GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.2

Based on 1.558 opinions finded in 2 websites

site_photo4

Nº 752 in 1604 in Newcastle upon Tyne

Nº 6 of 12 Japanese in Newcastle upon Tyne

CUSTOMERS TALK ABOUT DISHES WITH..sushibeautifulcookedroundpayfishchickenspicyprawnsteakmustsalmonduckchillicurrymeatriceskewersold

comment_iconOpinions

Staff, food and hospitality was fantastic. The bartender was amazing and sought a solution to my partner's allergy and created a delicious cocktail for her. To say I would go back and recommend this restaurant to others is a massive YES. 10 out 10. 🔥🔥🔥🔥🔥

site_logo

Shaun Barclay . 2025-05-20

MORE AT Google

Caminando alrededor de las áreas de comida y nos encontramos con este lugar, estábamos buscando al aire libre debido al buen tiempo, estaba un poco sucio alrededor del piso de la mesa, el fútbol estaba encendido, así que estaba ocupado con los seguidores después del partido. El servicio era lento y todo tardó tanto en llegar a la mesa (no hay suficiente personal de camareros) las bebidas estaban frías, pero sentimos que el plato de comida que pedimos era la combinación incorrecta y por lo que no lo terminamos. Bonito estar al sol pero a un costo (Drenes cercanos) y en el día del fútbol un montón de bromas. . . .

site_logo

CriticM . 2025-05-12

MORE AT TripAdvisor

We dine yesterday with the family, the food served was great.The staff are friendly and beyond expectations. Thanks to Mr.M.Lina.

site_logo

Florybeth Fontanilla . 2025-05-11

MORE AT Google

All staff went above and beyond, George is a credit to the company and we're so sad he's leaving. The area manager also went above and beyond for us too as it was my friends 30th birthday. Food was outstanding and all staff so lovely and smiley. I will 100% be returning for your amazing brunch! 10/10 one of the best in newcastle and we've been to nearly all of them over the years!

site_logo

Melissa Neale . 2025-04-27

MORE AT Google

Diabolical experience. Went for a meal alone on the 12th of April just celebrate a successful working month but what an awful choice. I wanted to try something new but ended up being put off. Booked a week in advance. When I got there, the music was so loud right off the entrance (should’ve turned back, actually), I couldn’t hear the front of house lady. I also booked a table specifically for one person and expected to dine for about 60 minutes. But then they offered a table but needed it back in 30 minutes. Flatly said no, because why would I say yes!!?? There is NO division between the dining area and the bar, so you can hear EVERYTHING, down to patrons shrieking PLUS the horrendous music. Ordering was fine but got given a dish that was for another table. Serving time was about 10/15 minutes for a single champagne flute and food took even longer. (Ridiculous.) The bill was served faster than my food, to be honest. On the upside, the food was decent and the servers, frantic as they were, were polite and understanding, especially the larger lad (not in a crude way, I just don’t know how to describe him). Overall, there are FAR BETTER choices elsewhere. Avoid.

site_logo

Ricky Cajimat . 2025-04-22

MORE AT Google

Aveika suele ser mi lugar de comida, nunca me decepciona en términos de calidad y sabor de la comida. He sido habitual durante años, sin embargo, un miembro del personal se destacó para mí llamado George. Vino para el almuerzo del domingo e hizo la experiencia tan acogedora, muy atento y servicial. Por primera vez en mucho tiempo me he encontrado con alguien en la industria alimentaria siendo amable y acogedor. ¡George gracias! Bueno, volveré otra vez

site_logo

Misfa B . 2025-04-13

MORE AT TripAdvisor

Top notch! Had dinner yesterday and the food was cooked to perfection 👌 absolutely delicious i had the wing starter and main was the teriyaki chicken skewer mmmm mmmm I am usually a food critic because I can cook and can honestly say the food was cooked to my liking perfect! Hot, tasty, loads of flavour, vegetables were nicely done i couldn't fault it. Atmosphere was super so was the service! You can see the chef at work in a very clean appealing environment. The young lady who was serving us was friendly, approachable and professional thank you 😊

site_logo

Reg Moses . 2025-04-10

MORE AT Google

Pasamos por una cena (no planificada) aquí, el menú atrajo. Situado en el acceso al muelle, Aveika tiene una calificación muy alta, y nuestra experiencia aquí ciertamente se hizo eco de eso. Era temprano un viernes por la noche, por lo tanto tranquilo, y conseguir una mesa para dos no fue un problema, aunque sin duda recomendaría reservar. El servicio era de primera clase, nuestro pedido fue tomado rápidamente, la entrega de la comida eficiente, y en todo, el personal a mano para comprobar todo estaba bien sin ser intrusivo. La comida en sí era excelente. Al no ser un conocedor de la comida japonesa, el menú era realmente sencillo de entender, y extenso con una amplia selección de opciones vegetarianas o de carne. Descrito como "auténtico pero no tradicional", lo describiría como delicioso. Muy bien preparado y presentado, y a un precio muy razonable. Hay tantos lugares para comer en Newcastle. Aveika puede desafiar lo convencional, pero tuvimos una excelente visita aquí y sin duda lo recomiendo.

site_logo

TheAviator0765 . 2025-04-09

MORE AT TripAdvisor

Booked over a month in advance for a table and followed all of the ridiculous rules and regulations everyone had ID, on time looking forward to our private table. Walked in to be told they had forgotten our booking and we have to sit at the bar but not ebnough seats for our group of 13 wouldn't even look at our booking reference or offer a solution. Even had to double check if we walked out we wouldn't be charged. Appalling service and attitude

site_logo

Laura Grieve . 2025-04-05

MORE AT Google

Gran comida, gran ambiente, fue por comida antes de dirigirse al centro de la ciudad 5 adultos 1 niño de 13 meses, el servicio era de primera clase, regresó más tarde y tuvo bebidas en el bar, John Preston nos encontró una zona para sentarse y estaba prohibido para hacerlo más privado, John se esforzó mientras estábamos allí para asegurar que nos atendieron. Muy recomendable tanto para comida como para bebidas.

site_logo

Billy P . 2025-03-30

MORE AT TripAdvisor

Gran experiencia! Y un gran servicio al cliente de Cherelle el sábado por la noche! -Muchas gracias. ¡Volveremos a visitarte en un futuro próximo!

site_logo

Jo . 2025-03-10

MORE AT TripAdvisor

Gran experiencia, nada era demasiado para Thomas nuestro servidor! La comida era increíble y los cócteles también! ¡Gracias, volveremos!

site_logo

tyler-marie k . 2025-03-07

MORE AT TripAdvisor

Lovely atmosphere, friendly service and gorgeous food!

site_logo

Natasha Pinkney . 2025-02-28

MORE AT Google

I’ve never been so disappointed in a restaurant in my life. My friend and I visited yesterday- Sunday, February 9th, late afternoon and we were literally the only customers in the entire restaurant. The waitress, a young oriental/asian woman took our order. Every exciting sushi roll had meat or seafood in it, so I asked if they could leave out the prawn in one of them or substitute it with a vegetable or tofu, etc.. She didn’t even bother asking the sushi chef who was within short walking distance from our table and simply said no. The only roll she offered me was one with asparagus and carrots. I was shocked since every single sushi restaurant I’ve been to before would easily leave out or substitute ingredients in a roll to accommodate their customers. The fact that she didn’t even bother asking the sushi chef and was cold and abrupt with me when I requested one small thing, showed me how much she cared about customers. I was left eating an asparagus and carrot roll which I could have made at home. The rolls were also expensive for the portions and ingredients compared to other sushi restaurants. The sushi chef was very nice, so I wish I spoke with him directly and just avoided the unhelpful waitress. I only left a tip for the sushi chef. Please, if you want to keep customers, hire staff that want to accommodate them and put sushi rolls on your menu that are exciting for all of your customers including vegans and vegetarians. You used to have roasted aubergine sushi rolls but removed them from your menu for some reason. Is it that difficult to put a sweet potato tempura and avocado roll on your menu? Please make your restaurant more vegetarian or vegan friendly when it comes to your sushi menu.

site_logo

Michelle . 2025-02-12

MORE AT Google

A sushi "restaurant" inspired by the NBA and MTV. Very rarely do I feel unsettled enough not to tip but I only tipped here out of pitty for the waiting staff. Without the unbearably loud music, I would have half expected Michael Jordan himself, to make an appearance as the waiters squeaked around the restaurant slamdunking orders left right and centre (perhaps some slight hyperbole with that last reference). They appeared rushed off their feet and this is perhaps why after waiting so long, I poured my personal waterbottle into a glass so as not to feel awkward. Went here in Restaurant Week after having not visited for years.I thought it was just that I had a headache after a long day, but the music was so loud and only made it worse. Despite this, there was a darkness to tne restaurant and the red stage lights gave off a nostalgic feeling of returning to the womb - not sure if this is what they were going for. The restaurant had a strange mix of guests: families with strollers and young people dressed in what I will respectfully refer to as "nightclub wear" - perhaps this just isn't the "restaurant" for me anymore. The table was against a wall and in a walkway where if myself or anyone else leaned back in their seat, guests were walking into us on their way in/out. Food was okay as is any food, and I am grateful that I am of the small percentage in the developing world that can complain. When Aveika first opened however, it felt like an authentic Japanese restaurant that served delicious food. This felt like fast food sushi served in what I can only imagine was the closest thing to a nightclub. I asked for chopsticks and the waitress gave me disposable ones in a plastic packet to replace the fork she had given me to eat my sushi and salmon. Both dishes were small and my main course was dry and cold. The jasmine rice was as expected but the whole dish was no better than what a university friend could whip together in her student kitchen (no offense to her but she did admit that she was new to cooking at the time). Perhaps she should open a "restaurant" or "Pan Asian sit down night club". I am not usually one to complain but have done so in the hope that people do not waste their money. I did not order dessert to avoid further disappointment.

site_logo

Abigail Middlemas . 2025-02-09

MORE AT Google

went for bottomless brunch with work friends, never been to aveika before but will totally be back!! we where greeted by lauren and had sophia serving us. fantastic service both girls where lovely and cocktails where amazing 😍

site_logo

Kacie Stevens . 2025-02-01

MORE AT Google

served by sophia and lauren they were absolutely amazing!!

site_logo

Esca . 2025-02-01

MORE AT Google

We dined here during restaurant week to try something new. Food was delicious and service was fantastic. Even with a limited menu for restaurant week there was something each of us could enjoy (4 people with quite different tastes). Will definitely return.

site_logo

Tracey Leverett . 2025-01-18

MORE AT Google

Came for a NYE meal with my partner and were both really impressed. I was worried it might be too “clubby” inside but the atmosphere was perfect, chilled and fun. The service was spot on and the man serving us was really friendly and polite without being overbearing. The food was unreal. We shared edamame beans, I had the crispy duck leg and sticky toffee pudding and everything was great. Cocktails were tasty too- just a shame there were no deals on them! Will def be back and would def recommend.

site_logo

Chloe Cook . 2025-01-01

MORE AT Google

Lauren and louwen were brilliant, they attended to our every need and were wonderful servers. The food was lovely and Lauren and louwens recommendations were well suited to our tastes. The service was quick and polite, would highly recommend.

site_logo

Harry Wheildon . 2024-12-22

MORE AT Google

Tuve una increíble fiesta de Navidad del personal con mi trabajo, Lauren hizo la experiencia 10 veces mejor, servicio extremadamente rápido, chica encantadora. Sin duda volveré : )

site_logo

Alannah . 2024-12-22

MORE AT TripAdvisor

me and my friend came for bottomless brunch, food was lovely the cocktails( porn star) were nice but couldn't taste alcohol. the service was great too but at the end of the night when we asked for the bill we noticed it was more expensive than we expected and when I asked about it they said it was due to the festive season. i said this is false advertisement and would like this changed. this was dealt with very quickly and the bill was then reprinted. other than that everything was lovely.

site_logo

Kayleigh Murphy . 2024-12-16

MORE AT Google

Visited for a birthday meal. Overall vibe was great inside, with one of the best sushi which I have ever had! Great gluten free menu, with no nuts at all on the premises for nut allergies. Generally food was slightly overpriced for what it was, and service lacked punctuality at times, with missing items and slow responses, but was overall satisfactory - when you’re visiting this sort of place however, you expect it to be perfect!

site_logo

ebr . 2024-12-03

MORE AT Google

Lauren went above and beyond for us all, we loved our night there!

site_logo

Anna Ferguson . 2024-12-02

MORE AT Google

Went for bottomless brunch on Saturday and it was amazing from start to finish. Lauren was so helpful and made sure our time there went smoothly and that we always had a drink. The waitress jade was also great. Food and drinks were lovely there was loads of choice. Would 100% recommend.

site_logo

Charlotte Easton . 2024-12-02

MORE AT Google

The women who was serving us was absolutely awful, very rude when I mentioned that there was a severe allergy to nuts on the table which I had previously mentioned. Since we were a big party the drinks were slow which is fair enough however we did ask for bottles of Prosecco on the table and the women had said that we weren’t allowed this however two minutes after she was putting bottles of Prosecco on the tables next to us who was doing bottomless brunch. We made David the manager away however the women was so rude it ruined my birthday! David was amazing tho and very understanding.

site_logo

Manon Bureau . 2024-12-02

MORE AT Google

The service and ambience was great. We went in for the vibe and it was perfect. The food was alright, not a fan of Japanese food so my review wouldn’t be great. Definitely overpriced though as the portion sizes were tiny. They say it was halal, but they don’t know what that means, there’s cross contamination and they don’t know that doesn’t work.

site_logo

Nadia Faraz . 2024-12-01

MORE AT Google

Teníamos muchas ganas de cenar aquí, pero por desgracia bang promedio para el precio. Tengo que admitir que tenía las alitas de pollo Stebaski para empezar y estaban golpeados, podría haberlos comido toda la noche. Mi esposa tenía el pollo harumaki, pero desafortunadamente no se dejó llevar por ellos. Mains ella tenía el pollo al curry katsu del que no tenía ninguna queja, pero yo tenía la parrilla de carne mezclada y me decepcionó mucho, le falta mucho gusto. Mencioné esto a unos cuantos servidores, pero no parecían demasiado preocupados porque había dejado la mayor parte de la comida. Para las bebidas me tomé un cruzcampo, no me puedo quejar de la buena pinta, mi mujer tuvo un Sevilla de verano que dijo que sabía a naranja fresca y limonada. Dijo que el Zinfandel blanco era encantador. La decoración y el ambiente era perfecto. En general, este lugar no me dejó realmente impresionado con su cocina

site_logo

Simmaz . 2024-11-17

MORE AT TripAdvisor

Absolutely terrible service had to ask for cutlery after waiting 40 minutes for food which was bland soggy and Luke warm staff just didn't seem as if they knew what they had to do the restaurant is actually in a bouncing bar with music blasting I couldn't here the waitress or even have a conversation with my wife it was that loud I have never experienced anything like it in my life I would definitely not go back and would definitely not recommend to my worst enemy it was that bad there is much better places to eat but if you like sitting in a night club and dining go for it!

site_logo

Andy Gibbons . 2024-10-13

MORE AT Google

Went in for the sushi club, £34 each with a friend, so £68 in total including service charge. First few plates of salmon nigiri were nice, but after that they probably didn't prepare enough rice as it started getting mushier and some grains were clearly hard and not fully cooked. The one plate at a time meant that most of the time was sent waiting in between, at least 5 minutes per plate of 4 nigiri (rolls take longer). There were only three tables including us in at the time. Quality of food wise, the salmon was fine, the tuna had gone brown, I personally would skip the rolls as most of them taste the same. The panko ones have sriracha drizzled generously over them so just tasted like a fried sriracha donut. Almost everything else had some sort of sweet/sour sauce drizzled over it to which I cannot understand why (including on the nigiri and even on the 'mexican' nacho beef and cheese roll) Overall, the sushi was a major disappointment, huge gripe with the horror of the nigiri rice, sriracha and sauce on everything for some reason. You can definitely get better value japanese food or other cuisines elsewhere for £68... Only good thing was that our server was very nice and quick with taking our orders!

site_logo

Kelvin Cheung . 2024-09-27

MORE AT Google

Lauren was an amazing manager looked after us all great. Jade was very efficient on the floor serving food and drink. Romero made some stunning cocktails would definitely come again.

site_logo

Dominic Wilford . 2024-09-19

MORE AT Google

Lovely food. Good price. Good night out

site_logo

Sarah Turnbull . 2024-09-05

MORE AT Google

Comida increíble - visitamos el domingo que era tranquilo (probable debido al footie y el mercado del muelle) pero queríamos un lugar para sentarse. Quería probar este lugar durante mucho tiempo. Menú separado GF y había un montón de opciones. También tuvimos menú de domingo y menú normal que todos teníamos algo de. La comida no decepcionó de las porciones a los sabores.

site_logo

RachyRooster . 2024-09-02

MORE AT TripAdvisor

It was absolutely amazing from start to finish. The food was unreal, staff were lovely and atmosphere was great. Highly recommend.

site_logo

S Begum . 2024-08-30

MORE AT Google

Estábamos deseando cenar aquí después de leer las críticas, pero eso fue de corta duración Teníamos el menú de 3 platos que optamos por alitas de pollo y rollitos de primavera a los que el pollo estaba seco y los rollitos empapados Tuvimos pollo teriyaki que era completamente insípido y servido con verduras extrañas, así que en general muy decepcionante

site_logo

Steve H . 2024-08-25

MORE AT TripAdvisor

Went for bottomless brunch on Saturday and Lauren and Sophia were amazing hosts. Could see it was very busy but we always had a drink in hand, the service was brilliant. The food was also some of the best I’ve ever had at a bottomless brunch, will definitely be back!

site_logo

Ava Welsh . 2024-08-22

MORE AT Google

Elegimos Aveika por recomendación de mi padre como lo había sido varias veces antes. Hay una zona de bar y un gran restaurante. Llegamos por un 1. Almuerzo del domingo a las 30 pm, y había muy poca gente en, a pesar de que el muelle estaba con la gente. Nos presentaron 3 menús: a la carta, un menú fijo y un menú de almuerzo dominical. Mi padre fue a un asado de carne, muy tradicional con pudín Yorkshire, pero el toque japonés era que el brócoli había sido cocinado en mantequilla miso. También tenía nigiri de salmón para empezar. Fuimos a por el a la carta, con una mezcla de verduras de tempura (casi no recubiertas y casi insípidas) , pinchos de salmón (buenos) , piquero de pollo (buenos) , y una selección de dim sum (en una cesta de bambú, casi insípida, esencialmente 4 gyoza que se desmoronaron) Las bebidas tardaron siglos en llegar, apareciendo justo antes de la comida, algo raro dado lo vacía que estaba, y una solicitud de sal y pimienta también tardó mucho en cumplirse. No había ambiente y el personal parecía confundido por qué estábamos allí. Si bien el asado dominical fue satisfactorio, no fue un lugar para regresar para la cocina japonesa o incluso fusión.

site_logo

adamcreen . 2024-08-12

MORE AT TripAdvisor

Qué decepción de principio a fin. Un miembro masculino del personal nos recibió con un gruñido. Llegaron las bebidas, pero el vidrio estaba sucio. La mesa estaba sucia. Comida solo bien. Las patatas fritas especiadas estaban poco condimentadas. No hay cubiertos traídos para el plato principal. Tuve que preguntar. Bebidas muy mediocres y caras. Gran cargo por servicio añadido por lo que la factura era enorme. No volverá.

site_logo

Flowerpot . 2024-08-08

MORE AT TripAdvisor

Comida encantadora, gran servicio de Jade 😊 ella era tan profesional y amable, y muy en la pelota con bebidas! Lo recomendaría a cualquiera!

site_logo

Nancy M . 2024-07-27

MORE AT TripAdvisor

Writing this on behave of my niece. She and a friend had the bottomless brunch. Food was excellent and the service they received was exceptional. They want to thank David for making their experience so enjoyable.

site_logo

AudreyMay92 . 2024-07-08

MORE AT TripAdvisor

Ate here this evening with a friend. We are staying at the vermont hotel and this restaurant was one that we were able to use our wine and dine offer through the hotel This was a set menu of 3 courses, with a glass of wine To begin with a warm friendly welcome Seated and menus given, water to the table also, which is a nice touch We both had the same dishes Starter chicken spring rolls with sweet chilli Main Katsu chicken Dessert sticky toffee pudding Each course was lovely, presented well, and staff were so curious and not in your face The dessert in particular, WOW you have to try this AMAZING Thank you guys for such lovely food and wonderful service

site_logo

Fiona Sturrock . 2024-07-05

MORE AT Google

Ate here this evening with a friend. We are staying at the vermont hotel and this restaurant was one that we were able to use our wine and dine offer through the hotel This was a set menu of 3 courses, with a glass of wine To begin with a warm friendly welcome Seated and menus given, water to the table also, which is a nice touch We both had the same dishes Starter chicken spring rolls with sweet chilli Main Katsu chicken Dessert sticky toffee pudding Each course was lovely, presented well, and staff were so curious and not in your face The dessert in particular, WOW you have to try this AMAZING Thank you guys for such lovely food and wonderful service Food: 5/5 | Service: 5/5 | Atmosphere: 4/5 Recommended dishes Chicken Katsu Curry, Sticky Toffee Pudding

site_logo

Fiona S . 2024-07-05

MORE AT TripAdvisor

Great food and atmosphere, friendly staff

site_logo

Mal Watson . 2024-07-03

MORE AT Google

We went to Aveika yesterday and tried their 3-course set menu. Amazing chicken sushi and spring rolls. We ordered beef skewers and mini sliders. The taste was on the point. They have best sticky toffee pudding in the Newcastle (10/10). Halal friendly. Go there if you love sushi 💯

site_logo

Haider Ali . 2024-06-30

MORE AT Google

Went as family of 4 had a lovely table overlooking the bar. Staff were really friendly - thanks Lauren and Sophia your service was fantastic. Food really tasty, we tried Salmon Poke bowl, Katsu chicken and sliders - all excellent. Drink’s great, good atmosphere. Will deffo go back

site_logo

OutofOffice . 2024-06-23

MORE AT TripAdvisor

I had a really bad experience at the bar by one of the bar people regarding the 2-4-1 cocktails. However Chloe, one of the bar people was really professional and calmed the situation and made me want to return to the bar. She was a credit to the establishment, well done Chloe!

site_logo

Joanne H . 2024-06-22

MORE AT TripAdvisor

Amazing setting with the best food in town!! 2 courses for £19.95 you can’t get better than that🥂

site_logo

Rosie Brown . 2024-06-20

MORE AT Google

Love this place! Nice staff at the counter. Surprised this place wasn't packed with people at 5 pm 😃

site_logo

A H . 2024-06-20

MORE AT Google

We have visited Aveila a number of times and always e joyed the food. We recently tried the bottomless brunch for a date night and would highly recommend it. The food was delicious as always and a good portion size for a bottomless brunch. We were delighted with the professionalism and attentiveness of our waitress, Hannah. She was friendly, accommodating, and knowledgable; she visited our table with a huge smile each time. Thank you.

site_logo

Lynsey E . 2024-06-08

MORE AT TripAdvisor

Spent a fab afternoon at Aveika. Food, staff and atmosphere all first class. Will definatly return and would recommend to family and friends. Well worth a visit.

site_logo

Diane Longcon . 2024-05-26

MORE AT Google

We might as well have been invisible the service was so poor, took ages to take orders, even longer for drinks to arrive and it felt like we were an inconvenience for the staff. Food seemed to take an age to come and the crackers that were suggested to us to keep us going till the food arrived, arrived with the food! Food wasn't bad in terms of flavours however some were tepid as though it had been left out for a while and portion sizes for some dishes not great considering the price. It was a bizarre setting, felt more like we were in a nightclub at the end of the night, not many dining, loud music from the bar was all we could hear, aircon on full blast meant we kept jackets on throughout the meal. Toilets in a very poor state. Someone who appeared to be a supervisor or perhaps manager eventually came with the bill (when he found time between conversations with others in the bar/restaurant) and didn't ask us how our food/experience was. We all paid separately and opted not to pay the huge service charge put on our bill, but later that night got an email to say we'd were short and they'd taken more from the card used to book. It left a bitter taste as we would never knowingly under pay and every one of us had handed a card to him to take payment - perhaps if he'd been paying more attention instead of breaking off to talk to people in the bar he would have realised his error. Instead he walked off without further acknowledgement and we were left none the wiser that 1 card had not been charged (until we checked bank accounts following the email). All in all, not one of our group will be back and would recommend no one else does either. For reference, we've been meeting as a group for weekends away all over the country for over 10 years and of the many meals we've booked, we've never had such a terrible dining experience.

site_logo

Tora Oetgen . 2024-05-20

MORE AT Google

Food is below average They charged over £5 for the crackers, which should be complementary given the way they offer. The whole chicken we had was badly marinated

site_logo

Abdulaziz Bader . 2024-05-13

MORE AT Google

Amazing venue and service from Hannah !!! She has made our experience so fun and was so friendly and helpful throughout x

site_logo

alannah hegarty . 2024-05-11

MORE AT Google

Nice spot by the quayside. Dj music

site_logo

N Asari . 2024-04-30

MORE AT Google

Great food with a wide range of vegan options that are delicious. The staff are friendly and helpful making the experience super relaxed. Highly recommend.

site_logo

Becky Entwistle . 2024-04-27

MORE AT Google

Had a lovely afternoon Bottomless Brunch with my friend. We had a lovely welcome, the drinks on offer were top quality and great variety to choose from. Our server Martyna was extremely helpful and friendly, very sad to hear it was her last day. She will be a big loss. The food was exceptional; I chose the salmon bowl - very tasty and generous portion. Would highly recommend this experience and look forward to a return trip.

site_logo

608carolynp . 2024-04-07

MORE AT TripAdvisor

Brilliant service from Maja and Sophia, will be back again!

site_logo

Kam . 2024-04-06

MORE AT Google

Came for a bottomless brunch for my friends birthday. Food and drinks were all unreal and amazing service from Maja.

site_logo

Sophia Sharp . 2024-04-05

MORE AT Google

My waitress Sophia was so attentive and welcoming will deffo be back again !!

site_logo

Maya Jach . 2024-04-05

MORE AT Google

Went for bottomless brunch early on a Thursday, we were the only ones in the restaurant as a table of 4 but my word, Lauren and David were the perfect hosts!! Jim cooked our delicious food and we were never without a drink (triple parked at times!). Thank you so much for an amazing experience we loved it

site_logo

Rachael Harrison . 2024-03-28

MORE AT Google

Bottomless brunch with David and Lauren as servers. Had to ask for both names as it was truly phenomenal service. Incredible work by all staff.

site_logo

Sean Garmory . 2024-03-28

MORE AT Google

Mia our waitress was a fantastic hostess and made sure we felt very attended to. Food was lovely and drinks were flowing a fantastic visit

site_logo

Jayne M . 2024-03-23

MORE AT TripAdvisor

Mia was an outstanding waiters and the bottomless brimuch so tasty. Really recommended. Lovely choice even though vegetarian

site_logo

Michelle B . 2024-03-23

MORE AT TripAdvisor

We had a bottomless brunch for a friends birthday and the service was great from start to finish. Our waitress Martyna was very attentive, keeping our drinks topped up and she was so friendly.

site_logo

niamh m . 2024-03-17

MORE AT TripAdvisor

We did bottomless brunch yesterday for my friends birthday and the service was amazing! Martyna was our server and we had the best experience!

site_logo

Abeatiie34 . 2024-03-17

MORE AT TripAdvisor

Went for bottomless brunch had an unreal time. Had Sophia as our sever and she was amazing so attentive 10/10 food was great aswell!

site_logo

Harris C . 2024-03-09

MORE AT TripAdvisor

Absolutely fantastic bottomless brunch. Thanks so much to Maja and David for a great service

site_logo

Katie Davison . 2024-03-09

MORE AT Google

I had brunch here, it was amazing, lauren done our service and she was so welcoming and kind, would recommend this place to anyone.

site_logo

Kaya Jach . 2024-03-08

MORE AT Google

What a lovely experience , Lauren was amazing so attentive and fun :) thank you Lauren and the team

site_logo

Martyna Stachura . 2024-03-08

MORE AT Google

Did brunch in Aveika, the drinks were absolutely amazing and came so fast, Lauren was doing our service, she was so welcoming and lovely.

site_logo

Kaya J . 2024-03-08

MORE AT TripAdvisor

Booked late night brunch for a birthday, we got a sharing platter between 3 that didn’t even have enough portions for 3 people. This included 2 prawn skewers, 4 chicken strips, 5 spring rolls and a small portion of chips, we weren’t asked if we wanted to order anything else or if it was ok, the platter just came. Definitely not worth the £50 each we paid. Drinks came in jugs which was also disappointing for a bottomless brunch. We ordered birthday desserts whilst booking that we didn’t receive, which we mentioned on the way in.

site_logo

XX . 2024-03-06

MORE AT Google

a group of me and my friends visited here for a bottomless brunch and let me start by saying one of our servers, Alliyana was brilliant and i can’t fault her! However, after spending almost £300 here one of my friends overheard 2 of the staff talking about how ‘the group of girls here think they’re something special when they’re in fact they look cheap’ one of these men was called david i believe and he had actually been serving us alongside the other server. after hearing them say this my friend questioned if they were speaking about us in which they replied ‘of course not’ but there were no other groups of girls in the restaurant that it could be about. in addition to this the bouncer on the door was also very aggressive towards us whilst we were waiting for a taxi in the doorway as it was raining. very disappointing experience when we were celebrating 2 of our friends birthdays. on a positive note the food and drinks could not be faulted!

site_logo

oliviadN9709WZ . 2024-03-02

MORE AT TripAdvisor

Bottomless brunch very sneakily served cocktails forgetting the alcohol. We complained and then told us we had to give our table up to wait in the bar for fresh drinks.

site_logo

Amanda and Milo . 2024-03-02

MORE AT Google

Came to bottomless brunch, had one drink in 45 mins, had the mini sliders which smelt of fish and sushi, was not satisfied with my service at all, the waitress’ were rushed and felt like they didn’t know what they were doing. Asked repeatedly for a new round of drinks which were the exact same as before as you have to pre order and took 40-50 mins to come, very dissatisfied as this was meant to be a great place. I would not return for even casual drinks or an occasion!!

site_logo

Tilly Robinson . 2024-02-24

MORE AT Google

Booked for a corperate event and staff were amazing

site_logo

Alexander Emmerson . 2024-02-23

MORE AT Google

Hmmmm what to say. Our server was so nice and helpful and patient as there is a lot on the menu to understand. Me and my wife so wanted this to be her perfect venue for an anniversary dinner and having read the booking information regarding their rules regarding dress code etc we hoped for the best. Safe to say the whole experience was ruined by groups who don't seem to know the difference between a restaurant and the football terraces. The noise, language and increasing drunkedness were just totally unacceptable. Food was OK but for vegetarians, no protein so basically - vegetables.

site_logo

Mountainathlete . 2024-02-23

MORE AT TripAdvisor

Highly recommended we had a bottomless Prosecco lunch The food was lovely I had the fish and my wife the meat both were very tasty Our waitress Mia deserves a special mention so friendly and very efficient she made our day We will definitely return

site_logo

geordieginge . 2024-02-21

MORE AT TripAdvisor

Everything was perfect, food was gorgeous. Came from middlesbrough and wasn’t disappointed. Staff were so lovely! Definitely be back soon. Thank you :)

site_logo

Anem Sharif . 2024-02-15

MORE AT Google

Went for Valentine’s Day, the set menu of 3 courses for £20.95 was amazing. Good portions, tasty food and the customer service was fab from the staff. Will definitely be visiting again

site_logo

Sophie Whitehouse . 2024-02-14

MORE AT Google

Alliana, David and Rachel Staff/chefs made the evening. It was what I expected, and went above and beyond, I thanked them so much and they made my night and my girlfriend, very special. Very much like to come back again. They are a credit to the team.

site_logo

camerona331 . 2024-02-14

MORE AT TripAdvisor

I went to Aveika Restaurant today as part of #NE1RestaurantWeek and was not disappointed. Delicious food. Lovely venue and very attentive staff. Can't wait until my next visit.

site_logo

Amanda Dixon . 2024-02-13

MORE AT Google

I was here on Saturday for bottomless brunch and have to say I couldn’t fault it at all. The food was amazing, we both had the duck bowl and absolutely loved it. Sophia was our waitress and made the whole afternoon amazing, nothing was too much and we were never left waiting for a drink. She was delightful and made us feel very welcome. We will definitely be returning soon!

site_logo

ross b . 2024-01-29

MORE AT TripAdvisor

Beautiful food and lovely staff.

site_logo

Florence Deputron . 2024-01-25

MORE AT Google

Visited Aveika on Thursday for the restaurant week offer. Service and food amazing throughout. Lauren provided us with everything we needed and more. Will definitely be coming back!

site_logo

anonymous123239 . 2024-01-21

MORE AT TripAdvisor

Food was lovely, staff were excellent. Well priced on the restaurant week menu but I also think that the main menu was fairly priced for the quality. Just found the music a bit loud and club-like for a relaxing lunch. Uncertain if I'd return for this reason.

site_logo

Janette Campbell . 2024-01-20

MORE AT Google

I went here with a group of friends on the 10th of jan for my friends birthday. The customer service was disgusting. I think are servers name was maya, she was rude and disrespectful and felt like she didn’t want to be there. Wasn’t a pleasant experience. Really need to improve her customer service skills.

site_logo

jasarms123 . 2024-01-18

MORE AT TripAdvisor

I came with a group of friends on the 13th of jan and the customer service was horrible and distasteful. The server had a bad attitude and always looked miserable. I think her name was mya/maya. Would’ve put 0/5 stars if it was possible - not a good experience!

site_logo

Rachel S . 2024-01-18

MORE AT TripAdvisor

Bottomless brunch was amazing. Sophia was so fast with the drinks and so polite. Gave us everything we needed. Great service and amazing food

site_logo

jessica b . 2024-01-06

MORE AT TripAdvisor

It's a great Japanese restaurant with excellent food. All the staff were very friendly. The interior of the restaurant is quite stunning. Dave helped me with the booking and Maja and Martyna looked after us and kindly boxed up our food, we simply couldn't manage...

site_logo

_lukeross0 . 2024-01-01

MORE AT TripAdvisor

Beautiful beautiful time for Christmas lovely scenery food amazing. Martina was the best. Love the chandelier in the room very vibey

site_logo

Daydream12667573050 . 2023-12-22

MORE AT TripAdvisor

The staff especially Martina where so friendly, continually checking we were ok and asking if we would like more drinks, would 100% recommend.

site_logo

_Daisy_H_76 . 2023-12-22

MORE AT TripAdvisor

Thoroughly enjoyed our bottomless brunch for my daughters 21st birthday. Food was excellent and drinks kept flowing. Even though they were extremely busy staff couldn’t do enough for you. Brilliant experience would definitely recommend and go back.

site_logo

June G . 2023-12-21

MORE AT TripAdvisor

To loud music for our taste. Good food, but drinks were not up to par.

site_logo

Vidar Lunde . 2023-12-21

MORE AT Google

Great service and great food, Martyna really looked after us. Small plates menu was just perfect for two persons. Enjoy

site_logo

I6382VQmattb . 2023-12-20

MORE AT TripAdvisor

Amazing service and food! Lovely atmosphere x

site_logo

Cleo Rimmer . 2023-12-17

MORE AT Google

The atmosphere is electric , time is 25 minutes faster in there, i check my time and i dont know have been there for long, music is a food to the soul ,their dj chef knows so well about cooking.

site_logo

Kolawole Ajao . 2023-12-17

MORE AT Google

Last night I had the pleasure of a meal with my friends in the restaurant followed by drinks up in the mezz after. I couldn’t fault one part of the night, door staff were polite, bar staff were quick, the food was gorgeous & having the upstairs area booked out for our party was a lovely atmosphere- it felt as if we had the whole place to ourselves! I would very much reccomend if you are looking to book for an event/ party/ celebration!!!

site_logo

Erin Parker-Taylor . 2023-12-16

MORE AT Google

Excellent food and serve from staff, David has been extremely helpful and couldn’t do enough for us during our visit! Highly recommend Aveika!

site_logo

Madeleine O . 2023-12-16

MORE AT TripAdvisor

Couldn’t recommend Avekia enough - especially if you’re looking to book for a meal/ drinks (or both!) for any kind of event or celebration. I had a Christmas party with my friends last night with food & drinks and the night couldn’t have went any...

site_logo

Erin P . 2023-12-16

MORE AT TripAdvisor

Sadly cant remember name of the manager in the restuarant.. think David. He went above and beyond to find fever tree tonic for me. I was impressed. I should have written an email to say that I thouhht he waa very attentive to the cistomers and hope will go a long way in the industry!!!! He stood out. 1/12/23

site_logo

Elizabeth Swanwick . 2023-12-13

MORE AT Google

Similary restaurants in North East

restaurant_img
4.2

1145 Opinions

location-icon69 Grey Street
Japanese
outdoor_seating_214683takeaway_214683delivery_214683

Lovely food and great friendly service.

restaurant_img
4.3

1271 Opinions

location-icon45 Bath Lane
Japanese
outdoor_seating_85977takeaway_85977delivery_85977

Vine aquí por el cumpleaños 18 de mi hija solo éramos 5, y el servicio fue absolutamente terrible. Nunca he recibido un servicio tan malo, la camarera fue tan grosera. En cuanto a las bebidas pedimos vodka arándano rojo dos veces, y en ambas ocasiones fueron devueltos ya que no había vodka en él. La segunda vez la camarera discutió con nosotros y dijo que lo hizo ella misma y que definitivamente era un vodka doble (todos en nuestra fiesta probaron este “vodka cranberry”). Luego procedió a traer un vodka doble a mi hija de 18 años para que lo oliera, y luego lo vertió en la copa que ahora se convierte en un vodka cuádruple. En esencia, ella ya puso un doble, sin embargo, literalmente se podía simplemente probar el vodka en este punto. La comida no podía culpar era hermosa y abundante, compromiso / entretenimiento estaba en el lugar.

restaurant_img
4.3

4740 Opinions

location-iconFenwick
Japanese
outdoor_seating_85989takeaway_85989delivery_85989

the staff here went above and beyond to ensure i managed to get ahold of some high in demand product i was struggling to find which was extremely wonderful customer care and service, so thank you very much toy team!

restaurant_img
4.1

632 Opinions

location-icon14 Leazes Park Road, Newcastle upon Tyne NE1 4PF England
Japanese
outdoor_seating_275207takeaway_275207delivery_275207

Went here on a weekday and the service was quite slow & we didn’t get things easily with having to ask the waitress multiple times for things which kinda tainted the really good food we ate. But we went back with high hopes on the weekend and the service was FAB! And the food was delicious!

restaurant_img
4.0

529 Opinions

location-icon139-141 Grainger Street
Japanese
outdoor_seating_238679takeaway_238679delivery_238679

Good variety of food. Can’t expect too much for a takeaway standard. Overall fresh and delicious. Would come back again.