GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.3

Based on 3.320 opinions finded in 2 websites

site_photo3

Nº 111 in 339 in Tonbridge and Malling

Nº 2 of 3 American in Tonbridge and Malling

CUSTOMERS TALK ABOUT DISHES WITH..sirloincookedmeatprawnscheesesteakladysteaksribfilletribschickenpaybeautifulsaladmustlobster

comment_iconOpinions

The food was exceptional, cooked to perfection, and the Rioja wine was an excellent value for money. However, the service was disappointing. Our waiter was visibly intoxicated and engaged in inappropriate behaviour. During breaks, he consumed large quantities of beer and crisps without washing his hands, and then proceeded to cut our bread manually. After the meal, he left steak juice on the table for several minutes without cleaning it up. When the waiter returned with the dessert menu, he used my wife’s napkin to wipe the table without applying any disinfectant, and failed to replace it. Consequently, we decided not to have dessert and requested the bill. We had to request the bill a second time before it was presented. The bill included a 12.5% service charge, which I found excessive given the unsatisfactory service we received. I did not feel inclined to tip, as my experience had been deeply marred. The waiter responded dismissively when we declined to offer a tip, and he promptly bid us farewell by throwing the receipt tray onto the bar top in anger. Overall, while we would consider returning for the exceptional food, we would not recommend the establishment for its service.

site_logo

Karl H . 2025-04-06

MORE AT TripAdvisor

The venue is beautiful and relaxed. It very clean. The staff can't do enough and are so friendly and attentive. Then there's the food. Oh my! Just gorgeous.

site_logo

leanne s . 2025-03-31

MORE AT TripAdvisor

Absolutely amazing atmosphere, attentive staff and lovelu food! Pav was absolutely amazing and made our experience so lovely! We will definitely be coming back x

site_logo

Wiktoria L . 2025-03-27

MORE AT TripAdvisor

We went as a family of 5 for lunch today for a birthday meal. We had the most amazing meal and the service was brilliant from the friendly staff. We opted not to have starters to leave room for dessert but, in the end, didn't have room. My daughter and I shared the chateaubriand which was cooked to perfection along with chunky chips, wild field mushrooms, peppercorn sauce and blue cheese sauce. My husband had the sirloin steak and the others in the party had the lobster thermidor. Everything was piping hot and super tasty. As I said before, the service was super without being pushy. I would heartily recommend a visit. Thankyou to all the staff for making our visit wonderful.

site_logo

karen o . 2025-03-10

MORE AT TripAdvisor

Staff were very friendly. Unfortunately on the day we went (a Saturday so expected better) there were 2 to 3 options missing off each course with no ‘specials’ as an alternative. Food was average. Very good wine list and not overpriced which is nice to see.

site_logo

Magpielover . 2025-03-09

MORE AT TripAdvisor

Our expectations was higher that we experienced , we all know good steak restaurants are expensive however with our steaks can’t say that worth the money was ok but not the best we had fillet steak was cooked how we liked however was strangely chewy but eatable , service was ok however wasn’t worth the amount of we’ve been charged ! Without a long review our meal was over all was ok but not fantastic also it’s very expensive just be prepared ! We had better steaks elsewhere!

site_logo

mirage21 . 2025-02-17

MORE AT TripAdvisor

Went to Brettington's on Saturday 15th feb after a recommendation by friends. The restaurant was very busy, tables at the back of the restaurant felt crammed in, very close to other tables/diners, not really private or intimate. The service was good, staff were friendly and helpful, but the food was disappointing! For starters we had lobster mac and cheese, which barely had any lobster in it, the pork belly was TERRIBLE, I'd go as far as saying inedible, it was lukewarm and rubber like, we didn't eat it and they ended up removing it from our bill. We had Chateaubriand which was ok, not the best we've had and the blue cheese sauce was bland and tasteless. We had the creamed spinach which was like a bowl of soup, Ive never seen creamed spinach quite like it and with a 12.5% service charge (which we paid) it was all very disappointing. I don't think I'd recommend and definitely wouldn't't rush back.

site_logo

Lucy G . 2025-02-16

MORE AT TripAdvisor

I had Valentines Day dinner here with my husband and son. The staff although busy were super attentive, the food was exceptional as always, they have a great wine list and it’s just an all over nice vibe!

site_logo

Jaq B . 2025-02-16

MORE AT TripAdvisor

Nicely location and friendly service. Food was nice. Steak a bit grisly for a couple of the party. But chips amazing. Don't appreciate being stuck with the 12.5% tip. I wouldn't tip 25 pounds unless everything was exquisite but here it is expected.

site_logo

Tracey A . 2025-02-16

MORE AT TripAdvisor

Great food. Good em service. Would definitely recommend.

site_logo

David . 2025-02-15

MORE AT OpenTable

Very noisy, very crammed in. One steak had to be rejected due to being more fat than meat. Should never have been served. Waiter very good, used to really enjoy coming here but sadly won’t be returning

site_logo

Nathan . 2025-02-15

MORE AT OpenTable

Food was amazing Service was brilliant We sat in a booth which was cool

site_logo

Mark . 2025-02-15

MORE AT OpenTable

Valentines Dinner here was divine, the staff were so attentive and the set menu was next level. They gifted roses and it was just a really nice vibe x

site_logo

Jacqui . 2025-02-14

MORE AT OpenTable

What a fail! Was not notified that it would only be the set Valentines menu only available at time of booking. Was only notified of the at 4:45pm on Valentines day. Due to allergies no alternative could be provided on starters. Fillet steak was ask to be medium rare but came out medium to well done. Although we were told that we only had the table for 1&1/2 hours. The service/food was so slow that we were still waiting on dessert 1&3/4 hours into booking! Waited for drinks and water for table 30mins after arrival. There were plenty of servers, I assume the kitchen could not cope. I will not be returning or recommending.

site_logo

Pauline . 2025-02-14

MORE AT OpenTable

Food was amazing and the service was spot on! Very friendly nothing seemed to be a problem really felt looked after, we will be back! Thank you x

site_logo

Tracey . 2025-02-13

MORE AT OpenTable

Their food has always been lovely but now they have a set lunch menu that is amazing value for what you get. Two courses for around £20. Food, as I say, is lovely but it's the service and atmosphere that really elevate this place above the rest in Rochester. Service is friendly but polite, prompt without rushing and all round just top notch. We've been to the gastro pub down the road which does do nice food but there's always some loud guys drinking at the bar so you spend over £100 on a lunch but feel like you're in a cheap pub. You don't get that issue here. It may be a little pricey but you get what you pay for, and this place has never disappointed.

site_logo

MissusWLondon . 2025-02-08

MORE AT TripAdvisor

Great experience. Food was lovely (except the spinach which was a bit too blended for my liking and presented as a sauce - I'd have preferred garden peas I think) but everything else was delicious, fresh and perfectly cooked. Service was friendly and calm - not pushy. Ambience good. I do miss table cloths at restaurants but that's the modern way. Very good - enjoy a very nice meal out here.

site_logo

Robin . 2025-02-07

MORE AT OpenTable

Fantastic service and the food is amazing! 4 adults 1 child and everyone very happy!

site_logo

Jacqui . 2025-02-03

MORE AT OpenTable

So let’s start with this is a Steak restaurant which charges London prices, in-line with the likes of Hawksmoor and Flatiron. If we take this into consideration you would expect the food and food quality to be that of these establishments. We attended for an important birthday, all started well with service and wine, starters came out, slightly late but arrived. When we came to main course 3/4 steaks came out nowhere near cooked as ordered. Sent the food back and waited an hour for it to return despite being told priority had been put in place and saw many other plates taken past. By this time the remaining person in the party had finished meal and just sat around. Steaks returned still not entirely cooked as you would expect for said charges but by this time it was past 10pm despite having the booking for 7:45pm. Quite frankly felt embarrassed at the way the kitchen was clearly being staffed and manned. The only saving grace was the manageress who could sense our embarrassment and did all she could to rectify the situation, thank you to her. Overall an awful embarrassing experience to which you really would not expect for an upper range steak restaurant situated in a tourist hot spot.

site_logo

Dan . 2025-01-25

MORE AT OpenTable

We have eaten here quite a few times and decided to go here for a special Birthday treat for my wife as it has always been great. On arrival we were sat directly on a table outside the toilets with no other space readily available. Not ideal but we didn’t complain. The starters were lovely and served quickly. The main was delivered as soon as we had finished the starter… the plates hadn’t even been cleared. It felt extremely rushed to be honest. The main ordered was chateuxbriand medium rare and was served almost raw blue. Not great and was told it was medium rare when questioned about it. Not going to rush back I’m afraid.

site_logo

Darren . 2025-01-25

MORE AT OpenTable

The staff were all friendly and always smiling. Inside was quiet and had a very welcoming and relaxing atmosphere. We particularly enjoyed the sesame shredded beef with Szechuan sauce starter! We were there to celebrate a birthday and dessert came out with some beautiful added extras. Our waiter Klodin looked after us very well and we look forward to returning in the future.

site_logo

Ben . 2025-01-24

MORE AT OpenTable

This was our first visit and found food and service very good. Would definitely go back.

site_logo

Sheila . 2025-01-13

MORE AT OpenTable

We have always been a big fan of Brettingtons, any special occasion was spent there as a couple or with friends. Unfortunately this won't be the case going forward, top bar moved to allow for more seating, middle seating area is as usual but the bottom felt like a sardine can with more tables than we've ever seen in that area. People now standing around the bar drinking which is fine but turns the volume of the place up, reminded me more of a canteen than a weekend treat. When we first went here the portion size was more than average which was unexpected but food was beautiful and to be fair the food last night was fantastic but portion size is more of an a la carte which is fine if you have an atmosphere to match. Prices seem more expensive for less food. Brettingtins for us was a place for a very decent steak experience but think we will be more Miller and Carter than here. It's a sad shame as Brettingtons was awesome.

site_logo

Matt . 2025-01-11

MORE AT OpenTable

The staff were exemplary The food was amazing Personal details thought of. They knew it was my son birthday an done a personalised message on the dessert.

site_logo

Ruth . 2025-01-11

MORE AT OpenTable

Lovely atmosphere and really amazing food for a really reasonable price. My wife and I have been twice and will definitely be going back again.

site_logo

Ryan . 2025-01-11

MORE AT OpenTable

Dined at the sister restaurant with the best Sunday roast I've ever had. Lacked a bit of ambience in the restaurant, but overall, a lovely lunch!

site_logo

Chris . 2025-01-05

MORE AT OpenTable

Food was really good however slightly ruined by wait staff singing very loud and badly at the bar! I appreciate its new years eve but it was only 4pm!! Ordered water for the table that never arrived which we were quite glad of as it got put on the bill and was £6 for water!! Was taken off straight away when pointed out so that was fine but in general place is a little over priced .

site_logo

Vicky . 2024-12-31

MORE AT OpenTable

Both myself and my husband ordered the. 8 oz fillet steak and I can honestly say it’s the best we have had. Everything about the meal was amazing. This is the third time we have eaten there and I can say it’s the best steak and lobster house in town. Staff are attentive and nothing was too much troubles. Would recommend for that special date night.

site_logo

Michele . 2024-12-31

MORE AT OpenTable

Lovely food and drink. Great atmosphere and service, will be returning in the new year

site_logo

harry . 2024-12-31

MORE AT OpenTable

Nice looking place and that is where it stops, 18.30 dinner reservation 4 out of 8 had starters, i myself had Pork Belly 3 Slivers for just under £10.00 bit step, 20.30 still waiting for our mains to come out of which two were luke warm at best. Great location but will not be returning.

site_logo

Chris B . 2024-12-23

MORE AT TripAdvisor

We loved our meal at Brettingtons. The food was very tasty and well presented. The server was great, very friendly. Definitely would recommend

site_logo

Megan . 2024-12-21

MORE AT OpenTable

We got a great lunch service and had great food.

site_logo

Rozina . 2024-12-18

MORE AT OpenTable

All the members of the team were so helpful and polite a really super place to eat . Napkins were so white and starched , tables super clean . All the floors were too ! So close to the station and right on the lovely high street . Love it !

site_logo

Judith . 2024-12-14

MORE AT OpenTable

So good! As always. Tasty, brilliant quality food. Great service and friendly staff

site_logo

Jan . 2024-12-14

MORE AT OpenTable

Lovely ambience, decor, lighting and service. Three of us, all having the 10oz fillet, cooked perfectly and lovely sides. The mash was smooth and creamy, spinach yum! And peppercorn sauce was lovely. We also enjoyed lobster Mac and cheese / scallops / prawns for starters, all were lovely and very generous portion of lobster in the Mac and cheese… overall super impressed as I normally enjoy steak restaurants London, so it had a lot of competition but wasn’t disappointed. Will be back soon

site_logo

jamie . 2024-12-14

MORE AT OpenTable

Considering it was meant to be there busiest weekend of the year and was cancelled due to the weather, they had some sraters and afters missing as they run out. Food good, service OK, price was well over the top. £450 for 6, I veggie, no starter of afters. Would I go again? Not for that price I wouldn't.

site_logo

Paul . 2024-12-08

MORE AT OpenTable

Excellent food, atmosphere and service, couldn’t fault it!

site_logo

Ben . 2024-12-08

MORE AT OpenTable

Everything about our meal itself was wonderful! The appetizers were scrumptious, the mains were generously portioned, and both fish and steak dishes were expertly seasoned and prepared. Pre-dining cocktails were first-class! The experience was so enjoyable that we are already booked for Subday roast---dining with Bressingtons two days consecutively.

site_logo

Stephen . 2024-12-07

MORE AT OpenTable

Amazing food, top service and lovely wine. Gorgeous restaurant tucked away on the high street with a cozy setting. Klodian our waiter was on hand for anything we needed, constantly topping up our glasses and recommending the best food. Have been wanting to visit here for a while and will definitely be back soon!

site_logo

Olivia L . 2024-12-06

MORE AT TripAdvisor

Third time here in a year, never disappointed. Food, Staff, Service as always top class. This was first time trying Lobster with our steak dishes. The waiter in attendance was top class. through out our visit. I was lost trying to open / cut / crack Lobster. But there staff was amazing to help. When paying final bill, which we where more than happy with, the waiter said she was only there three weeks, you need to keep that one.!!

site_logo

paulmckay2017 . 2024-11-30

MORE AT TripAdvisor

This is our third time there, excellent service and food again. Even ventured into a lobster with steak this time. Cannot complain about anything.

site_logo

Paul . 2024-11-29

MORE AT OpenTable

Everything was perfect, from the ambience to the service, to the incredible food. Some of the best steak I have ever had. Cannot recommend highly enough!

site_logo

Pierre . 2024-11-28

MORE AT OpenTable

Reading the recent reviews of this place had my partner and I feeling really excited to try it out on our day off but we were terribly disappointed. The meat served was outright unacceptable, both cold and undercooked. The prices are honestly appalling considering the quality of the food served to us. We were considering booking for Christmas for our family, but we immediately changed our mind. If you are to visit Rochester I would advise to stay clear of this place and eat anywhere else.

site_logo

Katy J . 2024-11-25

MORE AT TripAdvisor

Hi Service was very slow, had to ask where my food was then arrived but steak was cold so was obviously sitting on the side.

site_logo

martin . 2024-11-22

MORE AT OpenTable

Wasn’t as good as the last time, potentially a different chef?? Everything else was delightful, still had a wonderful time, the food wasn’t as good which is a shame.

site_logo

Devon . 2024-11-22

MORE AT OpenTable

Below average food and not a very nice dining atmosphere

site_logo

Ruth . 2024-11-16

MORE AT OpenTable

The food was absolutely amazing and the service was first class. Definitely going to go back again.

site_logo

Mike . 2024-11-16

MORE AT OpenTable

It's a nice place for ambience, however unfortunately the food was nothing special. The pork belly starter was mainly just soft pork fat, little actual meat. The chimichurri sauce was literally just like a potent garlic oil, I couldn't eat it. The lobster was just average. I don't think I would return.

site_logo

Jennifer . 2024-11-15

MORE AT OpenTable

Although the food was outstanding, the service we received wasn't at all up to expectations. We felt very rushed. Service charge 12.5% was asked to be taken off. We were not even aware a charge would be added either. Maybe let customers know of this as well.

site_logo

Stacey . 2024-11-09

MORE AT OpenTable

The tables were extremely close together. The servers were struggling to get by and if you needed the toilet, you were uncomfortably close to your neighbours' food when trying to pass. My starter and dessert were very nice but my lamb main course was overcooked, bland and chewy. The server said that the lamb would be served pink - I wish it was! Nobody asked if the food was okay, otherwise we would've told them. We waited too long for our plates to be cleared and given the bill so we had to get up and ask for it. Not the experience we were hoping for.

site_logo

Lisa . 2024-11-09

MORE AT OpenTable

My wife and so celebrated our wedding anniversary at the restaurant, which was just amazing, just can’t fault it Thank you

site_logo

Antony . 2024-11-06

MORE AT OpenTable

Lovely, friendly and attentive service. We ordered the chateaubriand medium rare, it was slightly more rare than we would have liked but still very nice. Otherwise a perfect evening. Would be happy to eat here again.

site_logo

Hannah . 2024-11-01

MORE AT OpenTable

Excellent and highly attentive service. Atmosphere was buzzing but not too loud (Saturday night). The food quality varied a bit. The scallops were a bit disappointing - slightly chewy - and the sirloin steak was a tiny bit dry. The lobster Thermidor was delicious though and the chocolate cake dessert was amazing. Great bottle of Sancerre too, sensibly priced. For the overall price though, at £75 a head it’s not quite where it should be in terms of overall food quality but everything else was great.

site_logo

Marc . 2024-10-26

MORE AT OpenTable

Great food, great service. Couldn't ask for more. Great all round.

site_logo

Damien . 2024-10-26

MORE AT OpenTable

As you can see by my previous reviews, I am I seasoned traveler and always seeking that extra special dining experience, whether it be a road side street kitchen or well presented non chain restaurant. Passing through Rochester on work related business, I happened on this well presented establishment and its decor and that little bit of class I could sense enticed me in. I was not let down in the slightest. Had the pork.l belly starter and 1/2 lobster Thermidor... 1st class. Good value and bang on. I will always be enticed with food that is hard to replicate at home of complicated.. And this was just that ... There is a few 1 star reviews but see straight through these as picky customers and or busy day .. Well done all keep up the good work, atmosphere is great and staff especially Klodian and Reece were fantastic and attentive..

site_logo

Mark T . 2024-10-23

MORE AT TripAdvisor

Never disappoints whenever we visit. Highly recommend

site_logo

Pippa . 2024-10-19

MORE AT OpenTable

Had a lovely lunch for my partner's birthday. Service excellent - very attentive, polite staff. Food was great - good portions and delicious. Great setting having been recently refurbished. Will definitely go again.

site_logo

Andrea . 2024-10-15

MORE AT OpenTable

Went here for my Fathers Birthday. Food was amazing, Service was amazing. Highly Recommend.

site_logo

. 2024-10-12

MORE AT OpenTable

Great ambience and customer service from our waiters, so attentive with every little thing from our evening out for my brother's birthday! Shout-out to Reece, Max and Claudia!

site_logo

Phoebe M . 2024-10-09

MORE AT TripAdvisor

Staff were very kind and cracked alot of jokes which lightened the place, I proposed to my girlfriend in the restaurant and they came and gave us a round on the house to celebrate. Loved having food in there and il definitely be coming again

site_logo

Bryce . 2024-10-05

MORE AT OpenTable

My wife & I celebrated our 6th wedding anniversary here last week, with some friends over the States & Barbados. The service was superb, we were greeted with a celebratory drink, which was an amazing touch. Service was always attentive, never over-bearing - all staff were friendly and the venue is spotless. Was the food the best I have ever had? No - but it was darned good - the steak was cooked well, fries were piping hot. My wife's mash was not hot - but warm - but you know what nothing is perfect. The service more than made up for some of the inconsistencies with the food, the pricing was very reasonable - there were 6 of us - 3 courses each, 2 bottles of wine and 3/4 beers and a couple bottles of bottle water and the bill was £420. We will be back for sure!

site_logo

Mark Q . 2024-10-04

MORE AT TripAdvisor

I booked brettingtons not knowing what to expect for myself and my girlfriend for our 1 year anniversary and it did not disappoint,we were sat immediately and giving complimentarily champagne on the house,the two gentlemen that dealt with us were courteous and very professional,attentive but not encroaching on our evening.Our mains were amazing,the steak in particular was the best I've ever had,but the overall experience of the restaurant made our night and we will definitely be coming back and recommending mainly because of the staff. Thankyou for a wonderful night

site_logo

Adrian . 2024-09-28

MORE AT OpenTable

We were greeted with a complimentary glass of prosecco each as it was our anniversary which was great and the steak and lobster were excellent, cooked to perfection - couldn't have wanted better and to finish it off the banoffee pie was also superb. Would recommended, you get what you pay for

site_logo

Jason . 2024-09-28

MORE AT OpenTable

We had our anniversary meal there last year and we received a complimentary drink, this time we did not receive one. Apart from that the food was amazing and waiting staff attentive.

site_logo

Michelle . 2024-09-28

MORE AT OpenTable

Food was ok , lobster wasn’t the best but the steak was good. Sadly they put the service charge on with out asking. Sad seeing restaurants doing this

site_logo

Andrew . 2024-09-27

MORE AT OpenTable

First time booking after hearing good things. Really impressed….lovely ambience with many of the tables being secluded booths. Our waiter was really friendly and attentive. Good selection on the menu and the food was really good! The 10oz fillet was hefty but cooked to perfection. Definitely will be adding this to our list of regular options.

site_logo

Paul . 2024-09-26

MORE AT OpenTable

Excellent as always, a great place to celebrate special occasions but also just to treat yourselves! Brilliant.

site_logo

Kevin . 2024-09-14

MORE AT OpenTable

Excellent service and great food

site_logo

PierisA . 2024-09-11

MORE AT OpenTable

amazing food and drink as always. Service was great and good delivery times on food. Always have a lovely meal when we come here

site_logo

Laura . 2024-09-10

MORE AT OpenTable

Thank you for an amazing night. The service and food was fantastic. We especially appreciated your staff wishing us a happy anniversary.

site_logo

Peter . 2024-09-03

MORE AT OpenTable

Fantastic experience, felt very welcomed and the ambience was lovely

site_logo

Tilly . 2024-09-02

MORE AT OpenTable

Staff were really lovely and food amazing. Had a really great tiime as usual.

site_logo

Jane . 2024-09-02

MORE AT OpenTable

The food was very good, the service was excellent - every single staff member spoke to us & all were so polite and friendly. The busy Friday night ambience could have detracted from that but it didn’t. Only small point was some candles on the tables or string lights could soften the green/ wood 40’s vibe! But great overall - especially outside of London - give it a try…

site_logo

louie_wins . 2024-08-30

MORE AT TripAdvisor

We had a great meal, for starters: 2 x calamari, 1 scallops, 1 x Thai king prawns - all really tasty. For mains 3 x rump steaks and 1 half lobster Thermidor, again, all delicious and the bearnaise sauce was scrumptious!

site_logo

Kim . 2024-08-24

MORE AT OpenTable

This was our second time going to Brettingtons and overall still one of our favourite places. Staff are very friendly, prompt in taking orders and serving food. The staff we spoke to was very helpful and professional service with a smile. Steaks cooked to perfection and cocktails mixed well.

site_logo

Maria . 2024-08-24

MORE AT OpenTable

Excellent quality food. Good sized portions and everything had great flavour. Lovely friendly staff!

site_logo

Emma . 2024-08-23

MORE AT OpenTable

Brilliant steak house. Really tasty food. Lovely ambience. Attentive staff. Really recommend this for a date night. We opting for a sharing platter for two, that had three different cuts. Really well cooked, great wine list.

site_logo

JoFo74UK . 2024-08-20

MORE AT TripAdvisor

Our evening certainly lived up to the reviews and expectations. The staff were very friendly and helpful... Max, our waiter for the night, was a star and helped us through our menu choice. We decided to go for the rib eye steaks and added a half lobster... The steaks were cooked perfectly at medium rare and my Bearnaise sauce was beautifully seasoned as was my partner's Peppercorn sauce. The lobster Thermidor was tremendous and we immediately regretted not ordering two!!! We finished the meal with Creme Brûlées... Needless to say "delicious". We came away nicely full but not bloated... and will be back for sure. Would thoroughly recommend Brettington's as a perfect venue for a wonderful experience all round. Thank you all.... Vic and Deborah

site_logo

Companion782812 . 2024-08-18

MORE AT TripAdvisor

We had a lovely meal to celebrate a birthday! Everything was great and delicious- it was nice. We’ve been before this was a second visit for us. The staff were friendly and laughed with the table shared a laugh with us and were professional in their manner throughout. The meal was really very nice, I didn’t leave feeling it was the BEST meal we’ve had however it was a very really evening.

site_logo

Ellie . 2024-08-16

MORE AT OpenTable

Disappointed. Has this restaurant been sold on???. The food wasn't great, tough stringy lamb. Monkfish was tough.Creme brulee was burnt. Can't even make a floater coffee.Was one of my favourite restaurants, will NOT be returning. £6.00 for a bottle of water. Service wasn't great!

site_logo

tracey s . 2024-08-13

MORE AT TripAdvisor

Quality and taste of food was exceptional. King prawns weren’t rubbery and weren’t drowning in butter and sauce which is brilliant. For a main we had a bone in ribeye steak for two, medium rare cooked and house salad and peppers as sides. Steak was to die for, tender, juicy, full of flavour and it wasn’t chewy. I enjoyed every bit of it. Would definitely come back again and recommend to my friends and anyone who loves good quality steaks and nice atmosphere. Members of staff were very friendly and polite. This place worth every penny you spend.

site_logo

AnnaK . 2024-08-10

MORE AT TripAdvisor

Went due to a recommendation of somewhere to eat in Rochester. Menu has some lovely options but some of them quite pricey. It was quite noisy too, but did reduce over the course of the evening. There is an option on the menu for ‘While you wait’ which says £5 - pork scratching, olives, sour dough bread. It’s not clear that it means £5 each. We had the bread, followed by chicken wings and pork belly starters. Mains we had rack of ribs (although this actually turned out to be half a rack of ribs, just 5 ribs) and a 10oz sirloin steak. We also had sides of spinach and onion rings. They were all very tasty, nicely cooked to order and well presented. We also had wine, beers and a cocktail. When booking made a note that it was a birthday and when we sat down the waiter commented that it must be a birthday as I had a gift bag of presents with me, and I’m sure he said they’d “sort something at the end”, but there was nothing during the course of the evening to acknowledge this, so no point in having been asked. Overall, we enjoyed the meal, service was friendly and prompt, but just a couple of small points that let it down.

site_logo

Michelle . 2024-08-09

MORE AT OpenTable

Great food, service and venue. A tad pricey but worth it for special occasions.

site_logo

Jatinder . 2024-08-06

MORE AT OpenTable

Wow we enjoyed a 1st class meal from start to finish fantastic food along with great service couldn't fault in any way at all . Thank you

site_logo

luigiferrara1965 . 2024-08-04

MORE AT TripAdvisor

Fine but not outstanding. Not great for value had to order extra sides , for price of meat we should not have had to.

site_logo

TonyG . 2024-08-03

MORE AT OpenTable

This is the 3rd time going and would rate the first 2 times as excellent! This time we were a little dissappointed with the food, we order Chateaubriand but the meat instead of being nicely cut was butchered in thick pieces. The sauce for the onion rings wasn't great either. Did try and chat to the waiter to see if the menu had changed but he had only been there a couple of weeks so couldn't really understand why it was different. Would still recommend based upon the first couple of times as that was excellent!

site_logo

Michael . 2024-08-03

MORE AT OpenTable

We went for our wedding anniversary and noted it on our booking, which they relayed and congratulated us on arrival, which was nice. The service was great, all staff were very attentive and the food was amazing - we had scallops and confit pork for starters, the chatueaubriand med-rare with a bottle of Malbec…it was all delicious and we’ll definitely be returning!

site_logo

. 2024-08-02

MORE AT OpenTable

This was a lunch with old friends for my wife's birthday. The food was excellent the service impeccable and the staff went above and beyond to make the occasion special. Ken Mitchell.

site_logo

Ken . 2024-08-02

MORE AT OpenTable

Greet customers service and nothing was to much trouble and food was amazing

site_logo

. 2024-07-27

MORE AT OpenTable

Steak cooked to perfection but £55 for a clawless lobster is a bit steep Best crispy beef starter I have ever had Service fantastic but I was given a flat, lifeless pint of lager which was replaced Would recommend but only for special occasions

site_logo

. 2024-07-26

MORE AT OpenTable

All the food was fantastic, service was brilliant, and they even went the extra mile to fulfil the cocktail request!

site_logo

. 2024-07-26

MORE AT OpenTable

Another great meal with the guys at Brettingtons. Well done, keep it up !

site_logo

Japop . 2024-07-21

MORE AT OpenTable

Prior to attending, called to adjust booking time by one hour & the manager i spoke to, who was polite & very professional, accommodated the change with zero fuss & i was very grateful. Shortly after attending on the day of the booking the restaurant experienced a power failure but dinning staff regularly checked-on us, provided myself and company with drinks and starter snacks, plus gave us several updates relating to the power failure situation. Eventually, the power was restored and we ordered food which was all nice to look at and tasted great. Dined at Brettingtons on several occasions and have enjoyed each visit. Definitely my favourite resturant in Rochester and maybe Kent. 😊

site_logo

MrJay . 2024-07-20

MORE AT OpenTable

Great anniversary dinner out. Food amazing. Service great. Even with power cut, we were well looked after and kept informed what was happening. Power restored super quick and meal was Lovely. Staff very attentive.

site_logo

EmmaW . 2024-07-20

MORE AT OpenTable

Awful experience! Steak was chewy and bland! Just pub grub level with prices that didn’t reflect the quality. Our waitress Grace was lovely and was the only positive thing about our evening! There was a power cut just after we finished eating, so the whole restaurant sat in dark, which was a natural disaster however the way the manager dealt with this was terrible! Showing a lack of experience! There was no announcement, no offer of a complimentary drink or removal of service charge! We also requested tomato sauce from the manager that never arrived! Poor attitude from manager, we would never ever return!!

site_logo

SophieC . 2024-07-20

MORE AT OpenTable

Lovely service, great food we did go early PM. Will be going back!

site_logo

. 2024-07-18

MORE AT OpenTable

Late decision to eat out with my wife and daughter. Been here before and as on previous occasions food and service were excellent. The ambience and atmosphere of the restaurant is relaxing and comfortable. Can’t fault.

site_logo

NeilG . 2024-07-18

MORE AT OpenTable

Some of the best customer service we have ever received, absolutely top notch server! Deserves a pay rise! Beautiful food, great drinks and lovely atmosphere. We were celebrating our daughter’s graduation and couldn’t have asked for a better experience. Highly recommend 5stars

site_logo

. 2024-07-17

MORE AT OpenTable

I visited Brettingtons with family for a special occasion and the service was impeccable, the staff were so lovely and gave me a glass of wine on the house due to the special occasion and really made me feel special. The food was incredible and enjoyed every moment.

site_logo

. 2024-07-17

MORE AT OpenTable

We had the loveliest experience celebrating my graduation at Brettington’s! The staff were extremely friendly and attentive. The food was perfect, couldn’t fault it!! Highly recommend!

site_logo

. 2024-07-17

MORE AT OpenTable

Similary restaurants in South East

restaurant_img
4.3

162 Opinions

location-icon14 East St, Tonbridge, TN9 1HG, United Kingdom
outdoor_seating_376800takeaway_376800delivery_376800

Over the moon today, having had an excellent lunch there. Service and food top notch, so THANK YOU!! The LWL foursome.

restaurant_img
4.3

1869 Opinions

location-icon497 London Rd, Ditton, Aylesford ME20 6DB, United Kingdom
outdoor_seating_346517takeaway_346517delivery_346517

Absolutely lovely fish & chips and great staff.

restaurant_img
4.3

691 Opinions

location-iconThe Green
British
outdoor_seating_192606takeaway_192606delivery_192606

Lovely interior with burning log fires. Excellent lunch which was enjoyed by all seven of us- we will be back! It is being transferred to community ownership but the staff will continue which is good news!

restaurant_img
4.3

549 Opinions

location-icon1, Angel Walk, 1 Angel Ln, Tonbridge TN9 1TJ, United Kingdom
outdoor_seating_376773takeaway_376773delivery_376773

Awesome! If you want a delicious taste of Asia then this is a gem right in Tonbridge! They offer lots of different sushi options (vegetarian included), and have a 'build your own' lunch of protein+sauce+rice/noodles = delicious! It's obviously not as cheap as a Greggs £1 sausage roll, but it's in line with a Pret/Costa and is carefully handmade food in a very nice restaurant. Check it out! 2025 update: just had lunch here again and so so good! Friendly staff and lovely food, good vegan options.

restaurant_img
4.3

39 Opinions

location-icon87 Carpenters Ln, Hadlow, Tonbridge TN11 0EX, United Kingdom
outdoor_seating_376825takeaway_376825delivery_376825

Cold, no hot food very dated and is a Shepard name pub..... what's there to like?