GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 882 opinions finded in 2 websites

site_photo4

Nº 537 in 1517 in Southwark

Nº 18 of 43 Other international cuisines in Southwark

CUSTOMERS TALK ABOUT DISHES WITH..chorizomustonionspicycheesesnackchickensandwichmeatpastrysteakhamspinachricotta

comment_iconOpinions

Finding a place with excellent Argentinian food in London was an unforgettable experience.

site_logo

Lucia Piton . 2025-05-17

MORE AT Google

There are some unfair reviews in my opinion. The seating area is small so obviously customers should not expect to eat food from elsewhere whilst sitting there. Empanadas very good - nice to find hard boiled egg and fruit in the beef one - it’s what I’m used to and I like that combination. Polite staff even though very busy. Borough Market packed that day with pushing and shoving and rudeness all over the place. Sorry to say, mainly from tourists. Not many places to get authentic empanadas around so am glad to have found this place. Recommend it.

site_logo

Catherine Hawkes . 2025-05-12

MORE AT Google

I only had a ham and cheese empanada, but it was delicious. More filling than pastry, just the way I like it. £3.50 each.

site_logo

Paulo Cruz . 2025-05-04

MORE AT Google

Really delicious. Could tell the food was good by the long queue. I got the chorizo empanada and it was delicious, very flavorful, and quite filling for the reasonably priced single one. My friend got the cheese and onion and spinach and ricotta one and preferred the cheese and onion.

site_logo

Pinktrophy . 2025-04-24

MORE AT Google

Absolutely delicious empanadas – crispy on the outside, perfectly seasoned and juicy on the inside! Each bite was full of flavor, and you can tell they’re made with love and quality ingredients. A must-try for anyone who loves authentic taste. I’ll definitely be coming back for more!

site_logo

Omar Aswad . 2025-04-22

MORE AT Google

Best empenda in the town Dare I say better than the steers of Buenos Aires, I had eaten empenda in la Boca and in Palermo, and this place beats both those Buenos Aires locations....

site_logo

Lavpreet Singh . 2025-04-21

MORE AT Google

Horrible experience. The woman was so aggressive because in addition to having bought 30 pounds worth of empanadas we were trying other normal things, it's a food market and we were spoken to too badly. I used to come to their stand every time but not for me anymore. I can't stand people who speak badly like this woman. Luckily I watched it in Spanish but really a shame!

site_logo

Jerome Buono . 2025-04-19

MORE AT Google

Excellent! You feel at home 🏠🧉🥟

site_logo

Natalia Romero . 2025-04-13

MORE AT Google

The empanada was really good, flavorful and well-prepared. The choripán, however, had a strange bitterness that seemed to come from the chimichurri.

site_logo

Marce B . 2025-04-11

MORE AT Google

Great empanadas for a very decent price!

site_logo

Daniel Macak . 2025-04-10

MORE AT Google

The market is a very busy place, especially on weekends so it gets quite crowded and you may have to wait for a bit. It’s worth the wait, though.

site_logo

Ana Paula Ortega Bernal . 2025-04-05

MORE AT Google

I got the steak sandwich which was very very salty. The ciabatta was ok, it’s not really as chewy or crispy as you’d expect. The quality of the meat was very good, just difficult to really taste it through the salt. The staff were very pleasant

site_logo

Hakeem Badran . 2025-04-02

MORE AT Google

Got the steak sandwich, it was delicious. Came quickly and thought reasonably priced (for borough market!)

site_logo

Eddie 891 . 2025-03-05

MORE AT Google

Argentina at the Borough Market The steak sandwich is terrific - it was cooked to order and the steak was suprisingly tender!! This is a great option for lunch at the Borough Market!!

site_logo

Suzie Lee . 2025-02-27

MORE AT Google

¡El sándwich de bistec es estupendo! ¡Fue preparado por encargo y el bistec estaba sorprendentemente tierno! ¡Esta es una gran opción para almorzar en el mercado del condado!

site_logo

SuzieLee71 . 2025-02-27

MORE AT TripAdvisor

The steak sandwich and choripan are unreal, as are the empanadas. Took empanadas for dinner, reheated in the oven, and they were fantastic. Really recommend this place. Fantastic friendly service too.

site_logo

Elena . 2025-02-23

MORE AT Google

I never knew what a good empanada tasted like—until now. This is, by a country mile, the best empanada I’ve ever had. Perfectly glazed, crispy on the outside, packed with filling, great structure, easy to hold, and absolutely delicious. I’ll be coming back and making this a regular stop!

site_logo

Gideon . 2025-02-21

MORE AT Google

The grill girl Jimena was very hardworking, she made my sandwich with the meat just right, David also had all the staff very friendly, Alejandra also recommend the chorizo ​​empanada and the caprese empanada. 100% recommended and the dessert was the canyon, dulce de leche, thank you ❤️

site_logo

Dani garcía . 2025-02-08

MORE AT Google

Capresse empanadas are incredibly good. I love Argentinean food!

site_logo

Nahuel Aguilar . 2025-02-08

MORE AT Google

Great place to try Argentinian empanadas at the market. The meat sandwich is good, while the desserts and empanadas are OK (nothing special). The prices for being in London are more than reasonable. Nice staff. Limited number of seats for eating. I recommend it if you are nearby.

site_logo

Fernando Silva . 2025-02-03

MORE AT Google

Great meat sandwich, super well cooked, the girl at the grill super friendly and attentive. Incredibly good Capresse empanadas!

site_logo

Júlia Acer Puig . 2025-01-25

MORE AT Google

Amazing Amazing Amazing Spinach and ricotta was our absolute favourite.

site_logo

shivanshu mishra . 2025-01-05

MORE AT Google

Portena is a typical small kiosk with speciality in empanadas and steak. Highly recommended, as I have tried 3 different times we love spinach & chicken empanadas. The steak at £11.50 is good portion size as well.

site_logo

V J . 2024-12-29

MORE AT Google

We do not recommend. Rude customer service and food was not great.

site_logo

Food lover 777 . 2024-12-17

MORE AT Google

I had some of the most delicious Empanadas and my first beer from Argentina I've ever had. Highly recommend stopping here.

site_logo

Sean Gowenlock . 2024-12-14

MORE AT Google

The sandwich is incredible and we also tried their brutal empanadas. I recommend 100%

site_logo

Alejandro Segura Carrión . 2024-12-07

MORE AT Google

Lived in London for a couple of years and being from Uruguay, this was one of my go to places when I felt homesick for Rio de la Plata’s food. Empanadas are definitely their best dish, but also tried the chivito (though in Argentina is called lomito) and they also serve one hell of a Choripan. Whatever you go for, you can’t go wrong. There’s also some Argentinian beer brands like Quilmes to go for the full experience. As the name goes, the place is also a shop where you can get the survival kit for Uruguayans and Argentinians: Yerba, Dulce de leche and alfajores, among others. They have several brands but they also make their own Dulce de leche which is quite good. Fully recommended.

site_logo

Gonzalo Ansa . 2024-11-27

MORE AT Google

Great empanadas street food. I really recommend chorizo spicy empanadas with a Red wine.

site_logo

Alberto Aspil . 2024-11-26

MORE AT Google

I discovered this delightful small shop that offers some of the best steak sandwiches I've ever tasted! This was my first time trying out Argentinian food, and it's safe to say it left me with high expectations. I got a steak sandwich and an empanada; both were good, with the empanada being ok. Although the seating area of this shop was spacious in relation to its footprint, finding a seat was still a challenge. As one might anticipate from a borough market establishment, the atmosphere surrounding the stand is dirty. I would recommend this restaurant for their steak sandwiches.

site_logo

Kyle . 2024-11-24

MORE AT Google

One of the best Argentine empanadas I have ever tried, 100% recommended. I recommend the ham and cheese empanadas and the pizza

site_logo

Eric Pozuelos . 2024-11-19

MORE AT Google

An almost spiritual experience, the steak sandwich was incredible. Served in an amazing ciabatta-style bread with a layer of cheese and incredible chimichuri sauce, it was dripping with flavour and succulent. Easily the best sandwich I’ve had in London in years and worth the 10 min wait at peak times. There’s a handy little seating area outside the stall where you can enjoy it and watch the market bustle.

site_logo

Paul . 2024-11-04

MORE AT Google

There are no pictures, but I tried the steak sandwich, ricotta empañada, and tomato empañada. The sandwich has a bit of a strong peppery flavor, but it's delicious and it's value for money. The portion size is quite large so I am full. The ricotta empanada was the most delicious. Recommended.

site_logo

Jaeyeong Bang . 2024-11-02

MORE AT Google

Steep for street food, but the taste is worth it. The place is busy because it does have good food, less so value for money. Steak sandwich + 1 empanada was £15. But in the end the quality warrants the price. The empanada was delicious, with a dash too much cumin for my taste, but the onion and beef chunks worked really well, the crust and pastry was awesome. The steak sandwich, in my opinion is the best option here. Freshly cooked steak, with cheese, tomatoes and lettuce. But what made the whole sandwich was the chimichurri, fresh tasty, sharp and perfect with the warm steak. Delicious!! 9/10 would recommend

site_logo

Petrut I . 2024-10-31

MORE AT Google

Really good steak sandwich for a relatively fair price. Highly recommended!

site_logo

Klaus Gummerer . 2024-10-26

MORE AT Google

The steak- sandwich is mouth- watering. Personally, I perfer a medium rare steak more than a medium-well.

site_logo

Mia Tran . 2024-10-14

MORE AT Google

Very good and tasty! Defo recommend

site_logo

Simeon Babadzhanov . 2024-10-05

MORE AT Google

If I could give 0 for customer service I would. Oh man was this staff rude!

site_logo

Steven . 2024-09-30

MORE AT Google

If you want ride customer service, a place that takes priority to ONLY Spanish speakers, and borderline spits in your face when you ask simple questions, then this id the place for you! 0/10 would not recommend to a friend a

site_logo

Margarita Yeromina . 2024-09-29

MORE AT Google

Spinach and ricotta empanada was out of this world. Steak sandwich was very good but I could only eat half of it as it was my second lunch 🥲. Very friendly staff. Seating stall in Borough Market is a huge plus too.

site_logo

Ahmed Al-Emadi . 2024-09-26

MORE AT Google

Excellent empanadas, especially the meat ones! Delicious! Spectacular service. Delicious beer and also the juices! The location is also very good because it is outside of the most chaotic area. Very good vibes all

site_logo

Josefina Martelli . 2024-09-23

MORE AT Google

Good to try something new. I haven't tasted this cuisine before and this gave a good start.

site_logo

harsha majety . 2024-09-20

MORE AT Google

The empanadas were fantastic, the service was great, all round a top tier experience. Tomas was a lovely and very accommodating server, I couldn’t recommend more.

site_logo

Josh Gibson . 2024-09-06

MORE AT Google

I went several times to buy empanadas because we are Argentinian. Yesterday, Sunday, I bought 8 meat and 6 ham and cheese as always, I'm going to the market by train. When I had dinner with my family, I served the empanadas and the 6 pieces of ham and cheese were not spicy chicken, which is very different, so my son and I were left without dinner. It is not very difficult to serve 6 empanadas Regrettable

site_logo

maria eugenia ribeiro escobar . 2024-09-02

MORE AT Google

Tasty empanadas and beers/wine. Good value too.

site_logo

Yorkshireman_Dan . 2024-08-16

MORE AT Google

The food was really good and very fast. Atmosphere was a bit weird as several times people came to ask for money and food.

site_logo

S M Iftekharul Huq . 2024-08-11

MORE AT Google

Borough Market is terrific and Portena seems to be an under appreciated find. My family and I grabbed some chicken and onion empanadas. I don't know what tbey season the chicken with but, it's delicious. I'd have liked the empanada dough to have been flakier but, it was a good meal.

site_logo

Steven . 2024-08-06

MORE AT Google

This is great, my first time here, I tried the Empanada it is great, also the Buenos Ayres gold, everything is authentic

site_logo

Wesley Mears . 2024-08-04

MORE AT Google

Very good empanadas in Borough Market. Recommending the meat one! Great quality-price

site_logo

F B . 2024-07-19

MORE AT Google

I recently grabbed a steak sandwich from Portena in Borough Market, London, and it was amazing. The bread was perfectly toasted, giving it a great crunch without being too hard. The steak was tender and packed with flavor, and the chimichurri sauce added a nice herby kick. The melted cheese and fresh tomatoes balanced everything out perfectly. With a cold drink on the side, it made for an awesome meal. If you're in Borough Market, you should definitely check out Portena.

site_logo

Daniel L. . 2024-07-14

MORE AT Google

Yummy empanadas- tried Caprese empanada. I’d love to try other ones too. Yum

site_logo

Pippi H. . 2024-07-11

MORE AT Google

Amazing service and delicious empanadas! A very good surprise.

site_logo

Vinicius Seixo de Brito . 2024-07-06

MORE AT Google

The most amazing Argentinian Empanadas in offer in London. We had a light lunch with each eating 2 beef empanadas, and sharing 2 of the chicken ones. They were juicy, full of flavour and yet so simple. We loved them, and the guys selling, making them, tidying up ate super, super nice. Perfect match when eaten with an Argentinian beer

site_logo

Paola OM . 2024-06-30

MORE AT Google

The one with tomatoes and mozzarella was very successful and made us very happy. I will come here again

site_logo

İbrahim Günhan Bahçe . 2024-06-26

MORE AT Google

No estaba seguro de qué comer y terminé eligiendo esto. Tenía una empanada y alfajores y sabían bastante bien especialmente los alfajores porque tengo un diente dulce.

site_logo

syl_via . 2024-06-14

MORE AT TripAdvisor

Was asked to leave their seated area even though I had bought several empanadas from their shop. They said I was eating something from elsewhere at the same time as my empanadas I was no longer allowed to sit in their area. As a long standing customer of theirs for over 5 years expected better. Lost me as a customer unfortunately as all the tables were empty and my lunch break was ruined by this.

site_logo

DJ Khriz UK . 2024-06-12

MORE AT Google

Mozarella and pesto empanada was deliciousz definitely a must try. Loved the sandwich and grilled taste of the meat as well. It was also great that there was some seats, which is not very common in Borough Market

site_logo

simge tabak . 2024-06-10

MORE AT Google

Everything is very nice, rich and cheap

site_logo

Silvina Ciribeni . 2024-05-17

MORE AT Google

Nice place for Argentinian food Tuesday to Sunday!

site_logo

Carlos Gouveia . 2024-05-13

MORE AT Google

Excellent option at Borough Market. The empanadas are cheap, with a generous amount of filling and freshly made. The taste is excellent and it was overall a great snack choice.

site_logo

benhockey97 . 2024-05-11

MORE AT Google

Fantastic Argentinian empanadas, recommend the ricotta and spinach and the chorizo

site_logo

Daniel Yao . 2024-04-30

MORE AT Google

The meat sandwich was delicious and the staff was lovely! Highly recommended

site_logo

Gema . 2024-04-28

MORE AT Google

A pleasure to be able to buy weed in London!

site_logo

Matías Sebastián Murgui . 2024-04-28

MORE AT Google

Walked past it in the morning where market was quite but a queue was by this small place, explored with no regerets! Best empanada! I tried the cheese with caramelised onion! Very generous filling and pastry so light!

site_logo

Rabab Almaajoun . 2024-04-27

MORE AT Google

Perfect place to pick up Argentinian empanadas for a picnic or eat a delicious Lomito. Good service.

site_logo

Jaquelina Giuliani . 2024-04-17

MORE AT Google

Lead staff member is so rude - it appeared to be our fault he had no wine glasses, that they were busy and we allegedly didn’t hear our names called. Shame as his obnoxious manner soured our enjoyment of the food. I feel they are so entitled we won’t come back.

site_logo

Jill Cuthbert . 2024-03-21

MORE AT Google

These empanadas are incredible. They are perfectly crispy and flakey, and packed with so much flavor. We only got two, one chicken and one beef, but they were both so so good.

site_logo

Eric Hansen . 2024-03-08

MORE AT Google

Had a steak sandwich at Portena while we were visiting London for the afternoon/evening. The staff were friendly, the food was served quickly, and it was really tasty. There is a seating area under the bridge to eat. Would definitely eat here again.

site_logo

Dani Atanacković . 2024-03-08

MORE AT Google

Best empanada and alfajores. Great staff, piece of Buenos Aires in London

site_logo

renato . 2024-03-04

MORE AT Google

Delicious, fresh, hot empanadas. Highly recommend the chorizo empanada and the spinach/ricotta empanada 🫶🏻

site_logo

Kate De Oliveira . 2024-03-02

MORE AT Google

Empanadas 👌🏼👌🏼👌🏼🤍 will come back surely

site_logo

Vlada Jakovleva . 2024-02-18

MORE AT Google

If you are undecided about where to go in the market, you can't go wrong here 🇦🇷 Delicious chicken empanada and steak sandwich

site_logo

David Carvalho . 2024-02-17

MORE AT Google

Si sos Argentino y estás en Londres, anda sin duda a probar las mejores empanadas que puede haber, sin duda te transportan a tu país. Son un 10 chicas

site_logo

Mili Cattelani . 2024-02-16

MORE AT Google

Muy rico, muy ricas las empanadas y los sándwiches.Los alfajores son una delicia.Aparte venden chimichurri y Yerba.En general es riquísimo todo.

site_logo

maria eva vincenti . 2024-02-14

MORE AT Google

WOOOOOOOOOOOWWWWW!!!!! Empanadas were amazing!!!! Best authentic Argentinian food I have had in such a long time! The staff were friendly! Highly recommend! 😮‍💨😮‍💨

site_logo

alex . 2024-02-10

MORE AT Google

Delicious Argentinian food - I just got back from trip around South America and this was as good as anything I had in Argentina 🇦🇷 juicy steak - massive portion - crispy sandwich. They also do choripan, empanadas, wine and beers 🍻 - real asado experience - best food in Borough Market!

site_logo

Elaine Heaney . 2024-02-07

MORE AT Google

As arrogant as you can expect. Do not spend a cent there.

site_logo

Hernan Ibanez . 2024-01-28

MORE AT Google

No steak sandwich available, only empanadas. They were not great, full of spices that don't belong there. You can eat them, but not the real Argentinian empanadas (trust me, I'm an Argentinian myself)

site_logo

Sebastian Cruz . 2024-01-18

MORE AT Google

Food was okay (got the empandas and steak sandwich), but was asked not to sit at the outside table even though we only got food with them and there was majority of tables were open

site_logo

Terance Kurry Jimenez (Tari) . 2024-01-16

MORE AT Google

Awesome little Argentinian spot in Borough Market. While we were there it appeared to be completely run by women (which would make sense with the name). They were crushing it and the food was great. Not traditional Argentinian empanadas or choripan but good nonetheless. The choripan came with lettuce and tomato instead of grilled onions and the fresh veggies were a nice change up. The empanadas were delicious and baked perfectly.

site_logo

Kumar Jensen . 2024-01-08

MORE AT Google

Vinimos aquí por recomendación de unos amigos y nos pareció un poco caro para lo que comimos. El chimichurri de los choripanes no nos gustó, tal vez es cuestión de gustos. Las empanadas estaban buenas.

site_logo

Fu Shoots . 2024-01-07

MORE AT Google

Pretty good empanadas. Try it out!

site_logo

Nicolaj S . 2023-12-21

MORE AT Google

Estar lejos de casa y querer comerse una empanada como Dios manda es mil veces más fácil gracias a ustedes. La empanada de carne es sencillamente ideal.

site_logo

Fede Gutierrez . 2023-12-20

MORE AT Google

The empanadas are good but i went for the steak sandwich. The meat was thin, not cooked very well and the quality of the meat was low. Super stringy and chewy, was honestly horrible to swallow. Would not recommend, service was not great either.

site_logo

Mert Oktay . 2023-12-19

MORE AT Google

Some of the worst empanadas I’ve ever had. There’s hardly any chicken filling or beef filling. They are seriously rationing on the protein. Avoid,unless you’d prefer a bland vegetable and potato empanada.

site_logo

realenglishnic . 2023-12-18

MORE AT TripAdvisor

Had the steak sandwich, very nice. Only outdoor seating (heated though). Good value for money, would come back. Thanks

site_logo

Megan Goldup . 2023-12-16

MORE AT TripAdvisor

Sono stato in Argentina dove l’empanada rappresenta l’istituzione dei piatti locali e di conseguenza gode di un’attenzione esclusiva, ma qui al porteña shop di Londra ho mangiato quelle che fino ad ora posso dichiarare di essere state le empanadas più friabili e gustose che abbia mai mangiato.

site_logo

Andrea Beltramo . 2023-12-13

MORE AT Google

Uno de los mejores bocadillos que he comido nunca!!!!

site_logo

Carlos Valls . 2023-12-10

MORE AT Google

Best place I've ever eaten at in London. Their empanadas are wonderful.

site_logo

Stefano Rossetto . 2023-12-08

MORE AT Google

One of our favorite places in the Borough Market. Excellent food, good prices... and very good atmosphere. Quality Argentine street food. The empanadas and meat sandwiches are a delight...!!!! Our obligatory stop every time we are in London.

site_logo

Claudio Rojas . 2023-12-05

MORE AT Google

Delicious, authentic empanadas. My husband's family is from Argentina and we sought this out specifically during our trip to London. Steak sandwich was also fantastic and they serve Quilmes beer:) Would go back again!

site_logo

Taylor T . 2023-11-30

MORE AT TripAdvisor

Went to porteña in borough market for a quick bite and left quite disappointed. Empanada wasn’t very hot and it was quite burn. Filling wasn’t great neither it tasted a lot of cumin instead of beef which is what I got.

site_logo

MissMP . 2023-11-29

MORE AT TripAdvisor

Great empanadas and beef sandwich! The staff always helpful and really friendly.

site_logo

Sophie Oliver . 2023-11-26

MORE AT Google

Shocking service really rude waitress, spent £50 on food and was asked not to sit on the seating area

site_logo

Jack Rowan . 2023-11-26

MORE AT Google

Siempre que visitó Londres me agá una escandirá para comer las mejores empanadas Argentinas el mejor sabor Argentino, y por supuesto comprar un cajita de Alfajores Havana 😋 Best place to eat Proper Argentinian food, super delicious 😋 and the service is the best!!! Thank you 😊

site_logo

Rosario F . 2023-11-26

MORE AT TripAdvisor

Best empanadas in London. We know the staff and, as all the Argentinian people, very friendly and nice. They hace recently increased the prices and it’s not longer cheap, but still price competitive for London.

site_logo

Laia atik massana . 2023-11-19

MORE AT Google

Food is good, but the staff is rude. We’ve got some empanadas, but someone in our party wanted to get oysters next door and the attendant yelled at us saying they wouldn’t allow to use their tables if we put a the oysters on the table. I believe it shouldn’t be all about the food. We felt disrespected.

site_logo

Paulo Amorim . 2023-11-17

MORE AT Google

Open later than other food stalls. Great for a evening bites. Products are fresh and tasty. Good service. Empanadas are good value, steak sandwich price is a bit high (used to be 9£) but that’s due to the central/ touristic area dynamic and

site_logo

Christophe Giot . 2023-11-17

MORE AT Google

Empanadas e panino con la bistecca fantastico.

site_logo

ivanolmen . 2023-11-16

MORE AT Google

Great steak sandwich and empanadas. Very kind staff. And lovely atmosphere during the evening/night is

site_logo

Furr J . 2023-11-07

MORE AT Google

The guy was so rude for no reason! I asked how long for the chicken and beef, he said 5 min, I said okay I’ll have one of each and a spinach/ricotta. I waited and then as I came up I noticed my Apple Pay only said £7, so when I asked (POLITELY) I mentioned that I noticed I only paid 7, and I was confused as o said one of each and the one I was already holding. He said “no you said beef” and I was literally gona say that I wanted both chicken and beef and was willing to pay, but in that moment he decided to tap his ears and said maybe you didn’t hear me cuz of your headphones (which I paused before I ordered so, NO), I was so confused because who was he talking to like that? He then put one of the empanadas in the bag and tried to go to put the other in and I grabbed the bag and said ‘oh no it’s fine I don’t want it” and then switched to Spanish—because o don’t think he realised I was Latino and so was treating me with less respect—and told him that ‘I DID SAY THAT, BUT YOU DIDNT HEAR ME’. I said this Twice—to ensure he heard me correctly, then walked off. Both empanadas were DISGUSTING, and I threw them out after two bites each. What a disappointment for both food and experience. Deff sticking to TACOS EL PASTOR (right across) for my Latino food fix because they are always nice and their food is actually tasty.

site_logo

Hannah Garcia . 2023-11-07

MORE AT Google

Similary restaurants in London

restaurant_img
4.3

432 Opinions

location-icon36 Snowfields Bermondsey, London England
Other international cuisines
outdoor_seating_250863takeaway_250863delivery_250863

Disappointing. We had our starters and mains (one of which had a hair in it) and skipped dessert. The 2 star award was surprising to say the least. Wouldn’t recommend or go back.

restaurant_img
4.4

799 Opinions

location-icon103 Newington Butts
Other international cuisines
outdoor_seating_72293takeaway_72293delivery_72293

great authentic peruvian food! good prices, friendly staff. gracias!!

restaurant_img
4.2

362 Opinions

location-icon63 Choumert Road
Other international cuisines
outdoor_seating_70481takeaway_70481delivery_70481

Tried to visit twice now for lunch during opening hours, once on Tuesday of this week and the other on Saturday of last week. Both times they were unexpectedly closed.

restaurant_img
4.5

63 Opinions

location-icon21 St Thomas Street
Other international cuisines
outdoor_seating_68317takeaway_68317delivery_68317

The Spiazzo Cafe had a great atmosphere and the baked goods were delicious. The entree's offered were fantastic too.

restaurant_img
4.1

14668 Opinions

location-icon2 More London Riverside
Other international cuisines
outdoor_seating_70165takeaway_70165delivery_70165

It was for my boyfriends 50th and I am so grateful for everything you did to make it special... the happy birthday on the pudding and the surprise complimentary drinks as well as accommodating us with a river view as requested. Thank you! It was a perfect