GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.8

Based on 3.022 opinions finded in 2 websites

site_photo4

Nº 400 in 488 in Derbyshire Dales

Nº 113 of 134 Other cuisines in Derbyshire Dales

CUSTOMERS TALK ABOUT DISHES WITH..cheesepuddingporkcoffeesteakchickencookedsandwichsaladmeatpaycreampieroastfish

comment_iconOpinions

Top❤️👍to sean .m. and isobel. Chris and monique vom holland

site_logo

Monique Van der Meer . 2025-04-08

MORE AT Google

The food is amazing! The new garlic bread tear and share is phenomenal, the best we’ve had! The burgers and chips are cooked to perfection. The atmosphere is so cosy and the staff are unbelievably welcoming. A great spot in Bakewell

site_logo

Max Lamb . 2025-04-04

MORE AT Google

Despite it being mother's day the service was excellent. We also took three dogs with us who also greatly enjoyed the visit.

site_logo

Peter Blackwell . 2025-04-02

MORE AT Google

Can't fault this establishment in anyway what so ever. We have been here 3 times now for a lunchtime snack whilst enjoying a day out in Bakewell Fast service Kitchen Staff do a great job Always look forward to our next visit.

site_logo

Jack Peters . 2025-04-01

MORE AT Google

Having placed our order,for 6 persons, we were informed it would be 40 mins. No worries at that point. After an hour I went to enquire when it was coming, few people left on the restaurant and I believe people ordering after us had been served. The meals then came within 3 mins 🤔. The burgers peas and chips were all dried up. The fish was nice but chips do dried up they were inedible. The only meal not dried up was a Sunday pork roast which my wife left half because she wasn't enjoying it. The ki ids even left their fries, which is unheard of. I voiced my concerns to be told they had been very busy. Very unimpressed, which is a shame as last time it was very nice

site_logo

Peter Marsh . 2025-03-30

MORE AT Google

Amazing service and food. They very kindly fit us in, on Mother’s Day, with no reservations. Eliza was kind and attentive with not only us, but our young sons too. We will absolutely be back, thank you very much

site_logo

Freya Primrose . 2025-03-30

MORE AT Google

Wonderful Mother's Day experience, Charlotte was fantastic; extremely attentive and super friendly. Thank you!

site_logo

Chris B . 2025-03-30

MORE AT Google

Great service by Charlotte. Thank you 😊

site_logo

Natalie Stevenson . 2025-03-30

MORE AT Google

Charlotte was absolutely fantastic and made our dining experience complete.

site_logo

Lee Scothern . 2025-03-30

MORE AT Google

Food was fab, staff friendly (Charlotte was amazing!) and really enjoyed a lovely Mother’s Day meal with the family. Thank you.

site_logo

Chris Glossop . 2025-03-30

MORE AT Google

Lovely Mother’s Day lunch. Great service, great atmosphere as always

site_logo

Sarah Campbell . 2025-03-30

MORE AT Google

Amazing food and service from Charlotte

site_logo

Felicity Birch . 2025-03-30

MORE AT Google

Had a great time, my wife really enjoyed her Mother’s Day meal and got a free cupcake for after! Nice meal, great service 👍 Server was Alisa!

site_logo

Aidan Smeaton . 2025-03-30

MORE AT Google

Great service, Eliza was great, brilliant food, would recommend!

site_logo

Kim Ottaway-Foster . 2025-03-30

MORE AT Google

Eliza was amazing. Such a fun place to have Sunday lunch. Thank you.

site_logo

Alan Wells . 2025-03-30

MORE AT Google

Roast veg was very much overcooked. Serving size was a bit small for the price. However service was great. Charlotte was lovely.

site_logo

Sarah Prattley . 2025-03-30

MORE AT Google

Amazing food and brilliant service!! Eliza was lovely :)

site_logo

Kelsey G . 2025-03-30

MORE AT Google

Excellent food and very quick service

site_logo

Nicola McArdle . 2025-03-30

MORE AT Google

We had the braised beef shoulder and the pork cutlet. Both extremely tasty and cooked very well by Sean M who even came out to check with us, and the service from Lee made us feel very welcome

site_logo

Kev n Denise . 2025-03-29

MORE AT Google

Lovely food and service from Charlotte

site_logo

Chelsea Bamford . 2025-03-29

MORE AT Google

Charlotte was a fantastic waitress, we had the fish and chips and the battered fish sandwich. It was all great!

site_logo

Steven Hayward . 2025-03-29

MORE AT Google

Food was fantastic, Henry couldn’t do enough for us, will be back again

site_logo

Andrew Stevenson . 2025-03-29

MORE AT Google

Staff were very friendly and helpful. Food was a mixed bag - fish and chips were nice, but club sandwiches were a bit dry (and intentionally cold, but we had wrongly assumed they would be warm).

site_logo

Alec Storey . 2025-03-24

MORE AT Google

Went on a Sunday. Was getting busier (we arrived at midday) but enough tables and greeted promptly on arrival. Can't fault the waiting staff - friendly and did their job. We had been previously and liked the menu and availability of gluten free so returned expecting the same. This time we were offered the Sunday menu. Lots of acronyms but no explanation of what they were (vgo, gfo) . Staff did make the effort to find out what vegetarian coeliac could eat from the menu (disappointingly, nothing) and was offered burger or sausages as the Sunday lunch. Good - thank you. Partner and I chose the parsnip tart (we are vegetarian). I was a bit shocked when my food arrived. Where was the tart??? I don't think I have been served up such a disappointing vegetarian option (forgetting the straight from the freezer vegetarian lasagna episodes) since the early 1990s. I could see some cooked pasty and some parsnips. Was this the tart? Apparently so. Oh dear. My heart sank. Our son works in a similar establishment so I would like to be sympathetic. It's a busy establishment. All eateries are struggling and I know recruitment, particularly in kitchens, is difficult. However ..... Vegetarians don't just eat vegetables. I like a bit of protein with my meal. And flavour. The Yorkshire puddings was a victim. And I prefer gravy on the side (so I don't have to have it). We were asked to leave a five star review by one of the waiting staff. You did a reasonable job but I felt a bit uncomfortable at the request.

site_logo

Queen Fnaar . 2025-03-24

MORE AT Google

A really lovely meal after a walk along the Monsal trail - the Wheatsheaf was the perfect place for a family get together and beautiful Sunday roast! Lee was so attentive to our pre order and gave us a warm welcome - and Jake was so brilliant at making sure we had everything we needed, including a birthday Bakewell pudding! Thank you for a great time, we will be back again.

site_logo

Jessica Williams . 2025-03-24

MORE AT Google

Eliza was a lovely server, very friendly and accommodating

site_logo

Charlotte Isabel . 2025-03-23

MORE AT Google

Really lovely pub, great food and great service from Eliza too!

site_logo

Maija Potts . 2025-03-23

MORE AT Google

The Sunday roast was delicious- great food and great atmosphere. Our waitress Eliza was also amazing

site_logo

Saskia Potts . 2025-03-23

MORE AT Google

Eliza was lovely. Food was amazing

site_logo

Jess Miles . 2025-03-23

MORE AT Google

Great roast and amazing service from Eliza

site_logo

Freya Potts . 2025-03-23

MORE AT Google

The food at The Wheat-Sheaf was absolutely brilliant—every dish was cooked to perfection and bursting with flavour. The experience was made even better by Eliza, whose service was outstanding. She was attentive, friendly, and ensured everything was just right. Highly recommended for a fantastic dining experience!"

site_logo

Jlowe1 . 2025-03-23

MORE AT Google

Food was exceptional the gravy was lovely! Great service from Elisa thank you ☺️

site_logo

Jenna Baker . 2025-03-23

MORE AT Google

The person behind the bar 22.03.25 who had a smart shirt and short cropped beard is so rude! I ordered drinks and not one word from him - never even asked if wanted ice and slice etc and then when coming to pay just thrust the card machine to me and didn’t even show me the cost - miserable as hell.

site_logo

Christian Ellwood . 2025-03-22

MORE AT Google

Jacob was great and attentive. Atmosphere was warm and welcoming

site_logo

William Hamilton . 2025-03-22

MORE AT Google

We dropped in for some dinner on Saturday evening after finding the pub on a walk earlier. We were shown a nice table and our meal was served in good time. I had a burger which was really good but the fries had been overcooked, I didn’t eat many of the fries, my partner’s chilli pasta although tasty was a small portion. As we finished the first server asked if our meal was OK and I mentioned that I wasn’t happy, he apologised and left. The second server who had brought our food out asked about the meal, he was very understanding and offered us a complimentary dessert or drink. We just felt a bit disappointed that a mostly good evening was spoilt by our meal which we were really looking forward to enjoying.

site_logo

Ian . 2025-03-21

MORE AT Google

We got married March 2025 lucy was great gave me all the information on what they could do for us we had a buffet in the afternoon the food was great plenty for everyone a nice big table in the backroom thankyou everyone at the wheatsheaf we had a fabulous time .

site_logo

Rosie Fletcher . 2025-03-19

MORE AT Google

Excellent service from Sean M Lovely and friendly Very attentive Thank you Sean M

site_logo

Evie Davies . 2025-03-16

MORE AT Google

Very pleasantly surprised, stumbled upon this lovely pub after walking for ages in the cold looking for somewhere to eat. We were greeted immediately when walking in by Jacob who was professional and welcoming. You order at the bar. It was busy but not heaving. Vibe is gastro pub. Food portions are absolutely huge, so you get what you pay for! Food was tasty and reasonably priced. Jacob was attentive without being intrusive. Would definitely come back here again.

site_logo

Jayjay Kumar . 2025-03-15

MORE AT Google

Great food freshly cooked and staff very friendly and polite

site_logo

Frank olley . 2025-03-11

MORE AT Google

Food wasn't great, gluten free bread was awful. Food took over 45 mins to be brought out to table, although staff were apologetic, no gesture of goodwill offered. Wouldn't bother, if you wanted a nice pub lunch I'd find somewhere else!

site_logo

Natalie . 2025-03-11

MORE AT Google

After a pleasant cycle along the Monsal Trail, this pub looked just the ticket. The welcome was warm and friendly with both the barman and waiting staff eager to please. The battered fish fillet sandwich was spot on with a good portion of crisps and salad nicely dressed. All washed down with an expertly poured Guiness Zero. Thanks for the pouring tip barman! Next time I’ll be sure to catch your name.

site_logo

Darren Hodgson . 2025-03-11

MORE AT Google

Jacob was very friendly, all the staff were!

site_logo

Jackie Hardy . 2025-03-08

MORE AT Google

Jacob was very friendly, food was lovely would definitely recommend!

site_logo

Georgia Barrett . 2025-03-08

MORE AT Google

Great food & excellent service from Jacob

site_logo

Katie Vickers . 2025-03-08

MORE AT Google

Jacob is a brilliant member of staff who was very attentive. Food was good although quality oil on mezze platter could've been better. Otherwise pleasant experience with lovely staff. Fish and chips looks amazing (ordered by other customers).

site_logo

Clara Halas . 2025-03-08

MORE AT Google

A lovely pub with great food and amazing staff, Jacob in particular was so lovely and welcoming.

site_logo

Billie Eades . 2025-03-08

MORE AT Google

Great place for a meal and a beer. Dog friendly too.

site_logo

Garry Knight . 2025-03-05

MORE AT Google

Pretty good place to eat in Peak district. Bit expensive but the food is lovely.

site_logo

Rohan jain . 2025-03-04

MORE AT Google

Nice large, comfortable dog friendly pub. The staff were friendly and welcoming and the food was good. Overall the place had a nice atmosphere.

site_logo

Giveup52 . 2025-03-03

MORE AT TripAdvisor

Ordered beef ragoût when it came it was a very large portion. I was expecting chunky shredded pieces of tasty beef in a rich flavoursome sauce. With a nice tasty piece of garlic bread. Instead I was brought a great big plate of mince meet which was tough and tasteless I a sauce with loads of pasta. And a piece of garlic bread that did not taste garlicky at all but was full of oil greasy and tasteless. I would have been happier with a much smaller portion of tasty quality food . As I paid £18.00 for this which is not cheap. The place itself is really nice and comfortable to sit in and the staff and service was good . The food let it down very disappointing.

site_logo

Dawn T . 2025-03-02

MORE AT TripAdvisor

Excellent dog friendly pub. Great food.

site_logo

Cath Tyler . 2025-03-01

MORE AT Google

A lovely establishment Beerngood and not over priced at £5.50 Arrived at 4.30pm Only about 4 people in bar Yet bar person didn't make any attempt to clear dirty tables of food or clear glasses from outside Our table (6) hadn't been wiped from previous occupants Such a shame

site_logo

Russ Martin . 2025-02-27

MORE AT Google

Fantastic ale and caring staff who regularly welcome you with a smile and quick to serve.

site_logo

S Miller . 2025-02-15

MORE AT Google

OMG what a meal!! We had the Valentine's platter and it was incredible. Beef croquet, steak, crab thermidor, oysters, prawns, scampi and bread and roasted potatoes.. all cooked to perfection and more flavour than you can wave a stick at! It's 5* cos that's all the scale went up to :) Tom, the Sean's and a personal handshake from the chef all made for an amazing meal!

site_logo

Daniel Kerr . 2025-02-15

MORE AT Google

Amazing place would recommend food is gorgeous and staff are fantastic especially Sean thanks we will be back 😊

site_logo

Stefanie Hudson . 2025-02-15

MORE AT Google

We had avacado on toast this morning. I don't think I've ever been more shocked at the quality and presentation. 2 slices of supermarket brown bread, cut into half triangles and a mashed avacado dumped on top. Maybe a touch of chilli. I would never serve this to my customers, I would be embarrassed. My comments may seem harsh but I paid £8 each for about £1 worth of food and zero effort. I'm angry with myself for not complaining. The chef completely took the xxxx Never again. Look on Tesco cafe website. Look up avacado on toast. For a supermarket cafe their attention to ingredients and presentation is 1000% better.

site_logo

Linda Linda . 2025-02-08

MORE AT Google

Thomas was friendly and helpful.

site_logo

Valerie Murray . 2025-02-06

MORE AT Google

Lovely lunchtime food, visited her on a day trip to Bakewell , nice clean place , food fresh and tasty, had a cheese and pickle sandwich each with chips to share

site_logo

Gina S . 2025-02-05

MORE AT TripAdvisor

Had a family lunch here and food and service was great. Lee in particular was very helpful and knowledgeable with food and drink choices. Will be returning

site_logo

Tracey S . 2025-02-05

MORE AT TripAdvisor

Delicious tasty food, good portions and excellent service. Clean and comfortable in centre of Bakewell.

site_logo

Gillian Wilson . 2025-02-04

MORE AT Google

Jacob was very welcoming and made this experience more enjoyable. We were worried at first because the bar staff were particularly rude whilst ordering our food and buying drinks. The food was underwhelming and very greasy.

site_logo

olivia ford . 2025-02-02

MORE AT Google

Jacob / sean / Tom , Just beautiful folks - come on in . It’s the best atmosphere in bakewell . Just perfect

site_logo

Jason T . 2025-02-02

MORE AT Google

Giant Yorkshire pudding filled with beef and veg for lunch. Epic portion size with more than enough to share.

site_logo

James Pearce . 2025-02-02

MORE AT Google

Experience was made better thanks to Jacob. He was very friendly and welcoming!

site_logo

Nicole Megan . 2025-02-02

MORE AT Google

Lovely food and great service from Jacob

site_logo

Alice Elizabeth . 2025-02-01

MORE AT Google

Fantastic pub/restaurant within Bakewell, the food and service is always excellent when we come here and they have a good selection of drinks too. Jacob was very accommodating and found us a table despite it being really busy.

site_logo

C F . 2025-02-01

MORE AT Google

Cozy, Great food. Definitely recommend the Braised Beef Shoulder. Jacob was pleasent and attentive

site_logo

Allan Garside . 2025-02-01

MORE AT Google

We were serve by Jacob. Had a wonderful meal, the gluten free option for the burger was really nice.

site_logo

Ben Stoner . 2025-02-01

MORE AT Google

Was brilliant service. Jacob is always so lovely when we come in as are the rest of the staff

site_logo

Talia Herron . 2025-02-01

MORE AT Google

Jacob our server was so friendly and nice - food was amazing and the cosy atmosphere perfect for a cold Saturday lunchtime - thank you 😊

site_logo

Karen Porter . 2025-02-01

MORE AT Google

Great food and service by Jacob

site_logo

Sofia Bernhardt . 2025-02-01

MORE AT Google

Fantastic breakfast on cold January morning . You can’t ask for much more - delicious breakfast, lit up fire , gorgeous espresso and very friendly and welcoming staff . Thank you !

site_logo

milena bailey . 2025-01-26

MORE AT Google

Really enjoyed our lunch here today,food was super tasty along with a decent selection of beers. Spotlessly clean and very attentive staff. Great work guys 👍

site_logo

Andy Hoops. . 2025-01-20

MORE AT Google

we arrived 12:40pm on friday, it was almost empty. we ordered fish and chips, beef ragu, tomahawk pork cutlet, chicken sandwich, all meals were tasty and in generous portion.

site_logo

WaiTak Chao . 2025-01-17

MORE AT Google

The food was amazing, definitely recommend the southern fried chicken burger. Service was great from Lucy, Tom and Sean. Will definitely return on my next visit to Bakewell. Well worth a stop when visiting the town.

site_logo

Tom Verity . 2025-01-15

MORE AT Google

I came into the pub on 13th January around lunchtime and the service was incredible. As a visitor to the area looking forward to having some food after a long hike this pub offered exactly what I needed. The staff were amazing, Lucy, Sean and Tom were so lovely and the food was fantastic!! I had the pesto and mozzarella sandwich as well as a crumble with cinnamon custard which was simply to die for!

site_logo

Lillie . 2025-01-15

MORE AT Google

It was an extremely busy Saturday lunchtime and terrible weather and we felt lucky to find the Wheatsheaf able to fit in six adults, a two year old and a baby in a pram. We all enjoyed our lunch and thought the staff were very welcoming. We would like to mention in particular Henry who was extremely courteous and kind to us.

site_logo

1418sja . 2025-01-14

MORE AT TripAdvisor

Beautiful meal and amazing service.

site_logo

Rebecca Bowering . 2025-01-11

MORE AT Google

Food was spot on and the waiter Charlotte was amazing

site_logo

Sam Nolan . 2025-01-11

MORE AT Google

Food was excellent, Charlotte was super friendly, she was attentive without being pushy and she made our visit brilliant - Thanks Charlotte?

site_logo

Olive . 2025-01-11

MORE AT Google

Food ok waited 45 mins between each course nice staff

site_logo

Krystyna Bolton . 2025-01-08

MORE AT Google

Great food great service friendly staff with a nice cozy atmosphere

site_logo

Carol Vale . 2025-01-06

MORE AT Google

Booked a table as requested online. However, when we arrived, we were seated in the bar area apposed to the restaurant area round to the back. Despite this, the bar was relatively quiet. The food was cooked to order, can highly recommend the steak pie, which my wife thoroughly enjoyed. I had the fish and chips, the fish was larger than expected, and tasted great, the only let down was that the batter was a little greasy on the underside, overall though a decent meal.

site_logo

Dave Williams . 2025-01-05

MORE AT Google

We have been here many times and love the pub for the food and the atmosphere. We were greeted and served by Charlotte and received excellent service. Would highly recommend this pub if you visit Bakewell.

site_logo

David Hicks . 2025-01-05

MORE AT Google

Great food and service with a smile from Charlotte

site_logo

Val Baker . 2025-01-05

MORE AT Google

Lovely food and service! Charlotte was brilliant and checked on us to make sure we were enjoying it all. Would recommend to anyone!

site_logo

Josh Carter . 2025-01-05

MORE AT Google

Food was lovely, Charlotte, our waitress, was wonderful! Definitely recommend!

site_logo

Shannon Allen . 2025-01-05

MORE AT Google

Excellent service from Charlotte and Lucy, really good food and we definitely recommend the veggie roast! Will definitely be back next time we’re in Bakewell!

site_logo

James Bentley . 2025-01-05

MORE AT Google

Good food, great service from Charlotte!

site_logo

Jonathan Cook . 2025-01-04

MORE AT Google

An order of soup, sandwich and a side of chips took 45 minutes! Had to go and ask, and then they said it would be 5 minutes more. "We need to plate the food." After 10 more minutes they brought some of the order. Had to ask again for the soup. How hard is soup: just ladle it into a bowl! Have to say, the food was good, and the staff all apologised, but still. Just say up front if there is a long delay.

site_logo

James Linderholm . 2025-01-04

MORE AT Google

I had a fantastic experience at this establishment. The food choices were plentiful and the meal I had was delicious. A particular standout was a member of staff by the name of Charlotte. Charlotte exceeded all expectations by provided exceptional service. Nothing was too much to ask and she added to the experience. 5 stars to the pub and 5 stars to Charlotte!

site_logo

Richard Burns . 2025-01-04

MORE AT Google

We ordered 8 meals and to be honest it was terrible all food was cold no taste clearly cheap food at high prices KEEP AWAY PLENTY OF OTHER PLACES IN THIS AREA

site_logo

Jeff W . 2025-01-03

MORE AT TripAdvisor

Everything about our visit was fabulous. Everyone was warm and friendly - Eliza especially. Our meals were absolutely delicious - would definitely recommend a visit. Dogs are welcome.

site_logo

Lorraine Stanhope . 2025-01-02

MORE AT Google

Great food and friendly service in a lovely location and at a fair price. Breakfast and evening meals were excellent.

site_logo

Leigh Harper . 2025-01-02

MORE AT Google

amazing service, especially from Eliza!

site_logo

Jess Minto . 2025-01-02

MORE AT Google

Had an awful experience at The Wheatsheaf Pub and Pantry in Bakewell today. I’ve visited a few times before because it’s easily accessible, but this visit was a complete nightmare. I only wanted a drink with my family, and yes, it was busy, but both members of the bar staff saw me waiting with my mum and still decided to serve people who arrived after me. The only conclusion I can draw is that it’s because I’m a wheelchair user. What made it worse was that they made eye contact with me and then carried on ignoring me. It was degrading and made me feel less than human. If you’re a wheelchair user, I’d strongly suggest avoiding this place. The staff were rude and ignorant, and they completely ruined our family day out. No one deserves to be treated like that. __________________________________ I'm adding a reply to Tom's comments here because Google doesn't give you that option: Hi Tom, Thanks for getting back to me. I just want to be clear about a few things. Since the initial email from management, I’ve tried to arrange a phone call, but I’ve been completely ignored. It honestly feels like that first emails I received back were just lip service, and I’m not convinced the training you mentioned will actually happen. What’s even more frustrating is that the same staff member who ignored me on Boxing Day had done the same earlier in the year when the pub was much quieter, but I didn't think much of it the first time. Busy or not, there’s absolutely no excuse for ignoring me simply because I’m a wheelchair user. If you look at the CCTV again, you will see that a group of 5 people walked in off the street and were served straight away, one in th group was a woman in a white/cream coloured coat, with blonde hair. To then have my follow-up email ignored just shows that accessibility really isn’t a priority for the pub, management, or certain staff members. If someone had replied to my last email, I wouldn’t feel this way now. I hope you’ll take this on board and make some genuine changes because it’s not just about me, it’s about ensuring everyone feels welcome and valued when they visit.

site_logo

Lisa Varty (LiV1084) . 2025-01-02

MORE AT Google

Food was very nice and arrived quickly, Charlotte was very helpful

site_logo

Adam Hartshorn . 2024-12-31

MORE AT Google

Food was absolutely exceptional and charlotte was a fantastic host! Very accommodating and friendly!

site_logo

Sarah . 2024-12-31

MORE AT Google

Landlady was very warm and welcoming. The staff were friendly and helpful. The food was outstanding in quality and portion size. Would definitely recommend to anyone visiting the area.

site_logo

Beverley Whiting . 2024-12-31

MORE AT Google

Super food and service on New Years Eve - and Charlotte is an absolute star!! Thank you so much for making our visit to Bakewell so special!

site_logo

John Heap . 2024-12-31

MORE AT Google

Similary restaurants in East Midlands

restaurant_img
3.8

406 Opinions

location-iconWye House Water Street
Other cuisines
outdoor_seating_207976takeaway_207976delivery_207976

When i came in today, a young lady called Katie? ( i overheard her name so apologies if this is wrong) served me and she was absolutely brilliant , very friendly, polite and helpful. Will definitely be coming back!

restaurant_img
3.9

556 Opinions

location-iconCrown Square
Other cuisines
outdoor_seating_200066takeaway_200066delivery_200066

Had a hot chocolate, and it was disgusting, very weak, and only just warm. The only thing was got lots of cream , not returning in a hurry

restaurant_img
3.6

492 Opinions

location-iconClifton
Other cuisines
outdoor_seating_197528takeaway_197528delivery_197528

A very nice garden centre, just the right size with a range of good & varied products. The restaurant has a good range of hot food,healthy type meals and a large selection of cakes & cookies. Very nice with a lovely view over the countryside from one end of the restaurant and an outdoor dining area at the other end.

restaurant_img
4.0

72 Opinions

location-iconQueen Street
Other cuisines
outdoor_seating_144969takeaway_144969delivery_144969

Called in for an ice cream this afternoon - salted caramel and a bubble gum. Overall quick service and tasted fine.

restaurant_img
4.0

1660 Opinions

location-iconThe Square
Other cuisines
outdoor_seating_213621takeaway_213621delivery_213621

Had dinner here which was very nice.