GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.2

Based on 1.184 opinions finded in 2 websites

site_photo4

Nº 165 in 338 in St Edmundsbury

Nº 43 of 79 Other cuisines in St Edmundsbury

CUSTOMERS TALK ABOUT DISHES WITH..onionsaffronbaconfishmeatsandwichchickencakeladyroastsaladtacosoldcookedbeautifulsteaktapascheesecoffeecream

comment_iconOpinions

Staff are nice. I would say the room hadn’t been hoovered. Laying in bed on the Friday we could hear the bass from the speakers downstairs which was annoying and disappointing.

site_logo

Paul Jones . 2025-05-12

MORE AT Google

Nice place to stay in Haverhill... The Hotel have only 6 rooms but all nice and quite. Breakfast and dinner are deliciuos and the Staff is really kind and lovely.

site_logo

Giovanni Marchini . 2025-04-22

MORE AT Google

Lovely Mothers day Roast dinner platter. Great food, great cocktails and really great service from Jaz, really attentive and friendly Thank you Jaz!

site_logo

LauraOgs . 2025-03-30

MORE AT TripAdvisor

Lovely Mother's Day lunch had with my mum and sister. Jaz our waitress was lovely, very helpful and funny throughout xxx

site_logo

Charlotte H . 2025-03-30

MORE AT TripAdvisor

Jasmine was amazing She is very nice very quick and extremely nice Made sure we were all happy And made us all feel right at home She deserves a pay rise

site_logo

Robert S . 2025-03-30

MORE AT TripAdvisor

Great food and service (Jaz is an amazing waitress) always love eating out here! The roast platters are amazing on a sunday!

site_logo

Jessica W . 2025-03-30

MORE AT TripAdvisor

Fantastic meal and fabulous service from jasmine! We will be back again soon and hopefully jasmine is our server again.

site_logo

Aimee L . 2025-03-30

MORE AT TripAdvisor

This booking was made via 3rd party, it allowed me book the hotel after 10pm and when I arrived to the hotel just after midnight, I found out that there was no access and no reception after 10pm. When I checked out, I also had a text to say I'll get a text on how to retrieve my key after hours, which I did not receive. I also got given an out of hours telephone number, to which nobody answered. Why would you allow bookings for a hotel after a certain time, if you know they're closed? Fast forward a week, customer services not helpful, so I started a charge back with my bank. The charge back was unsuccessful because they claimed that the opening hours were clearly written (they werent) and my bank agreed. So my question is, why do you allow bookings if the hotel is closed? I'm £63 down and never will I use this site again.

site_logo

Aaron Hodgson . 2025-02-19

MORE AT Google

The ambience and staff are warm and welcoming. They are very professional. Last night they arranged a girls only, post-Valentine party. The atmosphere was fantastic, the music great and not overwhelmingly loud and everyone who we met were friendly. Well done to James and his staff, you do Haverhill proud.

site_logo

Margaret Marks . 2025-02-16

MORE AT Google

Very good service, Helen was great!

site_logo

Samuel . 2025-02-15

MORE AT Google

Best Sunday Roast in a long time

site_logo

Karen Farrant . 2025-02-10

MORE AT Google

Amazing food, friendly staff. I would 100% recommend !! Definitely worth a visit

site_logo

Zoe Grigg-Pettitt . 2025-01-28

MORE AT Google

Stunning hotel, with amazing staff. Take time to get you anything you need. Rooms were great and had no issues. Would recommend to anyone ☺️

site_logo

Saffy Brown . 2025-01-28

MORE AT Google

The staff are so friendly & welcoming, the decor aesthetically pleasing & the food is fantastic! Will definitely be returning ⭐️

site_logo

Paula Bainbridge . 2025-01-28

MORE AT Google

Incredible hotel and restaurant and I’ll 100% be returning again. I have stayed and ate multiple times here and the staff are always amazing and couldn’t be more attentive! The rooms were super clean and I loved the decor and attention to detail. Also the food is fantastic!!

site_logo

Amani Bainbridge . 2025-01-28

MORE AT Google

Amazing stay at the Suffolk hotel! The rooms are lovely, very spacious and decorated beautifully! The food and cocktails down stairs are also great.. especially the nachos!!

site_logo

Rebecca Pilley . 2025-01-26

MORE AT Google

A fabulous 30th birthday hosted by the Suffolk hotel. Staff were so welcoming helpful and accommodating. Couldn’t fault the service. Special shout out to Sophie who ensured the evening ran so smoothly. We had lots of family visit from a far so we also made use of the hotel rooms- which are beautifully modern and clean from the feedback (reports were that breakfast was dreamy too!) Massive thank you to the Suffolk hotel team

site_logo

Ellice Hardy . 2025-01-21

MORE AT Google

Superb.. although if I say how good it is, everyone will book it and I won't be able to! Coffee machine was a very welcome addition to the room... loved it, going back again

site_logo

Andy Watkins . 2025-01-15

MORE AT Google

Stayed in a "king suite". Really poorly 'cleaned'. Pubes around the tap in bath. Chunks of paint in bath from goodness knows where Bathroom floor grimy. Mini spiders everywhere! Shower curtain long past retirement. Window broken and doesn't close. Floor needed vacuuming. Dust on everything. No sugar provided, only sweeteners. Tiny pointless cups. Only a 5 ft bed, expecting a 6 ft. Toilet seat wonky. Bathroom door won't close. Stains on sofa. Chose a bacon sandwich for breakfast, cremated inedible crackling in cold bread. Good location. Seemed nicer downstairs but private party meant no access. Massively overpriced. Unhygienic and disappointing. Avoid!

site_logo

Emma De Berry . 2025-01-01

MORE AT Google

Spent new years eve here with my partner . Staff seemed friendly enough . Everybody seemed busy. Pointed in directions of room , no explanation of how to get in or out after closing time . The room was big but hadn't been cleaned in ages , dust on cups , glasses , cobwebs on towels , shower, curtains impossible to close , broken window which couldn't be closed . Breakfast the following morning wasn't good, ordered 2 bacon butties , the bacon was cremated, rock hard and burnt to cinders . Overall not a good hotel to stay in for the price .

site_logo

John McGovern . 2025-01-01

MORE AT Google

Nice eatery. Well cooked food. Didn't experience hotel accommodation

site_logo

Wendy Bright . 2024-12-31

MORE AT Google

Busy Xmas drinks... Good drink selection.

site_logo

Simon Young . 2024-12-18

MORE AT Google

Decent little pub. Staff were very friendly. We visited the day of the Xmas lights and they was heavily understaffed for a couple of hours which meant delays for food and drink. No fault of the staff on shift but the pub should have planned ahead better knowing it will be a busy shift. Nice food and atmosphere

site_logo

Levelup . 2024-12-02

MORE AT Google

Was meant to post this a couple weeks ago but had an amazing experience here for our groups christmas drinks (24/11/2024). Big shout out to our server Helen who was just fabulous and elevated our time here beautifully (and somehow put up with our very loud and drunk group). Drinks were lush and we definitely got our moneys worth! Would highly recommend and will definitely be back soon!! :)

site_logo

Julia T . 2024-12-02

MORE AT Google

the best place EVER!!!! they accept our fur babies, the food is excellent the staff are absolutely 💯 amazing, always happy to help comfortable environment to be in, I totally recommend you taking a visit, they serve the best cappuccino I have ever had, I'm there almost every day, it's a wonderful relaxing place especially when you have a dog as most off us do these days, she is greated the same as I am, WELL DONE 👏

site_logo

Rachael Beckitt . 2024-10-29

MORE AT Google

In the centre of Haverhill, fantastic service and friendly staff members. The HIVE cafe, they have open in the morning must be the best place in Haverhill to grab a coffee 😊. Wonderful atmosphere, and also great place to eat out or enjoy a cocktail or a few in the evenings.

site_logo

Ryan Price . 2024-09-22

MORE AT Google

Wow what a lovely hotel amazing staff so helpful. Food wow yummy breakfast included in our room rate. Massive room and on suite at an amazing price. If you are Haverhill or surrounding area this is the place to stay with a car park to the rear thats only 2.80 for 24 hours. Room where so clean and tidy just fantastic thank team The Suffolk Hotel.

site_logo

Malcolm Lay . 2024-09-02

MORE AT Google

Had a lovely coffee and lunch here served by a lovely, helpful waitress. Disability friendly and clean environment.

site_logo

Tommy . 2024-08-20

MORE AT Google

Not very fast service rather expensive

site_logo

Peter Mitson . 2024-08-18

MORE AT Google

New-ish to the area and thought to have an anniversary meal here. Absolutely loved the vibe , decor, music, food and the service. The waitresses were amazing all very friendly, attentive and respectful. Lauren who served us was welcoming and was very right on suggesting the glazed Salmon dish. It was delish! Very fresh, tasty and generous food served. My partner had the Dragon Chicken and that too was lovely and well seasoned. We was very touched on the complimentary drink for our anniversary, that was unexpected and considerate. Thank you all for a wonderful evening :) we look forward to coming back to try out the rest of the menu!

site_logo

M D . 2024-08-17

MORE AT Google

Just had a lovely evening here. We have only had drinks here before. We went for our anniversary and were greeted warmly at the door. The bar area is beautifully lit with great music playing in the background. We were served by a lovely waitress called Lauren, who was very friendly and attentive. The food was amazing! Highly recommend the scotch egg starter and dragon chicken, it was delicious. My partner had the glazed salmon, which was equally as nice. The portions were generous and very reasonably priced. We really had a lovely evening and planning to go back and try more dishes :) Highly recommend.

site_logo

emmyd81 . 2024-08-16

MORE AT TripAdvisor

I come in with my family for my granddaughter birthday and treated them to some milkshakes. The waitress who served us didn’t make us feel welcomed and it didn’t seem like she wanted to be there meaning this didn’t make the experience pleasant. They enjoyed the milkshakes however didn’t enjoy the service.

site_logo

Jackie S . 2024-07-25

MORE AT TripAdvisor

I think it was the Hive which is the cafe part, it took 25mins for a chicken bagel and chips to come out, and the man who brought it to me was rather sweaty and had really yellow fingernails. It wasn’t the best experience i have had.

site_logo

gemma s . 2024-07-14

MORE AT TripAdvisor

Dreadful. Could not believe the burnt mess of a bacon and brie panini when it arrived 50 minutes after ordering. Partners meal faired slightly better. Friendly staff tho and fairly decent surroundings. Should try harder to improve food. Lager flat as well. Very sad as doesn’t seem much about in that area.

site_logo

Nina . 2024-06-08

MORE AT TripAdvisor

We had an absolutely amazing experience at a recent 'Bottomless Brunch' ....the food was lovely and the quality of the prosecco and cocktails were really amazing! Staff were really attentive (special mention for Jasmine, who couldn't do enough for us)! Would highly recommend ⭐️⭐️⭐️⭐️⭐️

site_logo

Vicky W . 2024-06-01

MORE AT TripAdvisor

We had an absolutely amazing experience at a recent 'Bottomless Brunch' ....the food was lovely and the quality of the prosecco and cocktails were really amazing! Staff were really attentive (special mention for Jasmine, who couldn't do enough for us)! Would highly recommend ⭐️⭐️⭐️⭐️⭐️

site_logo

Vicky Wilkinson . 2024-06-01

MORE AT Google

Had a wonderful lunch from the new brunch and lunch menu! The staff member who helped us was lovely and let us know about everything on the menu. Would 100% recommend and can’t wait to come back again for dinner and cocktails!

site_logo

Harley Britcher . 2024-06-01

MORE AT Google

Beautiful place for a social meet and greet with friends and family.

site_logo

Cousher Douglas . 2024-05-14

MORE AT Google

Come by from time to time always a good atmosphere Halle is always nice, polite and helpful and the food is great

site_logo

R . 2024-04-24

MORE AT Google

Sophie served us and she was lovely!!

site_logo

Lia Phillips . 2024-04-24

MORE AT Google

Had some lovely cocktails on Friday night, maybe a few too many. Sophie looked after our table and did a fabulous job of making sure we were topped up. Really friendly, and service with a smile.

site_logo

H C . 2024-04-24

MORE AT Google

Great place to go for a few drinks with friends, Sophie is a great and friendly member of staff. Couldn’t have done enough for us!

site_logo

Rox Whit . 2024-04-24

MORE AT Google

Had a great time in Nine Jars on Friday evening, Sophie was so friendly and helpful with choosing cocktails and was just a general delight. I then went back for lunch on Saturday, (for an absolutely delicious - very highly recommended the chicken Caesar salad) birthday lunch and Dan came and wished me very happy birthday, and gave me a complimentary cocktail to celebrate - such a lovely touch! Overall a great experience and service :) thanks for a great weekend, Nine Jars!

site_logo

Catherine Arnold . 2024-04-21

MORE AT Google

Lovely weekend, staff were all friendly, went out of their way to help you, We will be returning

site_logo

Debbie Davies . 2024-04-19

MORE AT Google

Really wish they'd open later for drinks but really nice place. The decoration is amazing!

site_logo

Aline Seigneur . 2024-04-16

MORE AT Google

I go to nine jars once a month for the veteran breakfast . The breakfast is really good for £11 and we all get free tea and coffee. Thanks to the owner/ staff .

site_logo

clive sweeting . 2024-04-10

MORE AT Google

Best fish and chips, very friendly staff

site_logo

Norma Miller . 2024-03-08

MORE AT Google

Very great experience halle has been phenomenal on every visit I've had

site_logo

Micah Brown . 2024-02-29

MORE AT Google

Went here for lunch last week. Not the best food I've had, toasted sandwich was hard and sausages not very warm so took them out, ordered chips but didn't get many, the lunch was quite expensive too. The place is very nice, won't eat here again but will go in for a cocktail maybe. Staff nice and friendly.

site_logo

Amanda Brown . 2024-02-26

MORE AT Google

I Come into Ninejars occasionally with my partner. And always get served with a smile by “Halle”. She’s very friendly and with a smile on her face. Nothing is ever too much trouble.

site_logo

james carter . 2024-02-07

MORE AT Google

Came in here for lunch, had a pulled pork cabano sandwich, the pork was just a lump of sogginess, the fries were awful just tasted of oil for £4 a portion is ridiculous and the tortilla chips that were served with our meals were stale and had no flavour. The service was good though disappointing unfortunately overpriced for what it is.

site_logo

Khiran Sparks . 2024-02-03

MORE AT Google

Absolutely annoyed that we had a group of 10 who travelled far to go to nine jars . The bar shuts at 11:30 but staff tried shutting at 10 so they can go home even though we already spent over £300 and we got served out last orders to which we could not even drink due to rude door man asking us to leave straight after buying last orders ! Not impressed!

site_logo

Hanan Mashhood . 2024-02-03

MORE AT Google

Lovely to have the tapas menu back which we enjoyed. We were really looking forward to a dessert but unfortunately when we tried to order we were told that the kitchen had closed, which we didn't expect before 9 on a Friday. Maybe next time.

site_logo

suffolkbluebell10 . 2023-10-25

MORE AT TripAdvisor

Lovely warm atmosphere as soon as you walk in. Food is incredible, especially the limoncello tiramisu ( please never take it off the menu) the staff are friendly and welcoming and love that we can bring our dog if we want to. Can't wait to return to try more!

site_logo

Stephanie W . 2023-10-24

MORE AT TripAdvisor

come down tonight for the bottomless deal and the food was amazing! it come out lovely and hot and there was plenty between us all! cocktails was none stop flowing and we had a lovely girl( abby) who was polite, cheerful and a friendly smile who was serving us tonight there was also another young lady,brunette, who did very well making sure our table was cleared and giving us the food. would come again!!

site_logo

liv w . 2023-10-20

MORE AT TripAdvisor

I travel to Suffolk for my tattoos from Staffordshire and ended up having to stay overnight . Can’t say about the rooms as I stayed in a local b&b as was much cheaper however I came here for food and drink during the evening as I saw it on my last appointment and my artist said it was a nice place to go. The cocktails are lovely and 2 for 1 all day , I ordered nachos and Mac and cheese food was lovely nice relaxed atmosphere great music and the girl who served me sorry I don’t know your name she has dark brunette blackish hair and was working 17/10 between 19:00-20:00 at night - was absolutely lovely, very friendly service with a smile 10/10 Thankyou for making me feel welcome in your little town

site_logo

Carley Marie . 2023-10-17

MORE AT Google

Post holiday meal, pizza topping too thick and clumpy, rocket salad on small plates and pizza was limp and did not deserve to be put out for human consumption. This was mentioned to the waitress who didn’t really seem to have an opinion.

site_logo

John Field . 2023-10-16

MORE AT Google

We were staying in the hotel and had a voucher for an evening meal as well. The music was a bit too loud and it was very dark, we could only just about read the menu. Our starters were delicious, I had breaded prawns and my wife had calamari. The first two things my wife chose as a main were unavailable so we both ended up with the burger. At £17.95 we thought they would be something special, unfortunately they were not. There was no flavour to them at all, it just tasted of mince! Mine was just about cooked but the one my wife had was virtually raw and she left most of it. I'm not sure if the hotel or 9 jars who do the breakfast but it was awful. Waited about 40 minutes for it to come out. It was pretty horrible, the sausages had a very strange taste and were pretty shriveled up and the hash browns were not cooked properly, they were nearly still frozen in the middle.

site_logo

Alan P . 2023-10-16

MORE AT TripAdvisor

Great service, nice friendly staff, good atmosphere

site_logo

Marias Channel . 2023-10-14

MORE AT Google

Great atmosphere and lovely memories 🥰

site_logo

Anna O . 2023-09-29

MORE AT Google

Friends 40th birthday brunch. Food took ages. Breakfast 20 beans on plate and frozen hash brown. Nachos cold and stuck in a lump. Macaroni lumped together. Asked for manager. Offered us free bottle of fizz which we paid for day before. Not a place for friends and no special service. Memorable for all the wrong reasons. Weatherspoons beats this.

site_logo

Claire Stagg . 2023-09-01

MORE AT Google

Not good that they do not take cash. If I had known I would have given it a miss. Only had one drink.

site_logo

Peter Chapman . 2023-07-21

MORE AT Google

So, we were on our way to Gatwick on the M11 and I saw Haverhill on a signpost and thought "we're hungry, and I've always wanted to go to Nine Jars." A friend's son works there and she's forever banging on about what a good employer they are, and I figured that's a rare thing these days, and have long promised to show them a bit of custom. It's clean, it feels trendy, but not *too* trendy for someone in the grip of mid-life like myself. The food is just amazing, and there's a fine array of beers too. Whilst away on holiday we ticked off another restaurant off the bucket list, the famous Dinosaur BBQ in NYC. It's no word of a lie to say Nine Jars was better. Just go, you won't regret it.

site_logo

andyfov . 2023-07-14

MORE AT TripAdvisor

I have started going here as the burgers are the best in the area. Just to make life more difficult they've taken away table numbers and stopped mobile ordering. It comes as a great shame they have stopped offering deserts which is a great shame. Service wasn't as good either, you can't order at a small bar at the start of the seating Area going in. You now have to go to the main bar. So you can't see where you are sitting. I will be going back, but a couple of changes has made it more difficult especially for disabled people. This makes it more difficult to tell them where you are seating and staff finding you.

site_logo

jdtayloruk . 2023-07-11

MORE AT TripAdvisor

A good Vegan Menu & really friendly welcome - nothing seemed to much of a problem & food was really good. Only downside is Card Only payments - just a shame they’ve done that 😢

site_logo

Darhigh . 2023-06-08

MORE AT TripAdvisor

I was visiting my mum on an overnight stay near to Haverhill, Suffolk. I had know where to stay, so I searched for a hotel, this one came up. The hotel is very well situated in Haverhill, just off the high street, queen street, parking is available at the rear for a reasonable price, 24hrs. Entrance to the hotel after hours is via the rear, which was lit at night. The room I stayed in was room 10 st Mary’s suite, This is a very spacious room, kitchen, toilet/shower, double bedroom and a spacious living quarters. The hotel was very clean. Perfectly situated to the centre of town. However, the morning after I had missed the seating town for breakfast. James was in charge in the morning, he made me my breakfast, full English breakfast with all the trimmings. This was greatly appreciated, he was very professional, very polite and generous, he didn’t need to do what he did, therefore he went above all expectations, great bloke, thank you Nick

site_logo

3022NickH . 2023-04-26

MORE AT TripAdvisor

Poor service, poor food with profit before product unfortunately. Incorrect orders and not for the first time. Unfortunately there is no completion in Haverhill at all during lunchtimes.

site_logo

Sunshine04506749032 . 2023-04-18

MORE AT TripAdvisor

Nice and friendly place to visit if your in the area. 2 for 1 cocktails are a lil confusing considering they give you 2 of the same .. would of been nice to be offered them separately instead of having 2 at a time as my partners second drink melted before she got around to drinking it so it went to waste.

site_logo

Adam Rowles . 2023-03-19

MORE AT Google

I went here for a meal in January there was only 2 of us and 3 other tables in the restaurant. I ordered my first option ( duck noodles) the waitress came back and said that was unavailable. Ordered my 2nd option (fish & chips) the waitress came back and said that was unavailable too !! We should’ve been made aware of what was available when we first sat down. Once we had finished our first course, they took our plates away and didn’t ask if we wanted more drinks or to look at dessert menu. We was sat for ages before anyone come over to us. Poor food options and slow service.

site_logo

sophiahdavies . 2023-02-28

MORE AT TripAdvisor

Nine Jars has a nice atmosphere. Cocktails are expensive for what they are.

site_logo

Jamie Stuart . 2023-02-11

MORE AT Google

It was OK took a while for the waiter / server to see us. Although we stood right in front of counter. The girl staff where quicker to act and we got a cuppa. Nice spacious rooms able to talk. Never been here before but would give it another go

site_logo

Jojo . 2023-02-10

MORE AT Google

First week they opened I tried to visit and grab a drink with some friends, for absolutely no reason I wasn’t allowed in, but my older friend was instantly. When I tried again to visit my friend inside I was confronted by the owner who accused me of being drunk in front of multiple customers. If they don’t want to accept my money then I simply won’t give them any. I assume the place is suffering from an identity crisis, trying to appeal to an upper class customer in a town that doesn’t have that clientele. Also heard some shocking tales of how some staff are treated. Would avoid at all costs. According to the owners response I am apparently banned since 2016, after the way I was treated by the owner, I am very proud of that knowledge.

site_logo

Sebastian Hammond . 2023-02-03

MORE AT Google

My partner took me here on Sunday. The brunch menu had a great choice. I could have chosen a few things. I had a full English Breakfast. It was absolutely delicious. They offer alternative milks. I had an almond latte. It was amazing. The staff were really polite and friendly. The decor and atmosphere is lovely inside. The prices are fair and we’ll definitely be back.

site_logo

princessemilyejt . 2023-01-26

MORE AT TripAdvisor

Starters ok. Main courses a disaster ! Out of 3, 1 was the wrong order, 1 Ribeye steak was so overcooked and dry it was inedible, served with mushrooms so dry i couple eat them .1 was ribs so tough my daughter took them home to cook some more and add sauce! Manager comped 1 meal but it was so disappointing for a special meal! VERY dissatisfied

site_logo

chrissieb2018 . 2023-01-21

MORE AT TripAdvisor

Well very nice service. Nice lunch. Ordered coffee's which were dearer than on menu. £4 instead of £2.50. Told it was a misprint. Would NOT HONOUR MENU. Last time in Nine Jars. Customer Service yuck. Not blaming staff.

site_logo

David Kennedy . 2023-01-18

MORE AT Google

If you’re in or near Haverhill, UK stop in at Nine Jars for brunch. They offer a 2/1 deal until 11 am and the food is absolutely terrific. My wife (a vegan) enjoyed the Garden Brunch complete with pico de gallo, avocado, roasted red peppers, spinach and a vegan protein. Completely beautiful to look at and very delicious. I gulped down the NJ brunch full of sausage, bacon, fried eggs, baked beans, tomatoes, and toast. Everything was so good I had a difficult time deciding which of the foods I wanted as my last bite. Great food, atmosphere, and very reasonable

site_logo

PPeters60 . 2022-12-27

MORE AT TripAdvisor

Tackiest place I’ve ever been to, the frozen calamari rings will break your jaw, and the manager is really unprofessional when you make a complaint.

site_logo

Tabitha Rowe . 2022-12-07

MORE AT Google

Best roast dinner we have ever had in a restaurant! Amazing. The minted veg, the pickles cabbage, the tender meat - it was to die for. The staff were lovely and the drinks great . Dog friendly as well so it was lovely to bring our dog in with us. High chairs for babies too. We will be back!

site_logo

Stay47175375991 . 2022-11-28

MORE AT TripAdvisor

Unfortunately this place only allows children until 6PM, so you can’t go for family dinner as you need to leave soon…

site_logo

DimaTania . 2022-11-26

MORE AT TripAdvisor

Lovely spacious suite! Tasty food and options for variety’s! Breakfast had variety’s as well! Had the tastiest Mac and cheese ever! Well seasoned and cooked steak! Good customer service! Ever need to lodge in Suffolk/Cambridge…. Nine Jars is the place!

site_logo

345adenikea . 2022-11-26

MORE AT TripAdvisor

The set up of this place has changed. A brightly lit front seating area and a looser lit issue. It did take a little while to order. I think they were low on staff. Usually they do a tapas menu but it looks to me...

site_logo

jdtayloruk . 2022-11-21

MORE AT TripAdvisor

Lovely place for a good meal! Was first served by a very friendly server named Megan who catered to every need with a big smile. Drinks came almost instantly and food came just as quick lovely and hot and cooked perfectly. Our server Megan said the chefs name was Jamie! Will most definitely be returning& hoping for the same amazing service. Thank you Nine Jars!

site_logo

Grace Alsop . 2022-11-17

MORE AT Google

Nice lunch great place for catchup, wasn’t to busy for a friday lunchtime Served quickly food hor Thank you

site_logo

180cathrync . 2022-11-16

MORE AT TripAdvisor

Place is nice but using a Taste Card just realised I have been grossly overcharged for the past 4 visits. Not fair to me as a customer and feels shoddy. Nothing wrong with the food and drink and just a shame as this has tainted the experience.

site_logo

Adrian Case . 2022-10-31

MORE AT Google

We recently hired Nine Jars to host a 40th birthday party, and had such a great night! The staff were amazing - nothing was too much trouble, the hot buffet was delicious and the cocktails superb. To top it all off we stayed in one...

site_logo

H3054EFnicolae . 2022-10-31

MORE AT TripAdvisor

We came to Nine Jars to celebrate my husband’s birthday. It happened to be burger night so we took advantage of the offer of 2 for 1 and we wasn’t disappointed. We chose the dirty burgers and they were quite simply the best burgers I’ve...

site_logo

296tamij . 2022-10-27

MORE AT TripAdvisor

Lovely hot chocolate with honeycomb & marshmallows + some subtle music playing in the background for my wife & I. Very relaxing…..

site_logo

Lee H . 2022-10-26

MORE AT TripAdvisor

Had a really fantastic meal at nine jars my steak was cooked to perfection so a special mention to Jamie .staff were very helpful to and nothing was to much trouble .looking forward to the next visit

site_logo

janet f . 2022-10-23

MORE AT TripAdvisor

This whole evening was amazing. Food was fantastic, service was phenomenal, and the atmosphere was so comforting to be in. Staff was so friendly, I would highly recommend coming here. I’ve been here before a few times and every time was exceptional. Amazing place, 100%...

site_logo

621charleyg . 2022-10-20

MORE AT TripAdvisor

Food was good albeit the steak wasn't as warm as I like, but well cooked, beer was a bit pricey though

site_logo

phil coles . 2022-10-01

MORE AT Google

After enduring some rather questionable Hotels, it was a pleasure to open the door to a fantastic room. Large, clean and well presented, with a comfortable bed and a generous walk in shower. The coffee machine was also a welcome surprise! The evening meal was...

site_logo

philmU3986LE . 2022-09-27

MORE AT TripAdvisor

My first visit to nine jars...... and my last, i was welcome by a lovely smile from a beautiful waitress..... my experience went down from there sadly, i was served a tea which was in a dirty pot and not really very hot, my milk jug was chipped right on the pouring bit which worried me incase the chipped bit was in my tea.., no spoons given just a wooden stirrer for my tea which i felt was more fitting to a motorway cafe, and before any one says "it cos of covid" I think wooden stirrers left on a table alday for anyone to touch is more of a risk but that's just my opinion, i ordered a NJ brunch and so did my partner, the toast wasnt toasted and my sausage was pink and under cooked but by then i had eaten half of it.. cant wait for the long toilet visit later today, the eggs very undercooked... but we ploughed on as we felt maybe the breakfast would get better..... the bacon was hard and over cooked and there was so much of what i can only decribe as "tiny hard bits with no flavour like a cheap bitty pepper" all over it so it almost crunched on every bite... but still everywhere cooks things differently so i pushed aside the undercooked bits and settled on the pale toast. I also noticed the servers didnt tie their hair back? I've earned and very decent living for many many years being a waitress but in all of my restaurants strick hand washing and hair being tied up was mandatory but again different places do things differently but i think the bit that got me most is when a passing visiting dog came in and the servers were petting it and cuddling it not one of them washed their hands when going back to service... I mean a dog shouldn't have even been in a restaurant let alone servers stopping mid service to pet it right?.. so in all not a great experience for the expense of 2 small breakfasts and 2 drinks then they only took card not cash which seemed alittle pre covid when we are very much post covid ain't we??? Not the best experience but not the worst on my quest to find the perfect breakfast. Il wait paitently for my scathing response but i do have pictures of my undercooked food and other complaints should the owner want to see them 😊

site_logo

Lorna Maria . 2022-09-25

MORE AT Google

Lovely little hotel with modernised rooms in the heart of Haverhill. Park next store in the Swan Car Park £2.80 per day. Restaurant and bar were great , small but good wine list and some nice beers and cocktails from the bar. Comfortable stay and...

site_logo

John Y . 2022-09-25

MORE AT TripAdvisor

Lots of tables food was served quickly but did not all come as per Menu had to ask for bread and oil. Weekend young person pub with doorman on . Music load at weekend.

site_logo

Michael Peirson . 2022-09-25

MORE AT Google

As this is my first visit and what I've heard I was expecting something nice, how wrong was I, I had a wooden stirrer for my coffee. Then my breakfast came, it looked very nice, till I tried it, it wasn't hot, the eggs was a little snotty, then a dog came in, and the servers was all cuddling it, when it left they carried on serving, without any washing of there hands, so dog hair on their cloths and hands, and in the breakfast of the man after the dog left. And the hair of the server's was long and not tied up.

site_logo

Antony Proudfoot . 2022-09-25

MORE AT Google

I have been a couple of times as I thought I couldn’t have a bad experience that often. But the amount of time it takes to get a drink is incredible. Last time myself and my wife left as it took so long. I’ve also...

site_logo

ollieb31288 . 2022-09-13

MORE AT TripAdvisor

Came in today for the new Sunday roast menu at Nine Jars. Easily could say one of the best roasts we have had out. The food was delicious and flavourful, well presented and generously plated. Couldn’t recommend highly enough for anyone looking for somewhere to...

site_logo

B9887YZdjc . 2022-09-11

MORE AT TripAdvisor

Such a Lovely ‘vibe’ coupled with great food and great service. We love our brunch’s at nine jars. The NJ brunch is awesome and fantastic value too given their 2 for 1 offer before 11.

site_logo

Simon G . 2022-09-10

MORE AT TripAdvisor

Good pub for you to visit pleasant staff and a good menu to choose from.

site_logo

Ale Johnson . 2022-09-04

MORE AT Google

Just wanted to say how perfect our private party was. Although the event was a sad occasion for our family, the items we bought to decorate and personalise was space was laid out beautifully. We spoke with Lauren and James in the weeks leading up...

site_logo

victoriamA770ZZ . 2022-08-25

MORE AT TripAdvisor

Similary restaurants in East of England

restaurant_img
4.2

1495 Opinions

location-icon14 Whiting St.
Other cuisines
outdoor_seating_87764takeaway_87764delivery_87764

Lovely staff, great food (skinny chips are a staple!), come regularly for the quiz, great atmosphere and night out. Great it's dog friendly too. Highly recommend

restaurant_img
4.2

372 Opinions

location-iconThe Street
Other cuisines
outdoor_seating_191693takeaway_191693delivery_191693

Whitebait. Rump steak cooked exactly the way I wanted it. Brownie and cream. Good value No messing, great service, bottle of shiraz and a superb pint of stout. What's not to like?

restaurant_img
4.2

1823 Opinions

location-icon39 Bury Road
Other cuisines
outdoor_seating_211787takeaway_211787delivery_211787

Extremely disappointing lunch today. It was our anniversary and a real treat to eat outside. Very little choice for vegetarians - only one main course option which included asparagus and broad beans - both vegetables that I don’t like. I opted for the celeriac instead even though it was really a starter. When my husband went to order he was told that we had to have all three courses served at the same time because we were eating outside. We had our dog with us so indoors was not an option. When my husband pointed out that the ice cream on the pudding would melt before we could eat it, the server agreed to hold the Treacle Tart with ice cream until we’d finished our main courses. Foccacia with sundried tomato butter was dried out and tasteless. I didn’t eat it. The waiter didn’t ask if everything was OK, just “have you finished?” I told him about the bread. He just said “Oh, dry?” And walked away. When the small portion of treacle tart was served, it had been microwaved so that it was too hot to eat, burning my tongue, and the ice cream had half melted. Who wants hot treacle tart in 24 degrees. If it was treacle pudding fair enough. I’ve seen your response to the last negative review, so just to confirm that we paid when we ordered and we weren’t offered a refund on the focaccia. Although we’re local we won’t be returning, which is a shame because it’s so close and a beautiful setting.

restaurant_img
4.2

2022 Opinions

location-icon25 Angel Hill
Other cuisines
outdoor_seating_143046takeaway_143046delivery_143046

I visited last night with my friend and wow! The service was outstanding. What an amazing waiter….So friendly, professional and helpful. Food was so amazing. Atmosphere was so calm & relaxed. Beautiful inside. Highly recommended a visit! 11/10 from me ❤️

restaurant_img
4.2

599 Opinions

location-iconHengrave Road
Other cuisines
outdoor_seating_87752takeaway_87752delivery_87752

Went yesterday for something to eat, was great to find somewhere that food was available all day. I had open fish pie and Parma Violet pudding and my brother had the liver and bacon dish of which I tried😃 x. All excellent taste and service. I would highly recommend.