus from me! The pub has own beer brewery and whole process visible to visitors and available to purchase too. There are various flavours and even some merchandise is sold there like hoodies, t-shirts and more.

site_logo

Silvia G . 2024-04-02

MORE AT Google

Friendly and helpful staff, great food and really good ale brewed on the premises. Breakfast was excellent......

site_logo

Chris Jackson . 2024-03-31

MORE AT Google

Lovely atmosphere. Lovely staff. Lovely beer.

site_logo

Ben Ward . 2024-03-30

MORE AT Google

Just popped in for a couple of pints, both brewed on site. Very nice. Friendly welcome. Had a little look around too. Nice to see all the brewing kit which is within the pub. The Sunday roast another table had looked fantastic. Will be back. A few holes in the car park which I'm sure they will sort shortly. Would be superb if they are able to brew some green hop ale come the autumn.

site_logo

Tim Jones . 2024-03-18

MORE AT Google

Stopped very spare of the moment for a couple of pints when in the area. Great beer selection, all brewed on site and great quality. Very welcoming and dog friendly. Would return if in the area.

site_logo

George Prior . 2024-03-13

MORE AT Google

Food was good, staff very helpful and friendly. It's a shame that a large family were allowed to walk through without wearing a mask between them , however we will eat here again . Second visit staff are very friendly food was best pub food in a long time, crisp a little bit more on the pork belly then 5 stars. 3rd visit mashed potatoes were cold steak and ale pie just about okay Wife and daughters burgers good this is pub food and not fine dining , deserts are clearly bought in and typical of any pub. The staff are friendly and helpful we will eat here again but stick to the burgers. The whole place was very clean. Visited last week (11 02 2023) Still very clean with friendly staff, the food was 2 stars at best as all the meals were saturated in salt stop adding salt in the kitchen and put salt on the tables, we will eat here again but insist No salt on anything. .visited on 8th March 2024 3 different burgers all fresh and very good asked for no salt on the fries , no salt on them, they tasted so much better , at this rate we will be eating here more often . Staff are young very polite and helpful.

site_logo

Chris Bost . 2024-03-12

MORE AT Google

The Monkey Brewhouse is a fantastic Inn and brewery serving a selection of there own brewed Real Ales. Along with an excellent range menu including daily specials. The staff are very warm and friendly. They also do accomodation.

site_logo

keithl279 . 2024-03-05

MORE AT TripAdvisor

Visited with a group of friends on a Saturday afternoon. Stayed until closing time we were enjoying ourselves so much. Fabulous food and great service.

site_logo

Julie . 2024-03-03

MORE AT Google

1 roast and 1 "fish of the day with chunky chips and peas" Yuck. Chips were overwhelmed with the taste of fried oil. Fish was nice but nothing special, chips were over cooked and the peas....yuck. Won't ever order that again. Hubby said the roast pork was a 6/10 Shame really, it's a nice pub and the food is hit and miss

site_logo

Charlotte C . 2024-02-26

MORE AT TripAdvisor

Lovely pub with fantastic selection of locally brewed beer. Locals friendly Food looks amazing

site_logo

Chris Quinlan . 2024-02-17

MORE AT Google

Great pub ...food and service were excellent. and they brew their own beer...which was brilliant..good selection. We were there on a friday and they had music which was really good.

site_logo

Jeff H . 2024-02-17

MORE AT TripAdvisor

Our first visit to Monkey Brewhouse and it certainly will not be our last, we were greeted by Sam with a welcoming smile and served by Joshua who was knowledgeable and friendly as well as informative of the unique premises and the menu. Food was enjoyable and portions were more than adequate. The Monkey Brewhouse oozes atmosphere and it was a delight to have experienced it there.

site_logo

Garry B . 2024-02-14

MORE AT TripAdvisor

Arrived with daughter and 2 dogs first lunch. They could not have been more welcoming. The food was excellent and the staff charming.

site_logo

David M . 2024-02-13

MORE AT TripAdvisor

Good selection of ale's with ease of parking

site_logo

lee houlgate . 2024-02-10

MORE AT Google

Great beer, great food and great staff.

site_logo

Max Baldwin . 2024-02-09

MORE AT Google

A lovely fire was welcoming on a chilly day. We enjoyed good beers and delicious food, and will definitely be returning for more.

site_logo

Carolyn Patey . 2024-02-08

MORE AT Google

Great throughout the visit. From the moment we arrived ,we were well looked after. Lovely helpful staff, very tasty food and nice atmosphere. Thank you to the staff for making this evening so special.

site_logo

Compass02591566205 . 2024-02-05

MORE AT TripAdvisor

This is a flippin' great pub with rooms. Our room was clean and comfy enough but you're there for the beer and the food which is excellent. Never before been along the whole tap range and liked every one of them. Brewed on the premises it doesn't get better than this. And the food follows suit with dishes created from scratch by their own chefs and served up by the happiest, smiliest bunch of staff ever. Plus live music twice a week. You can have a real good time and then just climb up the stairs to get your head down. Brill

site_logo

Steve Whiting . 2024-01-30

MORE AT Google

Fantastic experience! Last minute telephone booking for lunch with family - with a very, cheery Josh. When we were arrived we were welcomed by the same helpful Josh. In a world where we’re all swift to complain, I believe in praise where it’s due. It’s not often I go out for a meal and feel it was worth it .. but Monkey Brewhouse surpassed all hopes and expectations. Excellent, faultless food and service. I hope Josh is recognised by the business for his fabulous customer service.

site_logo

Louise Chapman . 2024-01-28

MORE AT Google

Always pour a nice pint. Food always great….staff always friendly… transfriendly (made that bit up)….could be…..

site_logo

Bill Brewster . 2024-01-28

MORE AT Google

Excellent meal with friends here. Really good service from friendly staff and everyone was very happy with their meal.

site_logo

Shirley Bonnett . 2024-01-27

MORE AT Google

Similary restaurants in South East

restaurant_img
4.0

1048 Opinions

location-iconPilley Street
British
outdoor_seating_102245takeaway_102245delivery_102245

We had an amazing experience here! We are always on the hunt for a Sunday roast. Here we got the most amazing sharing starter and Sunday roast. Sitting in the garden with the sun truly made our Sunday perfect. The combination of fantastic service, delicious food, and the charming setting of one of Britain’s oldest pub/restaurants made a memorable visit. Steve and his team couldn’t of done more for us and it 100% has become one of our favourite spots

restaurant_img
4.1

1225 Opinions

location-iconThe Bridges
British
outdoor_seating_144110takeaway_144110delivery_144110

The Fish Inn is a little out of the way but well worth seeking out. Fantastic food, good beer and great staff made our visit really memorable. Best pub food we'd had in a long time!

restaurant_img
4.0

1915 Opinions

location-icon25 Brookley Road brockenhurst
British
outdoor_seating_187032takeaway_187032delivery_187032

Great place to stop off in the New Forest for a meal snack or afternoon tea etc It looked as though it had closed down last time I was in Brockenhurst

restaurant_img
4.0

1201 Opinions

location-iconAll Saints Rd Lymington
British
outdoor_seating_101920takeaway_101920delivery_101920

Walked to the ‘Fish ‘ wearing new shoes … welcomed in and served with delicious food and wine supported by excellent service . Whilst there are cheaper places to eat I would argue the standard of food represents good value. A lovely evening I would highly recommend a visit. Oh and the landlord supplied plasters for my blisters !

restaurant_img
4.1

2288 Opinions

location-iconHurst Rd, Milford on Sea
British
outdoor_seating_101888takeaway_101888delivery_101888

The staff were petty and made me feel ashamed of food allergy and intolerance. Stood behind counter laughing about the situation which was so insulting. Left after trying to order. Will not return here, especially when there are nicer places with kind staff that want custom.