Based on 361 opinions finded in 1 websites
Based on 361 opinions finded in 1 websites
Opinions
Ordered the burger which came out with a completely frozen bun. After sending back it was returned warm but rock solid like concrete so completely inedible. Waitress told me they don’t use frozen bread but my bun had ice on it and was frozen solid. Being absolutely starving I did eat the meat which was lovely, fries were cold after going back and coming back out. My husband ordered the chicken burger which had a completely different type of bun and was fine. It was good he said but he had finished eating several minutes before my meal was returned. Overpriced
Mobile18337431623 . 2024-01-22
MORE AT TripAdvisor
I would not go back if you paid me. The waiting staff were lovely and I couldn’t fault them, they did their best but the food was very expensive rubbish. The chef couldn’t even accommodate a simple request of food (egg and chips) due to food allergies and there being nothing on the menu that was suitable. They wanted me to pay £8 for a poached egg !!! I had 9 chips which cost £4 and the oil they triple cooked them in left a disgusting taste in the mouth like nothing I have ever had before. This wasn’t the first time either as we had tried the restaurant 2 weeks before and got the same disgusting food issues, but that time I tried the GF pasta dish which was made for Tom Thumb I think and was dreadful for the price, but we gave them the benefit of the doubt and tried again and it was just as bad if not worse. I don’t think I have ever had food as bad as this anywhere in my life or been treated so badly by the chef who was the one stating the poached egg would cost me £8. I can not recommend this restaurant (loosely using that word) to anyone for anything. Avoid at all costs, there are far far better actual restaurants in Bury St Edmunds that you can go to and get much better food and better value for money.
Spursgal10 . 2024-01-09
MORE AT TripAdvisor
We have enjoyed Sunday lunch at No. 4 a couple of times in the past couple of months. Today I had carrot and cumin soup as a starter. The soup was warming for a cool Autumn day with just the right amount of cumin. For our mains we had slow roast pork belly. The pork was tender and the skin lovely and crunchy. The parsnips, carrots and cauliflower cheese were tasty and cooked perfectly. The staff were attentive at all times. If you haven’t visited No. 4 for a Sunday lunch it really is worth it. You’ll love it.
David G . 2023-10-29
MORE AT TripAdvisor
Very disappointed, booked a table for 3 people to have a meal after the film. When we arrived at the restaurant we were struck at a table away from the main bar ,when I complained about where we were sitting we were moved into the main part of the restaurant,why we were not seated there in the first place is a mystery. And to make things worse when my wife and myself ordered ,the dish my wife ordered from the special menu was not available. and the 3 choices on the main menu were also not available, the chef told us that he didn’t order enough . My wife and myself have been going to the cinema and restaurant for at least 15 years, I’m sorry to say the standard has gone down in the restaurant.
David L . 2023-10-18
MORE AT TripAdvisor
Very tasty poke bowl with wild mushrooms. I went for a small but maybe could have had a large (although I had room left for a very good slice of coffee cake). Really good service with friendly and helpful staff.
Alison R . 2023-10-14
MORE AT TripAdvisor
Absolutely amazing roast dinner , yummy dessert, great service , cannot fault anything will be returning soon , 5 ⭐️⭐️⭐️⭐️⭐️
dawncooper121 . 2023-10-01
MORE AT TripAdvisor
We had organised a family meal to celebrate a birthday and booked the newly refurbished function room for a meal followed by a film. Staff were friendly, efficient and helpful. The food was well-cooked and tasty and portions were generous. The function room was a lovely space for parties and events. Thank you for a fantastic evening!
lynneg849 . 2023-09-21
MORE AT TripAdvisor
Quite possibly the best roast dinner I have every had. Service was amazing. Absolutely nothing the fault.
Ash L . 2023-09-18
MORE AT TripAdvisor
Came here for Sunday roast today and it was honestly amazing! I don’t tend to leave many reviews, but felt this place needs to be praised for doing such a great job. The staff are all friendly, attentive and nothing is too much trouble. The place is clean and tidy throughout. The Food was beyond amazing, we got starters, Sunday roast and a dessert for £23 per person, and I cannot fault a single thing! All food was cooked perfectly, nice size servings and presentation was on point. We spoke to the chef, and you can just tell he truly loves what he does and cares about the food he serves- which shows in the amazing meals he presents. No. 4 has become a new favourite of ours, great food at great prices- I know we will be back soon!! Thank you all for an amazing meal 😊😊
charley p . 2023-09-17
MORE AT TripAdvisor
Had a fabulous slow roast belly of pork today. Fresh veg and beautiful roast potatoes with a lovely cauliflower cheese on the side. I opted for no Yorkshire pudding but could see they were homemade and my companions vouched they were delicious. Fabulous summer berry trifle for dessert afterwards with plenty of fruit, one of the nicest trifles I’ve eaten in a long time. Thoroughly recommend the roasts - will be back !
Natalie C . 2023-09-17
MORE AT TripAdvisor
Great ambience, attentive staff and top class food, superb ! Would recommend to all, I had the roast beef and it was excellent.
Venture62413740505 . 2023-09-17
MORE AT TripAdvisor
Looked on line at local restaurants, didn't know the abbeygate cinema had one. I looked at small but very interesting menu. It's my girlfriends birthday and decided on no4 based on menu. So glad I found it food and service where absolutely top notch. In a town known for its restaurants, no4 was real surprise amazing food for middle of road prices. We will be back very soon
guy g . 2023-09-15
MORE AT TripAdvisor
Booked for a meal at 7.30pm after watching the film "Lie with Me", the film finished at about 7,50pm rushed downstairs to the restaurant, only to be told the kitchen closes at 8pm and the kitchen staff have gone home! Interesting since when I booked I was asked that the restaurant may want the table back by 9.10! Also received an email this morning from No 4, asking me for my opinion of the restaurant and food the previous evening!
thomas052 . 2023-09-06
MORE AT TripAdvisor
Disappointed that the snack menu had been withdrawn meaning even less vegetarian choice, couldn't recommend this venue.
Dream13392716702 . 2023-07-23
MORE AT TripAdvisor
A really nice restaurant inside the cinema. Food was great and the price good too. Highly recommended
nha29 . 2023-07-11
MORE AT TripAdvisor
We have been twice in recent weeks and had trout the first time and repeated with the second visit, it is really good and am pleased that the restaurant is back to the high standards we were used to. the service is always good and...
Anne c . 2023-07-10
MORE AT TripAdvisor
Another excellent dish from the specials menu, although, as I mentioned to the staff, it was described as an Italian Sausage and bread dish, but was sausage and lentils with bread on the side. A dish I cook myself from a Jamie Oliver recipe. No...
silked286 . 2023-05-29
MORE AT TripAdvisor
Always liked No4 and always like to support independents with genuine food and great tesm but even more so now that it's got its mojo back. Fantastic piece of grilled sea trout with samphire, mome-made pesto, potato cake and lemon butter. Pair with white rioja...
Augeas . 2023-05-02
MORE AT TripAdvisor
We noticed there was a new menu which sounded nice so booked online for evening meal. We chose fish and chips, reasonable portion size, nice crushes peas, the gluten free mushroom pasta was very average and very small for a main dish, the chicken cesear...
Chris N . 2023-04-01
MORE AT TripAdvisor
The menu was so poor we left, nothing really more to say, except it had been rather good, when the New Zealand chef was there
I1673RJthomasb . 2023-03-24
MORE AT TripAdvisor
Fabulous meal at lunchtime. Baguettes with bacon, brie & cranberry, huge side salad + fries. Prompt service & friendly waiter's. My new "go to" eatery in Bury St Edmunds. Keep up the good work.
nickynik1 . 2023-03-04
MORE AT TripAdvisor
We haven't been to No 4 for a long time, ie., pre-covid. As we had rejoined the Abbbeygate cinema, it was time to make a return visit. I was aware that they had been experiencing mechanical kitchen problems, the temporary menu didn't look great, but...
salllymac65 . 2023-01-30
MORE AT TripAdvisor
Family brunch today was fabulous. Beautifully presented, huge portions freshly cooked to order. Good veggie selection and best mocha I’ve had in years. Excellent service from the Abbeygate team. Couldn’t fault in any way. Absolute gem.
patrickallenblake . 2022-12-31
MORE AT TripAdvisor
I used to love eating here, as well with the members discount, and it being round the corner, my fav restaurant in town. I think I love it even more now! I have eaten here twice, and both times I wanted to eat at least...
silked286 . 2022-12-14
MORE AT TripAdvisor
Have eaten at the restaurant many Times in the past . Decided to take some friends from out of town to “ one of my fave “ restaurants. OMG. what a experience. Bad food & service with attitude!. Sorry guys you need to know it’s...
K8627JHpatrickd . 2022-12-01
MORE AT TripAdvisor
We have been eating at No. 4 for years, we have recommended the place to all those asking where to get a great lunch or burger, and today was a disappointment on so many levels. First the menu has shrunk, which can be understood in...
Sylviane M . 2022-09-25
MORE AT TripAdvisor
We have used this restaurant a lot - always for a relaxed meal before a film. However, on this visit we discovered that there is a new chef and the menu had totally changed; in our view, not for the better. We both had one...
Suffolk007 . 2022-05-29
MORE AT TripAdvisor
We had only eaten here a couple of times in the past as we would struggle to find something on the menu to suit everyone. Last month we met up with friends for a meal before watching a film and there was a new menu...
Wedsuffolk . 2022-05-14
MORE AT TripAdvisor
New year bank holiday - everywhere seemed full. We walked past the window of the cinema looking for somewhere to eat lunch. No.4 had a table for 2. The menu gave us a huge choice and when the food was delivered it far exceeded our...
yellowlines1 . 2022-01-03
MORE AT TripAdvisor
Excellent service the food is amazing and great value for money I would highly recommend a visit if you’re in Busy st Edmunds
Brian R . 2021-11-15
MORE AT TripAdvisor
We arrived a bit early for our table but it was ready and we were warmly welcomed. Our orders were taken quickly and the food arrived in a timely manner. The food was delicious and we asked for our compliments to be sent to the...
PeachySuffolk . 2021-11-05
MORE AT TripAdvisor
First return to our regular restaurant following lockdown, as good as ever if not better. All the staff were friendly, attentive and helpful, nothing was too much trouble. The food was really good for a light snack or something more substantial. The burgers are most...
marilynj322 . 2021-10-23
MORE AT TripAdvisor
Had a meal there for the first time before watching Dune. Menu had lots of choice, also good selection for vegetarians. Food was tasty, staff very friendly and efficient. Also, great value for money.
gill g . 2021-10-22
MORE AT TripAdvisor
Staff were extremely helpful and friendly. The Menu has a great selection. Food was hot and tasty. My friends and I thoroughly enjoyed our evening. We will be back. Thank you.
Valerie999999 . 2021-10-15
MORE AT TripAdvisor
The restaurant has a lovely atmosphere, comfortable seating areas. Very friendly and attentive staff and service. Wide variety and choice of dishes available, something for everyone. The food was delicious. I had chicken chasseur and my sister had the jambalaya rice bowl which both tasted...
Q255FDpennyb . 2021-10-14
MORE AT TripAdvisor
As ever excellent meals, burger and teriyaki bowl. Staff really friendly too. Will be back soon. Great film too in.new Premier screen
sarapF7442ZR . 2021-10-12
MORE AT TripAdvisor
Probably the best burger in town! But a little bit miserly on the coleslaw and fries. Staff were very friendly and good humoured!
Canberra16 . 2021-10-10
MORE AT TripAdvisor
Burgers are always amazing and food hot and fresh Great service and nice friendly atmosphere We love it
sharonjG7779LI . 2021-10-08
MORE AT TripAdvisor
Really good first experience here! We were going to see a film so it was convenient - but would definitely return whether using the cinema or not. The food was delicious, service good and a great atmosphere too. Thank you!
katieg541 . 2021-10-06
MORE AT TripAdvisor
Had a lovely meal with interesting choices and friendly staff, reasonable prices, would go again. One veggi one meat eater happy!!
G8104JBamandar . 2021-10-04
MORE AT TripAdvisor
Before watching the film we ate some nice tasty burgers (bacon and cheddar). Impressed by helpful, friendly service.
chazza57 . 2021-10-02
MORE AT TripAdvisor
A Lovely restaurant tucked away inside the Abbeygate Cinema building in Hatter Street. We had booked a table for 12 for a family celebration , the service was excellent, food arrived promptly and was delicious as well as very good value for money. The staff...
1geecee . 2021-09-26
MORE AT TripAdvisor
For a small casual dining experience the menu selection is great. But importantly the food was so fresh and tasty. Even though I went in not planning to eat much I couldn’t resist!
Jennifer B . 2021-08-30
MORE AT TripAdvisor
The food is fresh, tasty and not over complicated. The staff are friendly and approachable. Thank you for finding me a mug of tea. We’ve eaten in more prestigious places and you beat them hands down. AND the movie was fabulous too - what’s not...
S2794JUhelenb . 2021-08-23
MORE AT TripAdvisor
The location couldn't be better for the cinema. The food is always good with a nice selection of items. The best part is the staff, always helpful, friendly and genuinely pleased to see/help you. A fantastic place we keep coming back to.
Dan_MarthaMildenhall . 2021-08-19
MORE AT TripAdvisor
Quirky restaurant with nice friendly atmosphere attached to the cinema, good service, interesting menu with drinks.
NCD36 . 2021-08-19
MORE AT TripAdvisor
The Alpha omega salad with garlic prawns was delicious, and we can never resist the pecan tart. Unusual menu - we always enjoy the food here.
Margaret Joan K . 2021-08-19
MORE AT TripAdvisor
Nice atmosphere and a relatively simple but well thought out menu. Food was tasty and fresh. Really enjoyed the malted milk-shake. Surprisingly cheap lunch for 2. I will definitely return.
Refdef . 2021-08-06
MORE AT TripAdvisor
Visited this cinema and restaurant for the first time last night. The food was delicious and very good quality, as was the service. I enjoyed the best burger and chips I've had in ages. The burger was very meaty, cooked to perfection, and the fries...
Destination692001 . 2021-08-06
MORE AT TripAdvisor
The burgers were delicious. Best I have had anywhere in town. Thick and juicy with bacon and cheese. I almost thought I should have split one instead of having a whole one. They were that big! And i modified the TexMex fires to my liking...
samhR6962UW . 2021-07-20
MORE AT TripAdvisor
The menu was very varied and interesting. Lots of items not available iin many restuarants. Prices were reasonable and the service was good. I would definitley recomment this to all diners
564declanc . 2021-07-19
MORE AT TripAdvisor
The combination of the restaurant and lovely cinema is hard to beat. Had Lisa club sandwich which was delicious and tge naughty but nice loaded fries.
Jane G . 2021-07-09
MORE AT TripAdvisor
fabulous range of food and absolutely gorgeous …… winner for all the kiddies too. Lovely, friendly and welcoming staff from entering and buying pre cinema snacks to being shown to our seat by a lovely gentleman and then fab waitresses and waiters for our meal....
alicepD5332LS . 2021-07-04
MORE AT TripAdvisor
/ 5 Likelyhood of return 4 / 5 Comments Reliable as ever. Staff were attentive, food came in good time and was very tasty, well presented and good value for money. So nice to be able to have a bite to eat and see a...
dennisr913 . 2021-07-03
MORE AT TripAdvisor
Well done to all at No.4 Restaurant & Bar. We had a meal there on June 18th. The food was freshly prepared, delicious, well presented and hot. The staff were cheerful & efficient throughout. We appreciated that there were plenty of vegetarian/vegan options & we...
U98GGsarahi . 2021-06-21
MORE AT TripAdvisor
Friendly and efficient service. Interesting menu with a variety of dishes from around the world plus good, basic burgers etc.
mctilley . 2021-06-19
MORE AT TripAdvisor
We had burgers and sweet potato chips, followed by coffee and a cookie. Not over priced. Tasty enough. I would have appreciated some salad vegetables in my burger though, although it was nice, and the bun was a toasted potato bread roll which was a...
L2238TFLouiseM . 2021-06-18
MORE AT TripAdvisor
We eat here frequently before or after seeing a film at the fantastic Abbeygate cinema. The service is great as is the food. I usually order the Korean Bimibap but the Teriyaki is also good. The prices are excellent
barbarawW2050NA . 2021-06-17
MORE AT TripAdvisor
Service is just great. Food is really tasty and served quite quickly considering its freshly cooked. The burgers are cooked to perfection (just the right side of pink). Only concern (and hence only the three stars) is the price of the chips. The classic fries...
Nick G . 2021-06-16
MORE AT TripAdvisor
As a local who some French-Canadian heritage I had to try the poutine (cheese curds and chicken gravy on chips). I loved it and it was filling. The chocolate milkshake was equally yum. Staff friendly too.
scottsY5503BB . 2021-06-14
MORE AT TripAdvisor
Great choice for vegetarians. I particularly love the Alpha Omega salad which is fresh and delicious. Accompanied with the seasoned fries, it makes a great meal either before or after watching a film. Easy to book a table and the staff are very efficient and friendly.
Cathy1970 . 2021-06-13
MORE AT TripAdvisor
Great meal as always. We love eating at No 4. Never had a bad meal. Look forward to our next visit. When in Bury St Edmunds we always eat at No4 and we are never disappointed
203jenniel . 2021-06-08
MORE AT TripAdvisor
Another excellent meal - the perfect 'meal and a movie' combination. We each had a single main course, quickly and charmingly served, as usual, and then strolled into the cinema. Great evening.
Suffolk007 . 2021-06-08
MORE AT TripAdvisor
I've always liked the burgers at No.4 and - post-lockdown - they are as good as ever. Thank you for the warm welcome and the fine food.
BJM2712 . 2021-06-05
MORE AT TripAdvisor
Pre booked and was given the table and position that I requested, very good service by ? Food followed quickly, excellent Burger, moist (not dry like so many) and meaty. very good Stem Ginger ice cream followed. An interesting menu, and an ideal venue after a film.
woolpiti . 2021-06-04
MORE AT TripAdvisor
It was easy to book online and we arrived in plenty of time to eat before watching a film. Very safe experience with spaced out booths and service was both speedy and friendly. My husband had jerk chicken and I ordered my usual kedgeree which I didn't manage to finish this time as my husband passed over the asparagus from his plate. Very good as always and we will return soon.
Glynis B . 2021-06-04
MORE AT TripAdvisor
We got in 45 minutes earlier than planned but were immediately offered a table. Very pleasant staff couldn’t have been more helpful. Really good food and Brewshed beer. What’s not to like!
clueyandjohn . 2021-05-27
MORE AT TripAdvisor
Lovely place to eat, really relaxed and the food is very good. Arguably the best 'cinema food' experience available.
steveholdenmail . 2021-05-26
MORE AT TripAdvisor
Very organised, great food and staff are friendly. We accidentally booked the wrong day for our lunch (watching Minari afterwards) and the staff managed to fit us in - thank you
Jane G . 2021-05-25
MORE AT TripAdvisor
Lovely to return after lockdown - reassuring that the previous interesting menu with some tasty vegetarian/vegan dishes is still on offer. Service excellent, friendly & efficient. Ambiance relaxed & welcoming. Always a delight to visit.
L2934RUpeterf . 2021-05-25
MORE AT TripAdvisor
If you want a safe place to visit after the lifting of restrictions, this is the place to go. Great food, drinks & staff. Excellent standards of safety are in place here.We really enjoyed the food ordered, kedgeree & chicken chasseur. Both were well presented & seasoned. We appreciated staff giving us time to make up our minds without being hassled. As members we had booked to watch a film after our meal. We ordered 2 coffees to take into the cinema with us which we also enjoyed.Our only gripe was that it was chilly in the restaurant & cinema on this visit.
MagsB57 . 2021-05-24
MORE AT TripAdvisor
Thoroughly recommend for a meal especially with the current restrictions in place the service was fantastic and the food was amazing possibly one of the best burgers I have eaten and the Poutine fries were out of this world ... I for one shall definitely be coming back
Dez-Bse . 2020-12-18
MORE AT TripAdvisor
Had a chicken burger which due to diet requirements was on the plain side but the restaurant were more than happy to remove ingredients.Good tasting chicken burger however the red cabbage garnish did leak into the burger bun, might be best to ask without.First time trying poutine fries and although the cheese/gravy combo shouldn’t work, it combines really well.All pandemic precautions taken, table service and tables distanced.
RKanharn . 2020-12-16
MORE AT TripAdvisor
Good food,bunless burger & chicken curry my favourites , great service, excellent staff & a relaxed Covid secure atmosphere
Simon W . 2020-12-10
MORE AT TripAdvisor
Another fab meal at No4. I love all the food and especially the rice bowls! Excellent service as always and immaculately clean and safe. We will be back soon!
simong302 . 2020-12-09
MORE AT TripAdvisor
Despite enjoying No 4 in the past I was sadly disappointed this visit. The three staff members were more interested in their (loud) conversation and had to be interrupted to order drinks. The food was uninspired. In these times I would expect service to be of prime importance. Won’t hurry back
ellisros24 . 2020-12-06
MORE AT TripAdvisor
I think this place has the best burgers in BSE!! The menu is a bit limited during COVID, as they usually have a ‘name your own burger’ but the #4 burger is still brilliant!😋😋
joemooney802 . 2020-12-05
MORE AT TripAdvisor
Great food and service and, although the atmosphere wasn't as warm and buzzy as it was pre-Covid, it remains one of the best places to eat out with atmosphere, scrumptious food and friendly service in Bury St. Edmunds.
Tamara H . 2020-11-10
MORE AT TripAdvisor
We had a) kedgeree bowl and b) bunless chicken burger bowl and both were really good and were served quickly from the time of ordering. Brewshed Bitter and Sauv. Blanc wine went down very well as accompaniments. We ended with one of our favourites - the Nanaimo bar which can't be faulted!! This was a meal before the cinema showing and worked extremely well. We gave ourselves an hour and a quarter prior to the film showing and our timing was spot on. Well done everyone!
Escape622212 . 2020-11-07
MORE AT TripAdvisor
Delicious light lunch (melted cheese and spinach dip) for an incredibly reasonable price. Rather a long wait between waiting staff appearing, but a very pleasant experience. Going back later in the week.
Wendy K . 2020-10-27
MORE AT TripAdvisor
I visited today with my three children. We loved the food and two of my children are very picky with food but they ate nearly all of it. It was a treat as the 35% off food was still going. Staff were helpful.
simone1032 . 2020-10-26
MORE AT TripAdvisor
Excellent pre-film meal - particularly the flat iron steak - cooked to perfection. V attentive staff with all Covid issues attended to. Didn’t wish to take advantage of my membership discount as this venue, as all others, needs our ongoing support in order to survive.
matthewgJ7706OW . 2020-10-25
MORE AT TripAdvisor
Burger and chips to die for - lovely Malbec - and a great discount! Well done guys, we will be back ASAP!!
Shropshirefoodie . 2020-10-22
MORE AT TripAdvisor
Very quaint restaurant associated with local cinema. Great visit the other night. COVID precautions well attended. I had the No4 burger, which was excellent This is in fact my favourite place for burgers in Bury St Edmunds. Wait staff were attentive. Running a limited menu at present, but has choices to appeal to most every palate
joemooney802 . 2020-10-21
MORE AT TripAdvisor
Excellent meal and outstanding value for money. Staff very attentive and made us feel very welcome whilst following the necessary Covid processes at the same time. The Moroccan Prawns for starters were delicious and the Poutine was the best I’ve had outside Canada. We will definitely return.
andydalziel2018 . 2020-10-21
MORE AT TripAdvisor
First meal in a restaurant for 6 months. A very tasty light meal with attentive service. Inexpensive. Excellent Covid-19 precautions.
DiscerningReggie . 2020-10-20
MORE AT TripAdvisor
Nice meal at No.4 before heading into the cinema. Very organised, spacious and the staff were friendly and did everything needed to make customers feel comfortable and safe. Tuesday promotion meant the meal was discounted which made it even more enjoyable!
dawnbT3246NY . 2020-10-17
MORE AT TripAdvisor
The service is prompt and you are made to feel so welcome. We recommend the burgers - both jackfruit and standard are delicious. Lovely fries too. I've also had a tasty 'spicy garden' rice dish with extra garlic prawns on top. A good range of drinks too - we had locally brewed lager which was the perfect accompaniment to the meal. We hope to be back soon!
Caroline B . 2020-10-16
MORE AT TripAdvisor
Great waitress service .. helpful tips. Good and unusual vegetarian choice. Hygiene excellent. Very good value for money
11Suem111 . 2020-10-14
MORE AT TripAdvisor
Great food, safe, and friendly. We enjoy being members for the movies and the great food, with discount. Highly recommend.
Ted A . 2020-10-13
MORE AT TripAdvisor
Got e-mail touting new menu items and the Moroccan King Prawns jumped out at me. Went today for lunch and had them as starter for lite lunch. YUMMY I'll have them as main course next visit which won't be that far away.
Dan_MarthaMildenhall . 2020-10-13
MORE AT TripAdvisor
Had a great bowl of chicken and rice protein well presented and tasty in a lovely relaxed environment.Staff were cheery, helpful and nothing was too much trouble.Always difficult with masks on. But a good start to the day for me. Well done all the staff.!
Mark S . 2020-10-12
MORE AT TripAdvisor
We have never have always had great meals at this venue and the staff are always friendly. The service is also quick.
Gladiatethere . 2020-10-12
MORE AT TripAdvisor
Always lovely Nothing is too much trouble Staff are great Food is quirky and excellent Great restaurant
Linda W . 2020-10-12
MORE AT TripAdvisor
Charming and efficient service, interesting menu, great ambiance. We saw a film them had a meal - a whole evening out for two for less than £65. It all felt very COVID safe, too.
Suffolk007 . 2020-10-11
MORE AT TripAdvisor
The Abbeygate Cinema is a little gem. Not only does it screen a broad range of films, from arthouse to blockbuster, for all ages but the restaurant, No 4, is without doubt the jewel in the crown. Imaginative and beautifully prepared dishes served with flair and attention to detail by the restaurant's young staff and all at very reasonable prices. Coronavirus safety rules are strictly followed both in the cinema and the restaurant, without destroying any of the enjoyment. It would be too awful to contemplate should Bury St Edmunds lose this wonderful cinema. The Abbeygate Cinema must be allowed to continue to entertain and delight fans of good cinema and delicious food.
Journey182769 . 2020-10-11
MORE AT TripAdvisor
Really love this restaurant now been many times staff nice and friendly with superb meals not what you’d expect from a cinema, looking forward to next visit with current deals. PS. Cinema great experience as well
Justgettinstarted1 . 2020-10-11
MORE AT TripAdvisor
We had a meal after we’d been to the cinema. The waiting staff are superb and service is prompt. Our meals were both delicious, chicken curry and a club sandwich, and substantial in size. Doing our bit to ensure the cinema survives this current crisis.
Patsipeapod . 2020-10-10
MORE AT TripAdvisor
This is the first time we have been out to eat indoors during Covid19.We were shown to an upstairs table, lovely atmosphere, great food, good service what more could you ask for.We need to support all local businesses if we want to keep them during this stressful time. We can’t recommend it highly enough and will be going back as soon as we can.
marynicholson1 . 2020-10-10
MORE AT TripAdvisor
Great place to eat, really loved the cuban rolls and spicy fries. Something for everyone on this menu. Would definitely recommend.
Pete H . 2020-10-10
MORE AT TripAdvisor
Similary restaurants in East of England
200 Opinions
What a little gem of a place.Table of 4 booked for their friday set lunch.Very good choices and are they were able to cater for my dietary requirements. Top that with a very friendly greeting and ple
ricegarliccabbagemuststeakcakesandwichpaysnackcreamchicken317 Opinions
Well a long awaited return to a fabulous pub restaurant. Lock down had kept us away but tonight we had the pleasure of eating here once again. Such are the staff(Bethany) they rang us whilst we were h
ricegarliccabbagemuststeakcakesandwichpaysnackcreamchicken59 Opinions
We had booked the dining area for a lunch time event to celebrate the life of a close family member who had died. Tina and her husband were so caring and helpful and laid on exactly the food we wanted
ricegarliccabbagemuststeakcakesandwichpaysnackcreamchicken