GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.6

Based on 271 opinions finded in 2 websites

site_photo4

Nº 2817 in 3395 in Cornwall, Isles of Scilly

Nº 36 of 41 Asian in Cornwall, Isles of Scilly

CUSTOMERS TALK ABOUT DISHES WITH..meatgoldenchickenfriedriceprawnladycookednoodles

comment_iconOpinions

Ok, well I don't like to give bad reviews but considering I spent £25 and had such a bad experience I think it's right to inform anyone thinking of getting a delivery from here.. So, I ordered mixed starters for one, crispy beef and chilli chips. Mixed starter, probably the only edible thing to arrive, although super oily and a lot of the stuff was dry, and not crispy... The sweet chilli beef was literally like sand inside... The sauce was nice but the beef was horrendous, like carbonated inside, didn't feel like eating meat.. More like charcoal... The chips.... Clearly fried from ages ago, or fried badly.. Soft cold wet outside, dry inside.. No real flavour.. Portion was massive, but sadly just more to go into the bin... Yeah, what else can I say, simply awful experience, for what was meant to be a massive nice meal ended up eating cereal for dinner..😅

site_logo

Alessandro Nunes . 2024-12-31

MORE AT Google

Home delivery.....BANGING....Arrived before we ordered it. Was really hot. And bloody tasty.....only complaint is the chips wasn't seasoned.

site_logo

jake shroff . 2024-12-21

MORE AT Google

Would not buy again... even my dog wouldn't eat it and he eats anything, I was stuck on the bog for 5 business days, not very happy at all

site_logo

Jay Doyle . 2024-12-21

MORE AT Google

Another dreadful review to add to the rest..... Literally the WORST experience of a takeaway and the most distressing home visit for my terrified children! Food was delivered cold, if you want honest reviews on this place just read all the dreadful reviews for yourself, the food was DISGUSTING... manager lady promised to drop me up a refund of £33, she came to my door and started screaming for me to let her in to see my bin, calling me a liar and shouting in front of all my neighbours, I have never known anything like it, I have it all on my CCTV, her promising me a refund, screaming and scaring my young children and calling me all sorts. All has been saved on cctv. She verbally promised me the refund, of £33 , then tried to defuct it down to £18 something, but she actually drove off without giving my refund and left me with nothing. I have this crazy lady screaming on my home surveillance system..... As everybody else says in the reviews, revolting food, revolting service, crazy psycho manager on my cctv. My young children were extremely distressed asking "Mummy is she going to break in?". The worst chinese food I have ever had and the worst customer service! How are these people still in business when EVERY review is bad, people are reporting food poisoning and constant vile food, they need to be shut down.

site_logo

Debbie D . 2024-12-17

MORE AT Google

As almost everyone else has said, food here is absolutely tasteless, just grease mixed with watered down chemicals, bulked up with nothimg other than cheap rotten onions, sauce like water and looks and tastes like vomit. It is clear from everyone's reviews also that anyone who doesn't like their food gets a dose of the extremely agressive, unprofessional owner woman who clearly needs to go to anger management and is an absolute psycho. She actually drove to my house screaming outside, demanding to be let in to see the contents of my bin when I tild her the food was binned 🤣🤣🤣 Read all the reviews, we can't all be wrong

site_logo

Debbie D . 2024-12-17

MORE AT TripAdvisor

Food dong matter what I order is always tasteless and always disappointed it's the only one open earlier than the others....can't go back again to be disappointed with my takeaway.

site_logo

Yasmin Y . 2024-10-18

MORE AT TripAdvisor

The best Chinese around, only recommend great restaurants always quick and can do a range of gluten free if asked.

site_logo

Steven peckham . 2024-08-22

MORE AT Google

Food was good a little on the greasey side

site_logo

Andre Carrington . 2024-07-31

MORE AT Google

Always welcoming and great food

site_logo

Anthony Kirk . 2024-06-30

MORE AT Google

A disappointing takeaway. Too many onions, 6 cashew nuts in the chicken + cashew nut dish. More onions than crispy chilli beef. Raw carrots + again, dishes padded out with onions.

site_logo

Stephen R . 2024-06-08

MORE AT TripAdvisor

My go-to for chinese takeaway. Delicious food, very friendly staff. No complaints whatsoever.

site_logo

Isaac Rule . 2024-04-10

MORE AT Google

Food fantastic. Always get my Chinese there now best I've tried

site_logo

Lesley Kistle . 2024-01-07

MORE AT Google

Visited Cornwall for Christmas, fancied a Chinese, found this place did not disappoint.

site_logo

Aimee Ross-Lee . 2024-01-06

MORE AT Google

We decided to use this place for the last time give it the benefit of the doubt as we had a £10 credit and we weren't surprised the food was absolutely gross again even left us on hold for nearly a minute listening to some kind of argument in Chinese don't waste your money guys you will be disappointed 20 12 23

site_logo

Malcolm Hall . 2023-12-20

MORE AT Google

Got takeaway from here last week and the food was delicious :) lots of choices on the menu too

site_logo

Ceire Martha . 2023-12-18

MORE AT Google

I had the chicken and shrimp Singapore fried rice. Flavour was nice but zero veg, which is unusual for this dish, quite disappointed with the quality

site_logo

Kelly McDonald . 2023-12-16

MORE AT Google

Great service fast delivery all food was delicious and hot I'd highly recommend.

site_logo

Paul Hamilton . 2023-12-10

MORE AT Google

Unusually poor takeaway this evening. The chips had just been reheated, presumably from the previous night, I know this cos I've reheated them myself, so I know what they look and taste like...definitely not fresh. The Singapore chowmein was insanely hot, I know its supposed to be a spicy dish, but today I could barely eat it and it was extremely oily. The black bean sauce was much stronger than usual, too. Overall not a good takeaway from here tonight. Sad, because its not cheap. 😥

site_logo

diane h . 2023-11-16

MORE AT TripAdvisor

Watch your food get cooked in front of you, online ordering, easy peasy

site_logo

Dan Trump . 2023-10-11

MORE AT Google

Consistent. Reasonably quick. Clean. Entertaining to see your food cooked. I miss the big fishbowl approach from Covid. Not the best but always very edible and tasty. Perfectly okay. I mean, seriously, it's fine. Have I had better? I don't think now is the time to talk about that, but yes. Do I always enjoy it? Now that is a better question, and yes, I find it quite acceptable.

site_logo

Mr Mann . 2023-10-07

MORE AT Google

Good food with a quick service.

site_logo

Ian Murphy . 2023-10-07

MORE AT Google

Had our first meal tonight from G.D. and have to say it was absolutely lovely. All the food was beautifully cooked, plenty of it and for under £40 for 3 main courses , a large rice and spicy noodles it was a bargain! Great delivery driver too, who despite not being able to find our house ( understandably!) took it all in good humour. Will definitely order again.

site_logo

Catherine Grummitt . 2023-09-09

MORE AT Google

Friendly lady at restaurant taking payment for order. Friendly delivery driver. Excellent takeaway.

site_logo

Joanna Hoskin . 2023-08-15

MORE AT Google

I've been using this Chinese for the past 8 years, and they've always been brilliant, but the last 2 orders of food we've had has been poor!! Chicken balls overcooked and rock hard, crispy chicken with salt chilli and pepper also rock hard to the point you could break a window with them, chicken fried rice overcooked and hard. It kills me to right this as in the past the food has been amazing but the last 2 orders have been disappointing so will be going somewhere else from now on. Shame really but I'm not waisting my money on poorly cooked food.

site_logo

Nick Jordan . 2023-08-10

MORE AT Google

Really good Chinese food. Get my order right every time. They even throw in fortune cookies and prawn crackers sometimes!

site_logo

Mr Hyde . 2023-08-01

MORE AT Google

All what's required from your local Chinese Takeaway

site_logo

Leon Roberts . 2023-07-28

MORE AT Google

Meat was to chewy and chips over cooked

site_logo

Kane Cumming . 2023-06-26

MORE AT Google

Always use Golden Dragon. Tonight’s Tofu with mixed vegetables and soft noodles absolutely delicious. Food ready on time and piping hot.

site_logo

Viv Mitchell . 2023-06-13

MORE AT Google

est Chinese delivery we have had for years. On time, hot, tasty, had left overs today still great food. Thanks

site_logo

Kevin . 2023-05-29

MORE AT TripAdvisor

Tried to put a complaint in but no option on the website so I called them to put a complaint in and they didnt listen to my complaint they just said "no no we are too busy"

site_logo

bethany m . 2023-04-04

MORE AT TripAdvisor

Absolutely perfect service food was amazing the staff polite place very clean and not long to wait for food

site_logo

Anne c . 2023-04-02

MORE AT TripAdvisor

Disappointed as its much more expensive than my usual Chinese which I wouldn't of minded but everything was extremely undercooked! Fried noodles weren't fried, chips only about done, and same for the foo young. Sad to say I won't be returning.

site_logo

Rachel Jose . 2023-03-26

MORE AT Google

Great takeaway . Fresh ingredients, hot and tasty

site_logo

Piran Perranporth “Murf” . 2023-02-02

MORE AT Google

We often order from the Golden Dragon as our local Cantonese take away and have always been satisfied with the food, 5 stars! We ordered our usual last night and this was the best take away we have ever had! Wow! The curry, chow mein and chicken wings were delicious! If I had to pick any negative I just wish they served Yuk Sung/lettuce wraps.

site_logo

Rach Howell . 2023-01-07

MORE AT Google

Unfortunately when it gets busy the food quality goes down.

site_logo

Nigel Melton . 2023-01-01

MORE AT Google

Absolutely fantastic, easy ordering online food was lush and cantonese crispy chicken is the best I’ve had anywhere,delivery was fast and the delivery girl and driver were very polite and will definitely be ordering again A*****

site_logo

annettemthomas . 2022-12-19

MORE AT TripAdvisor

excellent takeaway as always very busy tonight but still a great takeaway

site_logo

Beverly Wilson . 2022-11-26

MORE AT Google

your average Chinese takeaway but they're very happy to cater for gluten free! 🙂

site_logo

Casey Bourne . 2022-11-19

MORE AT Google

What a shame in the past I have had some nice dishes unfortunately tonight we ordered house special fried rice wellbit had that much soy sauce it was so salty you could not taste anything than soy will not be ordering this again banana fritter crispy nice we ended up having to make some sandwiches not good when you just spent over £30.

site_logo

Brioni Finnegan . 2022-11-09

MORE AT Google

Really good Chinese takeaway. Zero complaints at all. Food arrived piping hot and was absolutely delicious

site_logo

Tsuki Kesshō . 2022-09-16

MORE AT Google

Always consistently good food. Our go to chinese takeaway. It's also always a good sign if you can look into the kitchen of an establishment. We have never been disappointed and we go most weeks

site_logo

593tsukik . 2022-09-08

MORE AT TripAdvisor

Stumbled across this place after a long journey down to Cornwall. Quick and fast service but very poor food. Would not visit again or recommend.

site_logo

Andrew Taylor . 2022-08-28

MORE AT Google

Cool place good food. They went above and beyond. Would defo reccomend

site_logo

Paule Tekno . 2022-08-24

MORE AT Google

Absolutely brilliant food, used them a few times and they're so good. The food is faultless, really tasty and looks good too. I collected our meals and you can see it being prepared, from behind a screen. Staff all wearing masks and order is passed through a serving hatch, very impressed by attention to hygiene. Prepared promptly even though it was 9pm on a Saturday.

site_logo

L6003TXrichh . 2022-07-31

MORE AT TripAdvisor

Terrible food, mostly preheated rock hard chips tasteless chicken balls had family here on holiday £60 5 people waste of money

site_logo

Gacie . 2022-07-29

MORE AT TripAdvisor

Absolutely vile, awful food, chips were drier than the sahara desert, balls were dry and tasteless….

site_logo

584fins . 2022-07-13

MORE AT TripAdvisor

It's ok, the one in Threemilestone is the best but they dont deliver

site_logo

Ian Patterson . 2022-06-22

MORE AT Google

Amazing food. Really good quality and reasonable price. Open kitchen really clean and good to see.

site_logo

Mel Hewitt . 2022-06-03

MORE AT Google

Great food, Singapore chow mien, sweet and sour chicken Hong Kong, rice/chips, mmmmm.

site_logo

Jim Latham . 2022-04-30

MORE AT Google

Best Chinese in town!! Everyone needs to try the salt, pepper and chilli squid! Amazing!

site_logo

Jacq Beriadhwen . 2022-04-23

MORE AT Google

I like the fact that you can see your order being cooked. Very covid aware which is reasuring. Food is good too.

site_logo

joe taylor . 2022-04-10

MORE AT Google

Yummy food. Great after the theatre. Love the dragon balls.

site_logo

Afric Nickson . 2022-02-28

MORE AT Google

My friend was down visiting and we ordered from here as a treat. I don’t normally order from here as the price has previously put me off. Boy was I wrong, it is great value for money here, large portions and definitely worth it. Every part of the meal was delicious, cooked well and made quickly. Would recommend to anyone considering ordering from here

site_logo

torig543 . 2022-02-13

MORE AT TripAdvisor

Expensive and poor food. Visiting for work and thought we try a Chinese wish we hadn't. Starter combo was a joke for the money wonton where empty one rib not what I'd expected. Mains where tasteless and for me missing ingredients 1 prawn In the mixed meat curry. And no vegetables in the sweet and sour source. Chicken was not fresh frozen rubbish not fresh. Thank god this is not our local .

site_logo

Tim Jones . 2022-02-10

MORE AT Google

after swimming training most mondays i go here i get the sweet and sour balls wich is great egg fried rice and sometimes a chow mein wich i go for the king prawn one . the chicken in most things is rubbery but in the sweet and sour its not . never buy chicken curry the sauce is wattery . if you wantr chicken curry thats good go to jade house in perranporth.

site_logo

222jedl . 2021-12-29

MORE AT TripAdvisor

Had a takeaway from here on the 06/12 absolutely loved it very tasty very nice thought at long last we had found the nicest Chinese around. Sister and Brother-in-law down so ordered Chinese here last night totally different bland runny tough meat hardly worth it in fact the barbeque sauce had less taste than a cup of water.i would order again but it'll be returned if not improved on

site_logo

japw2021 . 2021-12-23

MORE AT TripAdvisor

Food still good, but prices have increased by over 50% in the last 18 months (large spring roll was £2.50 and is now £4.00). They are also still using mostly plastic and polystyrene packaging. Time to find a new Chinese Takeaway!

site_logo

Plymspear . 2021-11-02

MORE AT TripAdvisor

Still good food, but prices have increased more than 50% in the last 18 months (large spring roll was £2.50, now £4.00). SThey are also still using mostly plastic and polystyrene packaging. Time for us to find a new Chinese Takeaway.

site_logo

Teresa Spear . 2021-11-02

MORE AT Google

We order every other week and it always arrives super quick and is soo good. We are working our way through the menu and Love the food

site_logo

yoyoyoyo1 . 2021-10-22

MORE AT TripAdvisor

Nice Chinese takeaway away restaurant.

site_logo

PROMISE IROEGBU (Prince Promise) . 2021-08-05

MORE AT Google

Great meal, good value for money. Ordered a range of dishes for five people and nobody was disappointed. Will happily return.

site_logo

Julian W . 2021-08-02

MORE AT TripAdvisor

Very quick delivery n awesome food

site_logo

Patricia vella . 2021-06-17

MORE AT Google

Nice food, very large portions. Food is prepared quickly and they have currently have good Covid measures in place.

site_logo

Cameron Grey . 2021-05-30

MORE AT Google

OK but this time round somewhat meager on the mixed meat and prawns apart from that it was nice.

site_logo

Fred Seccombe . 2021-05-28

MORE AT Google

Food is always very good and delivery on time

site_logo

Claire Grose . 2021-05-25

MORE AT Google

It was simply the worst Chinese we have ever ordered.

site_logo

Claire Feltham . 2021-04-28

MORE AT Google

Our go to for Chinese takeaway, can't fault it 🙂

site_logo

Kurt Rumble . 2021-04-08

MORE AT Google

Only Chinese I use. Only had one meal this year because of lockdown.

site_logo

Jerry Booker . 2021-03-25

MORE AT Google

We Ordered a takeaway from here last night, the person on the phone was very polite and helpful. Our food was amazing it was really hot and tasted fresh. Thank you very much we will be returning :)

site_logo

becklap . 2021-02-28

MORE AT TripAdvisor

Gotten food from here a few times and it's always very tasty, portion sizes are average to good, and loads of options too!

site_logo

AESamuel1 . 2021-02-24

MORE AT TripAdvisor

Fantastic food! My favourite takeaway in truro!

site_logo

Lisa McEvoy . 2021-02-13

MORE AT Google

Positives: good portion size. Meat tasted nice and fresh. Negatives: no card payments. Ordered set menu2 so can give opinion on 5 dishes. Bbq rib: meat tasted nice, had a lot of pink thick sauce. Was trying to determine what that sauce tasted like, closest guess was water. Actually the problem was similar with other dishes: sauce tasteless. Just colured tasteless goo. Shrimps with moshrooms and sweet sour chicken was quite ok, tomato beef was the worst. Overall weak medicore. If I spend this amount of money on a dinner I would have hoped for better quality. Havent found a proper chinese place in Cornwall yet.

site_logo

LrKrynn . 2021-02-07

MORE AT Google

Was ok quality just didn't seem fresh everything was quite dry chicken, rice, chips etc asked to have the sauce separately on the combo trays but was just on top and wasn't much sauce either if you like a good amount. just didn't look appetising like you'd expect.

site_logo

Curtis Keen . 2021-02-07

MORE AT Google

Read the reviews after booking a delivery. It was actually very good, and far better than recent reviews might suggest. I'm not sure what's going on here, but you might be advised to make your own mind up!

site_logo

Tony W . 2021-02-05

MORE AT TripAdvisor

The Chinese in Truro. Wonderful food and service.

site_logo

Rachel Louise . 2021-01-31

MORE AT Google

Wow what can I say about this place, first time having food from here and was very disappointed, chicken balls rubbery and greasy and pink inside and it ended up in the bin i will not recommend this place, I wished I stayed away from...

site_logo

243sll88 . 2021-01-11

MORE AT TripAdvisor

Duck on beansprouts in Oyster sauce.. Duck on gravy; not just any gravy, but tastes like granules dissolved in boiling water. House Special fried rice same gravy, tasteless. Spring roll, the size of a medium pasty, but basically beansprouts, with very little else. To be...

site_logo

609busterg . 2020-11-13

MORE AT TripAdvisor

Ordered from here lots of times and had another great take away last night. They are super efficient, ordered online and it was ready 15mins later and it was quite a big order. Collected, paid by card, they have got Covid 19 precautions well sorted... Very impressed... Stuffed ourselves silly for daughters 18th! Thanks 👍

site_logo

Andy Yule . 2020-11-13

MORE AT Google

After waiting for over an hour for an order I placed for delivery, I received an email saying my order was ready for collection. I called to say that I'd requested delivery and was told that my order was for collection and if I wanted...

site_logo

clairewP430JI . 2020-10-24

MORE AT TripAdvisor

Havent had a chinese in ages, this did not disappoint, good food and service

site_logo

Katie Wilding . 2020-09-15

MORE AT Google

Ordered a chicken chow mien, there was no sauce and it was just noodles in grease. The chicken was ok but there wasn’t enough of it. My mum ordered latge fried rice and vegetables in black bean sauce. The rice was the same colour as the black bean sauce, there was weird white residue on the onions and it tasted horrible. don’t get it from here.

site_logo

Poppy Hendy . 2020-09-06

MORE AT Google

Passable, but certainly not the best Chinese around, try Threemilestone instead

site_logo

Tom Tregenna . 2020-08-09

MORE AT Google

I don’t recommend this place. I ordered chicken with vegetables. The chicken was brown and unchewable , like rubber. I ended up throwing it. Just ate the rice. If I didn’t drive all way to home I would have returned it to the restaurant. Disappointing and expensive!

site_logo

Goran Manojlovic . 2020-08-06

MORE AT Google

The food is absolutely delicious, the best Chinese food in Town i highly recommended golden dragon. you will get Good quality food.

site_logo

Nessie / Winkie Designs . 2020-06-26

MORE AT Google

Bog standard Chinese takeaway - all the usual menu choices and the same taste as you'll get anywhere else. Fast service and a convenient free car park (in the evening) directly opposite.

site_logo

Primestop . 2020-03-05

MORE AT TripAdvisor

Ordered online , food was ready and waiting, everything exactly as ordered, great food

site_logo

Terry Jane . 2020-02-19

MORE AT Google

Consistently good. Our go to for take away in Truro.

site_logo

Andrew Albert . 2020-02-16

MORE AT Google

Very nice, even with my OCD way of dishing up.

site_logo

Steven Webb . 2020-02-14

MORE AT Google

I really fancied some sweet and sour pork balls so popped into the Golden Dragon. The lady behind the counter wasn't particularly welcoming but I did not have long to wait for my food and it was not bad. Just ok really, nothing that special.

site_logo

therichastill . 2020-01-29

MORE AT TripAdvisor

Greasy grey slimy chewy crispy beef inedible, chicken satay tasted and looked like vomit, shrimp foo yung was just about stomachable, worst Chinese I've had.

site_logo

billyb92 . 2020-01-25

MORE AT TripAdvisor

Food came very quickly, had fried squid, chicken balls and king prawn chow mein. Only thing that tasted of anything was the squid, prawn dish was bland had to add my own sauces to give it any flavour. Chicken balls equally flavourless tried having the “sweet and sour sauce” but tasted more like bbq sauce. Other places in Truro can do better tasting food for cheaper unless you’re really wanting Chinese food I wouldn’t recommend

site_logo

Wade Lax . 2020-01-06

MORE AT Google

Fabulous meal. We ordered for 27 people to be delivered came on time exactly what we ordered and piping hot . Great service thankyou

site_logo

Susanne Harrington . 2020-01-05

MORE AT Google

Love this Chinese. Probably one of the best in Truro. Must of used them dozens of times of the years and only ever had one bad order.

site_logo

J B . 2019-12-28

MORE AT Google

Asked for no mushrooms in vegetable dishes as vegetarian wife doesn't like them. They were both loaded with mushrooms. So many in fact that we wonder if chef was trolling us. Unhappy wife can't eat half of her food.

site_logo

Nick M . 2019-12-21

MORE AT TripAdvisor

We had a disgusting meal of chicken and duck fried rice, ribs, sweet and sour chicken, vegetable rolls and chips. All of it was DISGUSTING. Absolutely foul food, greasy, dry. The worst chinese we've ever eaten. When we phoned to complain the lady on the...

site_logo

Jade S . 2019-12-17

MORE AT TripAdvisor

Food was greasy and tasted off, both me and my partner felt ill and stopped eating it, we rang and explained it was not nice. The manager went mental and was so rude, she told us we can not order from them again!! She refused to help or do anything We will never order drom here again...

site_logo

sabrina Spargo . 2019-12-17

MORE AT Google

Food was greasy and tasted off, both me and my partner felt ill and stopped eating it, we rang and explained it was not nice. The manager went mental and was so rude, she told us we can not order from them again!! She refused...

site_logo

O9892TSsabrinas . 2019-12-17

MORE AT TripAdvisor

We had a disgusting meal today of ribs, duck and chicken fried rice, sweet and sour chicken, vegetable rolls and chips. Worst chinese I've ever had. Overly greasy and all the food was dry. When I phoned to complain the owner got aggressive and very rude on the phone to me, told me I was lying and wouldn't offer a refund or to send someone to collect. DO NOT GO HERE, SERIOUSLY THE WORST TAKEAWAY I'VE EVER HAD!

site_logo

Jade Spargo . 2019-12-17

MORE AT Google

Food lovely and hot. Good choice. Excellent portion size. Very quick service

site_logo

Karen Taylor . 2019-12-06

MORE AT Google

Good food but waited a long time for order.

site_logo

Jordan . 2019-10-26

MORE AT Google

Similary restaurants in South West

restaurant_img
3.6

57 Opinions

location-iconCornwall, 47-49 Meneage Rd
Asian
outdoor_seating_329815takeaway_329815delivery_329815

I really try to never write bad reviews and even my google review reflects that it is possibly edible. But I have now found myself even after explaining very clearly “no tomatoes as I have an allergy” to find underneath my meat it is covered in tomatoes and after reviewing a Snapchat video I sent whilst waiting for my food watching the server take all of the salad from the same bowl that contained tomato and actually picking out some which he saw was on my food with his own uncovered fingers, now find myself taking all the medication I have to fight a reaction that could have been avoided and hoping it subsides with minor symptoms. As much as I try to support local business this is beyond even slightly positive. This place needs to be shut down. The gentleman that served me even asked when I tried to pay with a £20 note for £9 worth of food if he could keep it as he didn’t have change. To only come out with change when I refused which I forgave as maybe there was a language barrier. It is clear that was rubbish. Avoid at all cost.

restaurant_img
3.7

205 Opinions

location-icon5 Station App
Asian
outdoor_seating_154210takeaway_154210delivery_154210

Beautiful food. Plentiful and fast delivery. Chips are proper chinky chips, curry not too hot. Chicken is succulent, even chicken balls are more chicken than batter! Very nice indeed and they deliver to holiday Parks. Recommended

restaurant_img
3.7

3734 Opinions

location-iconSt Austell Enterprise Park, Treverlyn Road
Asian
outdoor_seating_137453takeaway_137453delivery_137453

Fantastic food as always ! Unfortunately service was very slow . Waited three quarters of an hour for a drink to be brought to the table didn’t have time to cut the cake let alone eat it as it took so long to come out which was a real shame as it was a celebration meal . The young lad serving our table was absolutely brilliant though polite happy bubbly lad five stars for him !!

restaurant_img
3.7

296 Opinions

location-icon109 Trelowarren Street
Asian
outdoor_seating_182067takeaway_182067delivery_182067

Ordered takeaway for the first time for along time from here,went for the set meal c , the soup was the best part. then everything else went down hill from there Ribs were dry and over cooked, sweet n sour chicken was pasty and the sauce tasted like cleaning chemicals, beef was ok but more veg than meat ,chicken n pineapple looked and tasted synthetic not happy as i might aswell put £35 in the food waste bin as that's were it ended up......

restaurant_img
3.4

463 Opinions

location-icon17-19 Commercial Rd
Asian
outdoor_seating_128518takeaway_128518delivery_128518

Ordered prawn toast, beef black bean sauce and egg fried rice Food was very salty. Beef was tender but the salty sauce overpowered it. Egg fried rice didn’t have much egg. Wouldn’t go again unfortunately. Portions were generous.