GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.1

Based on 1.519 opinions finded in 2 websites

site_photo4

Nº 842 in 1604 in Newcastle upon Tyne

Nº 7 of 12 Japanese in Newcastle upon Tyne

CUSTOMERS TALK ABOUT DISHES WITH..salmonbeautifulcookedroundoldcurrymustricechillipaymeatfishchickenspicysteakprawnducksushiskewers

comment_iconOpinions

Visited for a birthday meal. Overall vibe was great inside, with one of the best sushi which I have ever had! Great gluten free menu, with no nuts at all on the premises for nut allergies. Generally food was slightly overpriced for what it was, and service lacked punctuality at times, with missing items and slow responses, but was overall satisfactory - when you’re visiting this sort of place however, you expect it to be perfect!

site_logo

ebr . 2024-12-03

MORE AT Google

Went for bottomless brunch on Saturday and it was amazing from start to finish. Lauren was so helpful and made sure our time there went smoothly and that we always had a drink. The waitress jade was also great. Food and drinks were lovely there was loads of choice. Would 100% recommend.

site_logo

Charlotte Easton . 2024-12-02

MORE AT Google

The women who was serving us was absolutely awful, very rude when I mentioned that there was a severe allergy to nuts on the table which I had previously mentioned. Since we were a big party the drinks were slow which is fair enough however we did ask for bottles of Prosecco on the table and the women had said that we weren’t allowed this however two minutes after she was putting bottles of Prosecco on the tables next to us who was doing bottomless brunch. We made David the manager away however the women was so rude it ruined my birthday! David was amazing tho and very understanding.

site_logo

Manon Bureau . 2024-12-02

MORE AT Google

Lauren went above and beyond for us all, we loved our night there!

site_logo

Anna Ferguson . 2024-12-02

MORE AT Google

The service and ambience was great. We went in for the vibe and it was perfect. The food was alright, not a fan of Japanese food so my review wouldn’t be great. Definitely overpriced though as the portion sizes were tiny. They say it was halal, but they don’t know what that means, there’s cross contamination and they don’t know that doesn’t work.

site_logo

Nadia Faraz . 2024-12-01

MORE AT Google

Absolutely terrible service had to ask for cutlery after waiting 40 minutes for food which was bland soggy and Luke warm staff just didn't seem as if they knew what they had to do the restaurant is actually in a bouncing bar with music blasting I couldn't here the waitress or even have a conversation with my wife it was that loud I have never experienced anything like it in my life I would definitely not go back and would definitely not recommend to my worst enemy it was that bad there is much better places to eat but if you like sitting in a night club and dining go for it!

site_logo

Andy Gibbons . 2024-10-13

MORE AT Google

Went in for the sushi club, £34 each with a friend, so £68 in total including service charge. First few plates of salmon nigiri were nice, but after that they probably didn't prepare enough rice as it started getting mushier and some grains were clearly hard and not fully cooked. The one plate at a time meant that most of the time was sent waiting in between, at least 5 minutes per plate of 4 nigiri (rolls take longer). There were only three tables including us in at the time. Quality of food wise, the salmon was fine, the tuna had gone brown, I personally would skip the rolls as most of them taste the same. The panko ones have sriracha drizzled generously over them so just tasted like a fried sriracha donut. Almost everything else had some sort of sweet/sour sauce drizzled over it to which I cannot understand why (including on the nigiri and even on the 'mexican' nacho beef and cheese roll) Overall, the sushi was a major disappointment, huge gripe with the horror of the nigiri rice, sriracha and sauce on everything for some reason. You can definitely get better value japanese food or other cuisines elsewhere for £68... Only good thing was that our server was very nice and quick with taking our orders!

site_logo

Kelvin Cheung . 2024-09-27

MORE AT Google

Lauren was an amazing manager looked after us all great. Jade was very efficient on the floor serving food and drink. Romero made some stunning cocktails would definitely come again.

site_logo

Dominic Wilford . 2024-09-19

MORE AT Google

Lovely food. Good price. Good night out

site_logo

Sarah Turnbull . 2024-09-05

MORE AT Google

Comida increíble - visitamos el domingo que era tranquilo (probable debido al footie y el mercado del muelle) pero queríamos un lugar para sentarse. Quería probar este lugar durante mucho tiempo. Menú separado GF y había un montón de opciones. También tuvimos menú de domingo y menú normal que todos teníamos algo de. La comida no decepcionó de las porciones a los sabores.

site_logo

RachyRooster . 2024-09-02

MORE AT TripAdvisor

It was absolutely amazing from start to finish. The food was unreal, staff were lovely and atmosphere was great. Highly recommend.

site_logo

S Begum . 2024-08-30

MORE AT Google

Estábamos deseando cenar aquí después de leer las críticas, pero eso fue de corta duración Teníamos el menú de 3 platos que optamos por alitas de pollo y rollitos de primavera a los que el pollo estaba seco y los rollitos empapados Tuvimos pollo teriyaki que era completamente insípido y servido con verduras extrañas, así que en general muy decepcionante

site_logo

Steve H . 2024-08-25

MORE AT TripAdvisor

Went for bottomless brunch on Saturday and Lauren and Sophia were amazing hosts. Could see it was very busy but we always had a drink in hand, the service was brilliant. The food was also some of the best I’ve ever had at a bottomless brunch, will definitely be back!

site_logo

Ava Welsh . 2024-08-22

MORE AT Google

Elegimos Aveika por recomendación de mi padre como lo había sido varias veces antes. Hay una zona de bar y un gran restaurante. Llegamos por un 1. Almuerzo del domingo a las 30 pm, y había muy poca gente en, a pesar de que el muelle estaba con la gente. Nos presentaron 3 menús: a la carta, un menú fijo y un menú de almuerzo dominical. Mi padre fue a un asado de carne, muy tradicional con pudín Yorkshire, pero el toque japonés era que el brócoli había sido cocinado en mantequilla miso. También tenía nigiri de salmón para empezar. Fuimos a por el a la carta, con una mezcla de verduras de tempura (casi no recubiertas y casi insípidas) , pinchos de salmón (buenos) , piquero de pollo (buenos) , y una selección de dim sum (en una cesta de bambú, casi insípida, esencialmente 4 gyoza que se desmoronaron) Las bebidas tardaron siglos en llegar, apareciendo justo antes de la comida, algo raro dado lo vacía que estaba, y una solicitud de sal y pimienta también tardó mucho en cumplirse. No había ambiente y el personal parecía confundido por qué estábamos allí. Si bien el asado dominical fue satisfactorio, no fue un lugar para regresar para la cocina japonesa o incluso fusión.

site_logo

adamcreen . 2024-08-12

MORE AT TripAdvisor

Qué decepción de principio a fin. Un miembro masculino del personal nos recibió con un gruñido. Llegaron las bebidas, pero el vidrio estaba sucio. La mesa estaba sucia. Comida solo bien. Las patatas fritas especiadas estaban poco condimentadas. No hay cubiertos traídos para el plato principal. Tuve que preguntar. Bebidas muy mediocres y caras. Gran cargo por servicio añadido por lo que la factura era enorme. No volverá.

site_logo

Flowerpot . 2024-08-08

MORE AT TripAdvisor

Comida encantadora, gran servicio de Jade 😊 ella era tan profesional y amable, y muy en la pelota con bebidas! Lo recomendaría a cualquiera!

site_logo

Nancy M . 2024-07-27

MORE AT TripAdvisor

Writing this on behave of my niece. She and a friend had the bottomless brunch. Food was excellent and the service they received was exceptional. They want to thank David for making their experience so enjoyable.

site_logo

AudreyMay92 . 2024-07-08

MORE AT TripAdvisor

Ate here this evening with a friend. We are staying at the vermont hotel and this restaurant was one that we were able to use our wine and dine offer through the hotel This was a set menu of 3 courses, with a glass of wine To begin with a warm friendly welcome Seated and menus given, water to the table also, which is a nice touch We both had the same dishes Starter chicken spring rolls with sweet chilli Main Katsu chicken Dessert sticky toffee pudding Each course was lovely, presented well, and staff were so curious and not in your face The dessert in particular, WOW you have to try this AMAZING Thank you guys for such lovely food and wonderful service

site_logo

Fiona Sturrock . 2024-07-05

MORE AT Google

Ate here this evening with a friend. We are staying at the vermont hotel and this restaurant was one that we were able to use our wine and dine offer through the hotel This was a set menu of 3 courses, with a glass of wine To begin with a warm friendly welcome Seated and menus given, water to the table also, which is a nice touch We both had the same dishes Starter chicken spring rolls with sweet chilli Main Katsu chicken Dessert sticky toffee pudding Each course was lovely, presented well, and staff were so curious and not in your face The dessert in particular, WOW you have to try this AMAZING Thank you guys for such lovely food and wonderful service Food: 5/5 | Service: 5/5 | Atmosphere: 4/5 Recommended dishes Chicken Katsu Curry, Sticky Toffee Pudding

site_logo

Fiona S . 2024-07-05

MORE AT TripAdvisor

Great food and atmosphere, friendly staff

site_logo

Mal Watson . 2024-07-03

MORE AT Google

We went to Aveika yesterday and tried their 3-course set menu. Amazing chicken sushi and spring rolls. We ordered beef skewers and mini sliders. The taste was on the point. They have best sticky toffee pudding in the Newcastle (10/10). Halal friendly. Go there if you love sushi 💯

site_logo

Haider Ali . 2024-06-30

MORE AT Google

Went as family of 4 had a lovely table overlooking the bar. Staff were really friendly - thanks Lauren and Sophia your service was fantastic. Food really tasty, we tried Salmon Poke bowl, Katsu chicken and sliders - all excellent. Drink’s great, good atmosphere. Will deffo go back

site_logo

OutofOffice . 2024-06-23

MORE AT TripAdvisor

I had a really bad experience at the bar by one of the bar people regarding the 2-4-1 cocktails. However Chloe, one of the bar people was really professional and calmed the situation and made me want to return to the bar. She was a credit to the establishment, well done Chloe!

site_logo

Joanne H . 2024-06-22

MORE AT TripAdvisor

Love this place! Nice staff at the counter. Surprised this place wasn't packed with people at 5 pm 😃

site_logo

A H . 2024-06-20

MORE AT Google

Amazing setting with the best food in town!! 2 courses for £19.95 you can’t get better than that🥂

site_logo

Rosie Brown . 2024-06-20

MORE AT Google

We have visited Aveila a number of times and always e joyed the food. We recently tried the bottomless brunch for a date night and would highly recommend it. The food was delicious as always and a good portion size for a bottomless brunch. We were delighted with the professionalism and attentiveness of our waitress, Hannah. She was friendly, accommodating, and knowledgable; she visited our table with a huge smile each time. Thank you.

site_logo

Lynsey E . 2024-06-08

MORE AT TripAdvisor

Spent a fab afternoon at Aveika. Food, staff and atmosphere all first class. Will definatly return and would recommend to family and friends. Well worth a visit.

site_logo

Diane Longcon . 2024-05-26

MORE AT Google

We might as well have been invisible the service was so poor, took ages to take orders, even longer for drinks to arrive and it felt like we were an inconvenience for the staff. Food seemed to take an age to come and the crackers that were suggested to us to keep us going till the food arrived, arrived with the food! Food wasn't bad in terms of flavours however some were tepid as though it had been left out for a while and portion sizes for some dishes not great considering the price. It was a bizarre setting, felt more like we were in a nightclub at the end of the night, not many dining, loud music from the bar was all we could hear, aircon on full blast meant we kept jackets on throughout the meal. Toilets in a very poor state. Someone who appeared to be a supervisor or perhaps manager eventually came with the bill (when he found time between conversations with others in the bar/restaurant) and didn't ask us how our food/experience was. We all paid separately and opted not to pay the huge service charge put on our bill, but later that night got an email to say we'd were short and they'd taken more from the card used to book. It left a bitter taste as we would never knowingly under pay and every one of us had handed a card to him to take payment - perhaps if he'd been paying more attention instead of breaking off to talk to people in the bar he would have realised his error. Instead he walked off without further acknowledgement and we were left none the wiser that 1 card had not been charged (until we checked bank accounts following the email). All in all, not one of our group will be back and would recommend no one else does either. For reference, we've been meeting as a group for weekends away all over the country for over 10 years and of the many meals we've booked, we've never had such a terrible dining experience.

site_logo

Tora Oetgen . 2024-05-20

MORE AT Google

Food is below average They charged over £5 for the crackers, which should be complementary given the way they offer. The whole chicken we had was badly marinated

site_logo

Abdulaziz Bader . 2024-05-13

MORE AT Google

Amazing venue and service from Hannah !!! She has made our experience so fun and was so friendly and helpful throughout x

site_logo

alannah hegarty . 2024-05-11

MORE AT Google

Nice spot by the quayside. Dj music

site_logo

N Asari . 2024-04-30

MORE AT Google

Great food with a wide range of vegan options that are delicious. The staff are friendly and helpful making the experience super relaxed. Highly recommend.

site_logo

Becky Entwistle . 2024-04-27

MORE AT Google

Had a lovely afternoon Bottomless Brunch with my friend. We had a lovely welcome, the drinks on offer were top quality and great variety to choose from. Our server Martyna was extremely helpful and friendly, very sad to hear it was her last day. She will be a big loss. The food was exceptional; I chose the salmon bowl - very tasty and generous portion. Would highly recommend this experience and look forward to a return trip.

site_logo

608carolynp . 2024-04-07

MORE AT TripAdvisor

Brilliant service from Maja and Sophia, will be back again!

site_logo

Kam . 2024-04-06

MORE AT Google

Came for a bottomless brunch for my friends birthday. Food and drinks were all unreal and amazing service from Maja.

site_logo

Sophia Sharp . 2024-04-05

MORE AT Google

My waitress Sophia was so attentive and welcoming will deffo be back again !!

site_logo

Maya Jach . 2024-04-05

MORE AT Google

Went for bottomless brunch early on a Thursday, we were the only ones in the restaurant as a table of 4 but my word, Lauren and David were the perfect hosts!! Jim cooked our delicious food and we were never without a drink (triple parked at times!). Thank you so much for an amazing experience we loved it

site_logo

Rachael Harrison . 2024-03-28

MORE AT Google

Bottomless brunch with David and Lauren as servers. Had to ask for both names as it was truly phenomenal service. Incredible work by all staff.

site_logo

Sean Garmory . 2024-03-28

MORE AT Google

Mia our waitress was a fantastic hostess and made sure we felt very attended to. Food was lovely and drinks were flowing a fantastic visit

site_logo

Jayne M . 2024-03-23

MORE AT TripAdvisor

Mia was an outstanding waiters and the bottomless brimuch so tasty. Really recommended. Lovely choice even though vegetarian

site_logo

Michelle B . 2024-03-23

MORE AT TripAdvisor

We had a bottomless brunch for a friends birthday and the service was great from start to finish. Our waitress Martyna was very attentive, keeping our drinks topped up and she was so friendly.

site_logo

niamh m . 2024-03-17

MORE AT TripAdvisor

We did bottomless brunch yesterday for my friends birthday and the service was amazing! Martyna was our server and we had the best experience!

site_logo

Abeatiie34 . 2024-03-17

MORE AT TripAdvisor

Absolutely fantastic bottomless brunch. Thanks so much to Maja and David for a great service

site_logo

Katie Davison . 2024-03-09

MORE AT Google

Went for bottomless brunch had an unreal time. Had Sophia as our sever and she was amazing so attentive 10/10 food was great aswell!

site_logo

Harris C . 2024-03-09

MORE AT TripAdvisor

Did brunch in Aveika, the drinks were absolutely amazing and came so fast, Lauren was doing our service, she was so welcoming and lovely.

site_logo

Kaya J . 2024-03-08

MORE AT TripAdvisor

I had brunch here, it was amazing, lauren done our service and she was so welcoming and kind, would recommend this place to anyone.

site_logo

Kaya Jach . 2024-03-08

MORE AT Google

What a lovely experience , Lauren was amazing so attentive and fun :) thank you Lauren and the team

site_logo

Martyna Stachura . 2024-03-08

MORE AT Google

Booked late night brunch for a birthday, we got a sharing platter between 3 that didn’t even have enough portions for 3 people. This included 2 prawn skewers, 4 chicken strips, 5 spring rolls and a small portion of chips, we weren’t asked if we wanted to order anything else or if it was ok, the platter just came. Definitely not worth the £50 each we paid. Drinks came in jugs which was also disappointing for a bottomless brunch. We ordered birthday desserts whilst booking that we didn’t receive, which we mentioned on the way in.

site_logo

XX . 2024-03-06

MORE AT Google

a group of me and my friends visited here for a bottomless brunch and let me start by saying one of our servers, Alliyana was brilliant and i can’t fault her! However, after spending almost £300 here one of my friends overheard 2 of the staff talking about how ‘the group of girls here think they’re something special when they’re in fact they look cheap’ one of these men was called david i believe and he had actually been serving us alongside the other server. after hearing them say this my friend questioned if they were speaking about us in which they replied ‘of course not’ but there were no other groups of girls in the restaurant that it could be about. in addition to this the bouncer on the door was also very aggressive towards us whilst we were waiting for a taxi in the doorway as it was raining. very disappointing experience when we were celebrating 2 of our friends birthdays. on a positive note the food and drinks could not be faulted!

site_logo

oliviadN9709WZ . 2024-03-02

MORE AT TripAdvisor

Bottomless brunch very sneakily served cocktails forgetting the alcohol. We complained and then told us we had to give our table up to wait in the bar for fresh drinks.

site_logo

Amanda and Milo . 2024-03-02

MORE AT Google

Came to bottomless brunch, had one drink in 45 mins, had the mini sliders which smelt of fish and sushi, was not satisfied with my service at all, the waitress’ were rushed and felt like they didn’t know what they were doing. Asked repeatedly for a new round of drinks which were the exact same as before as you have to pre order and took 40-50 mins to come, very dissatisfied as this was meant to be a great place. I would not return for even casual drinks or an occasion!!

site_logo

Tilly Robinson . 2024-02-24

MORE AT Google

Hmmmm what to say. Our server was so nice and helpful and patient as there is a lot on the menu to understand. Me and my wife so wanted this to be her perfect venue for an anniversary dinner and having read the booking information regarding their rules regarding dress code etc we hoped for the best. Safe to say the whole experience was ruined by groups who don't seem to know the difference between a restaurant and the football terraces. The noise, language and increasing drunkedness were just totally unacceptable. Food was OK but for vegetarians, no protein so basically - vegetables.

site_logo

Mountainathlete . 2024-02-23

MORE AT TripAdvisor

Booked for a corperate event and staff were amazing

site_logo

Alexander Emmerson . 2024-02-23

MORE AT Google

Highly recommended we had a bottomless Prosecco lunch The food was lovely I had the fish and my wife the meat both were very tasty Our waitress Mia deserves a special mention so friendly and very efficient she made our day We will definitely return

site_logo

geordieginge . 2024-02-21

MORE AT TripAdvisor

Everything was perfect, food was gorgeous. Came from middlesbrough and wasn’t disappointed. Staff were so lovely! Definitely be back soon. Thank you :)

site_logo

Anem Sharif . 2024-02-15

MORE AT Google

Went for Valentine’s Day, the set menu of 3 courses for £20.95 was amazing. Good portions, tasty food and the customer service was fab from the staff. Will definitely be visiting again

site_logo

Sophie Whitehouse . 2024-02-14

MORE AT Google

Alliana, David and Rachel Staff/chefs made the evening. It was what I expected, and went above and beyond, I thanked them so much and they made my night and my girlfriend, very special. Very much like to come back again. They are a credit to the team.

site_logo

camerona331 . 2024-02-14

MORE AT TripAdvisor

I went to Aveika Restaurant today as part of #NE1RestaurantWeek and was not disappointed. Delicious food. Lovely venue and very attentive staff. Can't wait until my next visit.

site_logo

Amanda Dixon . 2024-02-13

MORE AT Google

I was here on Saturday for bottomless brunch and have to say I couldn’t fault it at all. The food was amazing, we both had the duck bowl and absolutely loved it. Sophia was our waitress and made the whole afternoon amazing, nothing was too much and we were never left waiting for a drink. She was delightful and made us feel very welcome. We will definitely be returning soon!

site_logo

ross b . 2024-01-29

MORE AT TripAdvisor

Beautiful food and lovely staff.

site_logo

Florence Deputron . 2024-01-25

MORE AT Google

Visited Aveika on Thursday for the restaurant week offer. Service and food amazing throughout. Lauren provided us with everything we needed and more. Will definitely be coming back!

site_logo

anonymous123239 . 2024-01-21

MORE AT TripAdvisor

Food was lovely, staff were excellent. Well priced on the restaurant week menu but I also think that the main menu was fairly priced for the quality. Just found the music a bit loud and club-like for a relaxing lunch. Uncertain if I'd return for this reason.

site_logo

Janette Campbell . 2024-01-20

MORE AT Google

I went here with a group of friends on the 10th of jan for my friends birthday. The customer service was disgusting. I think are servers name was maya, she was rude and disrespectful and felt like she didn’t want to be there. Wasn’t a pleasant experience. Really need to improve her customer service skills.

site_logo

jasarms123 . 2024-01-18

MORE AT TripAdvisor

I came with a group of friends on the 13th of jan and the customer service was horrible and distasteful. The server had a bad attitude and always looked miserable. I think her name was mya/maya. Would’ve put 0/5 stars if it was possible - not a good experience!

site_logo

Rachel S . 2024-01-18

MORE AT TripAdvisor

Bottomless brunch was amazing. Sophia was so fast with the drinks and so polite. Gave us everything we needed. Great service and amazing food

site_logo

jessica b . 2024-01-06

MORE AT TripAdvisor

It's a great Japanese restaurant with excellent food. All the staff were very friendly. The interior of the restaurant is quite stunning. Dave helped me with the booking and Maja and Martyna looked after us and kindly boxed up our food, we simply couldn't manage...

site_logo

_lukeross0 . 2024-01-01

MORE AT TripAdvisor

The staff especially Martina where so friendly, continually checking we were ok and asking if we would like more drinks, would 100% recommend.

site_logo

_Daisy_H_76 . 2023-12-22

MORE AT TripAdvisor

Beautiful beautiful time for Christmas lovely scenery food amazing. Martina was the best. Love the chandelier in the room very vibey

site_logo

Daydream12667573050 . 2023-12-22

MORE AT TripAdvisor

Thoroughly enjoyed our bottomless brunch for my daughters 21st birthday. Food was excellent and drinks kept flowing. Even though they were extremely busy staff couldn’t do enough for you. Brilliant experience would definitely recommend and go back.

site_logo

June G . 2023-12-21

MORE AT TripAdvisor

To loud music for our taste. Good food, but drinks were not up to par.

site_logo

Vidar Lunde . 2023-12-21

MORE AT Google

Great service and great food, Martyna really looked after us. Small plates menu was just perfect for two persons. Enjoy

site_logo

I6382VQmattb . 2023-12-20

MORE AT TripAdvisor

Amazing service and food! Lovely atmosphere x

site_logo

Cleo Rimmer . 2023-12-17

MORE AT Google

The atmosphere is electric , time is 25 minutes faster in there, i check my time and i dont know have been there for long, music is a food to the soul ,their dj chef knows so well about cooking.

site_logo

Kolawole Ajao . 2023-12-17

MORE AT Google

Couldn’t recommend Avekia enough - especially if you’re looking to book for a meal/ drinks (or both!) for any kind of event or celebration. I had a Christmas party with my friends last night with food & drinks and the night couldn’t have went any...

site_logo

Erin P . 2023-12-16

MORE AT TripAdvisor

Excellent food and serve from staff, David has been extremely helpful and couldn’t do enough for us during our visit! Highly recommend Aveika!

site_logo

Madeleine O . 2023-12-16

MORE AT TripAdvisor

Last night I had the pleasure of a meal with my friends in the restaurant followed by drinks up in the mezz after. I couldn’t fault one part of the night, door staff were polite, bar staff were quick, the food was gorgeous & having the upstairs area booked out for our party was a lovely atmosphere- it felt as if we had the whole place to ourselves! I would very much reccomend if you are looking to book for an event/ party/ celebration!!!

site_logo

Erin Parker-Taylor . 2023-12-16

MORE AT Google

Sadly cant remember name of the manager in the restuarant.. think David. He went above and beyond to find fever tree tonic for me. I was impressed. I should have written an email to say that I thouhht he waa very attentive to the cistomers and hope will go a long way in the industry!!!! He stood out. 1/12/23

site_logo

Elizabeth Swanwick . 2023-12-13

MORE AT Google

Bottomless bruch, fantastic friendly service from staff, food lovely, great cocktails delivered as fast as we could drink, great atmosphere, very complmented by their request we take part in some publicity filming and photos our smiles were genuine, definitely recommend and will return again Thank...

site_logo

Jane B . 2023-12-11

MORE AT TripAdvisor

Came as a group of friends for out Christmas get together (really hard due to working shifts) table booked 7:30pm. Trouble as party ran over totally understandable, seated at 7:45pm meal ordered and starter arrived at 8:20 lovely. We sat chatting lovely catch up, and...

site_logo

Julie J . 2023-12-09

MORE AT TripAdvisor

Lovely festive menu. Sliders were delicious 😋

site_logo

S O . 2023-12-07

MORE AT Google

Went here for bottomless brunch at the weekend the service was unbelievable our waitress martina couldn't of done anymore for us. I gave 5 stars for service but had there of been more stars she would of got more. See you again soon

site_logo

Martin Mcloughlin . 2023-12-06

MORE AT Google

Absolutely fabulous bottomless brunch. One of the best we've had! Food was amazing and the range of drinks were excellent. The service from Sophia was top class. Thank you for a great afternoon!

site_logo

Jill C . 2023-12-04

MORE AT TripAdvisor

I came here with friends yesterday for bottomless brunch and it was one of the best. The food was beautiful. I got salmon teriyaki and added chilli and garlic chips. Maja well and truly looked after us and kept those cocktails flowing, thank you. We'll...

site_logo

Quinny1991 . 2023-12-03

MORE AT TripAdvisor

Booked bottomless brunch for 2pm Saturday afternoon. Seated straight away and service was amazing throughout, special shout out to Maja very friendly and kept the drinks flowing. Food amazing. Would definitely recommend.

site_logo

figee28 . 2023-12-03

MORE AT TripAdvisor

Bottomless brunch with the girls was brilliant , food was gorgeous , drinks came quickly and service was perfect, cannot recommend enough and maja was fabolous host

site_logo

Stay01778525398 . 2023-12-03

MORE AT TripAdvisor

Lovely service by martyna always there to help. Really enjoyed my time and food

site_logo

Dylan Lawson . 2023-11-25

MORE AT Google

Just been for a bottomless brunch and can not complement the young woman martyna enough she was absolutely a pleasure great service great talk what a lovely young lady a asset to the bar/ restaurant

site_logo

dylan L . 2023-11-25

MORE AT TripAdvisor

Out for a friends birthday - Very attentive no hassle and great food! Really impressed with this bottomless brunch! Would deifnetly recommend!

site_logo

Itsavibe12345 . 2023-11-25

MORE AT TripAdvisor

Gorgeous food, really tasty and beautifully presented. Our server Maja kept our drinks flowing for our brunch.

site_logo

Kat M . 2023-11-24

MORE AT TripAdvisor

Unreal good and drinks Martyna was amazing and looked after us all night could not fault her at all food and drinks were all spot on xx

site_logo

Macy M . 2023-11-19

MORE AT TripAdvisor

Martyna was the loveliest server, she made sure our drinks were filled at all times, and the food was lovely she was a gorgeous girl!!❤️

site_logo

jessica h . 2023-11-19

MORE AT TripAdvisor

Was there for afternoon brunch, our waitress Georgina was fantastic and the food and cocktails were spot on, only down side was it was very noisy but I’d definitely go again!

site_logo

Rebecca B . 2023-11-19

MORE AT TripAdvisor

We were served by Martina who was so attentive and friendly. Made our experience really enjoyable.

site_logo

Kelly Jefferson . 2023-11-19

MORE AT Google

Bit noisy but we are old. Food fantastic and Sophia our waitress was lovely, smiley, pleasant and nee her stuff

site_logo

Carole P . 2023-11-18

MORE AT TripAdvisor

Bottomless brunch was lovely, food amazing and drinks were always topped up. Thank you Martyna great service 🤍

site_logo

Ellie K . 2023-11-18

MORE AT TripAdvisor

Our waitress Maja was attentive and always made sure our glasses were filled. Food was beautiful and we felt very welcome. Thank you Maja.

site_logo

Caron D . 2023-11-18

MORE AT TripAdvisor

First time here. We opted for the bottomless brunch. The food was amazing. I had chilli beef skewers whilst my partner had thai green curry. Beautifully presented and fantastic flavours. I’d return for the food and service alone. Very attentive staff keeping us topped up...

site_logo

RGoer . 2023-11-13

MORE AT TripAdvisor

First time visiting Aveika for a meal, having only ever been for drinks. Can only describe it as like being at the circus. People dashing around, being asked the same question multiple times by different servers, one waiter was rushing around that much he actually...

site_logo

Hannah S . 2023-11-12

MORE AT TripAdvisor

Food was good for most of our group, but unfortunately several could not have what they wanted due to a 1 hour wait time for the sharing platters initially ordered. It was only 8 in the evening so a bit of a shame that a...

site_logo

Experience770152 . 2023-11-08

MORE AT TripAdvisor

Me and my friend done the bottomless brunch on Saturday afternoon and it was the best service from a brunch I have ever received. Sophia our server was so accommodating and we were never without a drink, she was so attentive. The food was lovely...

site_logo

rebeckahb123 . 2023-11-06

MORE AT TripAdvisor

Similary restaurants in North East

restaurant_img
4.1

606 Opinions

location-icon14 Leazes Park Road, Newcastle upon Tyne NE1 4PF England
Japanese
outdoor_seating_275207takeaway_275207delivery_275207

Went out for my birthday. The service was terrible, waiting over half an hour for anyone to come take our order. There was a couple behind us that came in after us and they had their order taken as they came in. My food was lovely though, enjoyed that. Few of the party said the katsu curry was bland. They didn't bring items that we asked for and we had to ask 3 times for one of our party to even get a tap water. Attitude from the servers wasn't the best at all, and no management in the say anything too. We got the service charge taken off because we complained, which is optional anyways. Unfortunately, I won't be going back.

restaurant_img
4.0

521 Opinions

location-icon139-141 Grainger Street
Japanese
outdoor_seating_238679takeaway_238679delivery_238679

Good variety of food. Can’t expect too much for a takeaway standard. Overall fresh and delicious. Would come back again.

restaurant_img
4.2

1112 Opinions

location-icon69 Grey Street
Japanese
outdoor_seating_214683takeaway_214683delivery_214683

Took clients for dinner as the setting is snug without being too intimate and there are lots of tasty plate options and alternatives. Unfortunately we arrived at different sites and only connected after 30 minutes of waiting(despite both mentioning the booking name -a glitch in the two-site system if you don't arrive as one group). Wine list is fine and lots of festive options of cocktails etc. Service a bit hit and miss as they were inducting new staff but the veterans knew the menu well and made some informed suggestions. Loved the Bau buns and octopus balls especially. Around £50per head plus drinks. A successful evening.

restaurant_img
4.3

4593 Opinions

location-iconFenwick
Japanese
outdoor_seating_85989takeaway_85989delivery_85989

The Champagne bar is a fantastic experience! The staff are second to none and the experience is one not to miss!

restaurant_img
4.3

1238 Opinions

location-icon45 Bath Lane
Japanese
outdoor_seating_85977takeaway_85977delivery_85977

Entrego aquí con bastante regularidad. Nunca nada más que sobresaliente. No hay trucos tontos, sólo buena comida cocinada en su mesa. Recomendaría Hanahana a cualquiera.