GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 860 opinions finded in 3 websites

site_photo4

Nº 182 in 330 in Sevenoaks

Nº 1 of 2 Japanese in Sevenoaks

CUSTOMERS TALK ABOUT DISHES WITH..chillinoodlescookedprawnladyspicychickenramenpayduckcurrysquidoldricemustbroth

comment_iconOpinions

I have been coming to Wagamama for years and was in for a poor disappointment during today’s visit. Myself and 3 kids, we asked for tap water when we sat down. With food order I asked for a coke. We got the coke, we got the starter - still no sign of water. I had to ask 3 times. We waited over 30 min for the mains to arrive - my adult meal was served and 3 kids were still waiting for their katsu chickens. I had to ask again. When their meals arrived - we found the usual chicken and veg portion was cut in HALF! The coke that used to come in a bottle now arrived in a can. £3.90 for 330ml of coke. Good days of waga are over. Won’t be returning!!!

site_logo

S.A. . 2025-04-16

MORE AT TripAdvisor

A real drop in quality — disappointing experience I’ve just been to Wagamama and left feeling really disappointed. While the service was friendly and the ambience still enjoyable, the food has gone drastically downhill. What used to be a fresh, vibrant and relatively healthy take on Asian-inspired dishes has now become something completely different — greasy, overly fried food that tastes like it’s come straight from the freezer into a deep fryer. It’s a real shame because Wagamama used to stand out for its freshness and quality. Somewhere along the line, it feels like a cost-cutting strategy has taken over, and it shows. The ingredients taste cheaper, the preparation seems industrial, and the overall experience just doesn’t reflect the brand it once was. Wagamama still has the potential to offer something great, but not if it continues down this path

site_logo

Filip P . 2025-03-30

MORE AT TripAdvisor

Top place, server called will graham is great guy. Solid meal highly recommend.

site_logo

hugo smith . 2025-03-23

MORE AT Google

Always enjoy visiting Sevenoaks Wagamama food is always great and service too. Always very helpful going through the menu as my partner has a nut allergy

site_logo

carl lynch . 2025-03-15

MORE AT Google

Second time I've ordered via deliveroo. Nearly an hour for delivery and driver waited a while, food has been delivered cold. Second time this has happened. Never again , waste of money

site_logo

P Peler . 2025-02-14

MORE AT Google

Excellent service. Lovely food. Great atmosphere.

site_logo

Peter Brighton . 2025-02-10

MORE AT Google

I lunched here with a family member - the service was attentive and helpful. Prices are are ££ level we both had squid starters that were very good and undoubtedly fresh squid is used - medium sized portions and very tasty and hot. We shared a katsu curry that was ok - I wasn’t keen on the fact that they brought up the main course almost immediately after serving the starters resulting in the main course being warm/tepid by the time we got to it. Starter was more satisfying than the main because of this - green tea is served free and was like warm - I prefer any tea to be piping hot free or otherwise. Having said that I would visit again. I hope this has been helpful and if so please like and follow me and I will follow you back - thank you.

site_logo

Adrian Burch . 2025-01-23

MORE AT Google

Everything was great as usual however one of the servers, when seating customers, took one look at us at the front of the queue and proceeded to seat the couple behind us. I find this unacceptable, especially after making the two of us wait beforehand. I hope this will not happen again to us and to all other customers. The girl who then served us was very nice though

site_logo

Ruiyi Sun . 2025-01-11

MORE AT Google

I didn't know there was a Wagamama in Sevenoaks, so was really happy to find that there is one. We had a lovely lunch - the food was delicious as always, the staff was kind and the atmosphere was lovely. This one is a really nice store, really spacious and not too busy.

site_logo

leuveen . 2024-12-22

MORE AT TripAdvisor

Everything was good but the food was slacking a little of flavour. Everything was a little more bland than the usual Wagamamas

site_logo

Chein Huang . 2024-12-17

MORE AT Google

Three mums with their babies - accommodated for and space found for our three prams. Excellent food and service as always. Alex stood out as being extra accommodating when we were trying to navigate the app but also sort our babies at the same time! He was keen to help and helped us with our technical glitches! Thanks!

site_logo

Tanya S . 2024-12-09

MORE AT TripAdvisor

Absolutely loved dining at this restaurant, the ambiance was warm and inviting, perfect for any occasion. The staff were attentive and knowledgeable, making our experience seamless. The food was outstanding—flavorful, beautifully presented, and truly memorable. A must-visit for food lovers. I can’t wait to return for more!

site_logo

Ishan tejinder . 2024-12-01

MORE AT Google

I had wagamamas for my dinner tonight I had chicken and prawn noddles which I really enjoyed because they were very tasty yummy delicious I really enjoyed every bit of it I ate all of it Which means I definitely enjoyed it for sure You do such lovely food at wagamamas sevenoaks The food is also spot on That was the best noddles I have ever had I like the sauce that goes on it It brings out the best in the food The food gets another 5 out of 5 star rating by me Enjoy reading another google review by me Have a lovely rest of your evening 5 stars all around

site_logo

Charlie Williams . 2024-11-18

MORE AT Google

While the food has recently started to feel oilier and heavier than in the past, it is still delicious.

site_logo

Jessie Bartholomew-Smythe . 2024-11-05

MORE AT Google

Very disappointing that Wagamama Sevenoaks no longer allow you to order a side unless it's attached to a main dish. Not sure we will visit this branch again

site_logo

Mark T . 2024-10-31

MORE AT TripAdvisor

Very disappointing this evening to hear of a rule change at Wagamama Sevenoaks. No longer able to order add ons to your dishes unless it's with another main course. Won't be visiting again

site_logo

Mark Tetley . 2024-10-31

MORE AT Google

Waited over 15 minutes for a pre booked collection. Other food ordered and collected in time now cold. Happens every time with this place. No apologies just made to wait. Food is always good and staff as friendly as they can be.

site_logo

John Mckenzie . 2024-09-07

MORE AT Google

We really enjoy visiting Wagamama as a family. There is something for everyone on the menu and we always enjoy a variety of "starters" and a main each. The service was friendly and food is consistently good.

site_logo

Sarah K . 2024-09-04

MORE AT TripAdvisor

Today was awful. We sat outside because of the weather. The waiters didn’t seem to appreciate the fact we wanted to sit outside… cutlery slung on the table asked for drinks which didn’t turn up we felt abandoned. Last time we came here the guy wearing stripy trousers gave us an amazing service tho so pheraps it’s just the people on todays shift.

site_logo

Frankie Faux . 2024-09-01

MORE AT Google

Foods alright but the service is terrible and there are often waiting times. Most staff seem to be kids from the local school too busy gossiping to serve you. The managers are slightly better but is obvious they can't hire anyone decent to staff this branch. Shame really, I've been to some very slick Wagamamas in the past - but I will never go here if I can help it.

site_logo

James . 2024-08-26

MORE AT Google

It was my first time visiting this branch on my lunch break! I must say Louis’s customer service has been exceptional! He has been been very calm and understanding throughout as well as prioritising my order first as I had very limited time left. Food was very nice too. Thank you once again! Will definitely be coming back here soon and highly recommended this place👍🏻

site_logo

Mabina Miah . 2024-08-22

MORE AT Google

I went there over a weekend for a lunch with my wife and I have been to many wagamama but I didn't like the flavour at this one. I ordered my regular menu but the taste was not good, I am not sure on how it can happen but I was surprised with the flavour. I definitely won't be going there again ever.

site_logo

Nitish Sharma . 2024-07-27

MORE AT Google

We absolutely love Wagamama. We visited the Sevenoaks branch today after years as we usually go to Bromley branch. We had the usual chilli squid. Chicken gyoza, the new rice squares and I tried the new duck dish which was absolutely beautiful however, the portion size of the squid and duck dish were tiny with about 8 pieces of squid. Also my girls had the usual mini katsu the chicken breast was TINY, I did mention it to the waiter and her response was ‘ I can bring you out some more chicken it’s £4 a piece’ I kindly declined! Seriously Wagamama £18 for a small bowl of noodles and a bit of crispy duck. It is a fast food restaurant. I will be going back to the Bromley branch where I hope the portion sizes have remained!

site_logo

Gina MS . 2024-07-25

MORE AT Google

Used to love this place but last 2 visits have not been good. Service poor although restaurant wasn't busy. Food, just as poor, lacking in flavour, steak bad both times, price has gone up but quality has gone right down. I gave it a 2nd chance & left it a couple of months appart, will not go back now. Bromley Wagamama is far superior, Sevenoaks you need to sort it out.

site_logo

Gemma Beech . 2024-07-17

MORE AT Google

Kimchi good, salty edamame fine but ramen disaster. Overcooked noodles, broth absolutely boring... Chicken one ok but beef. Asking that price for such a low quality is not wise. Remember original wagamama ramen was good.... This one is cheap. Staff smiling but meals came 10min from each other... Sorry, not acceptable.

site_logo

Michal S . 2024-07-05

MORE AT Google

Best food ever! I have the chicken Katsu curry and it is amazing!

site_logo

Darcey Penny . 2024-06-18

MORE AT Google

Had high hopes for Wagamama Sevenoaks as my family and I normally go to Bromley. Unfortunately we will not be back, the food was good however the service was shockingly poor. The staff that served us seemed unbothered and the woman I believed was the manager lacked self-awareness as she was having an extremely loud conversation at the table behind us (approx 15 mins) and it dominated the restaurant. It’s lovely to have staff that enjoy their jobs and talking to customers however, not at the expense of ruining other customer experiences.

site_logo

KC12 . 2024-06-02

MORE AT TripAdvisor

Made a quick stop for lunch at this branch over the weekend. I’ve got to say it’s a bit of a hit and miss with Wagamama sometimes but this branch performed well. Food (I’d say Japanese-Thai fusion) was great and customer service is one of the best around- attentive and a friendly lot.

site_logo

Su Vien Y. . 2024-05-13

MORE AT Google

I am not a fan. Was a hit and miss experience throughout our visit.

site_logo

Chris A . 2024-04-28

MORE AT Google

We had another terrific meal at Wagamama this time in Sevenoaks. Food as always was delicious, we were looked after really well and kept a pair of expensive gloves to one side that I had inadvertently left behind. Thank you.

site_logo

James Johnson . 2024-04-25

MORE AT Google

Such a delicious meal and fantastic service from Brad.

site_logo

Kila Wynter . 2024-04-13

MORE AT Google

Great atmosphere and food, amazing service from Bella, she was attentive and communicated well, we got our food fast and with no mistakes. She recommended a fantastic desert too, thank you

site_logo

Julian Szuma . 2024-04-08

MORE AT Google

Good food and cocktails were good too!

site_logo

Kris Nuevo . 2024-03-31

MORE AT Google

Popped into Wagamama today to meet up with friends. Very welcoming staff. Food choice excellent. We were served by Jade. A delightful young lady who was extremely helpful.

site_logo

Jenny . 2024-03-29

MORE AT Google

Good food and very attentive service. Finn was especially helpful, with menu selections. Food served in good time and served nice and hot. The meal was very reasonably priced.

site_logo

Margaret F . 2024-03-21

MORE AT TripAdvisor

Lunched there with friends. The starter dishes were fine, but the yaki udon was dire. Wife thought hers was vegetarian there was so little protein. Mine had a strange taste, the veg seemed overcooked. A poor plate of food. I’ve been eating at Wagamama in London since the mid 90’s, first time I’ve used the one in Sevenoaks. Had we seen the other poor reviews we would have eaten elsewhere.

site_logo

Shining_Knight . 2024-03-08

MORE AT TripAdvisor

My wife and I just love Wagamama's especially at lunch time, great quick service, I have to say and wonderful tasting food 😋

site_logo

adrian coppin . 2024-03-08

MORE AT Google

We come here often, and really enjoy it every time! Sadly, this evening was a completely different experience and we are reluctant to return! I understand places get busy, I work in hospitality myself and have sympathy for busy periods and how it does get stressful. I must say, the girl who was seating/hosting was lovely and really helpful, but the other interactions with staff were not so great. Rudeness and short/ snappy answers from staff is something I will never understand or sympathise with. The girl with brown hair who was running food this evening ( Friday 23rd ) was awfully rude and slammed the plates down without saying anything. And our waitress Jasmine was rude and sarcastic towards us when we asked after 15 minutes if we could have a menu! However, food was spot on as always. Bring back Finn!! He was always lovely and nothing was ever too much hassle! Very disappointing wagas!!:(

site_logo

charlottemeharg . 2024-02-23

MORE AT TripAdvisor

Allegedly Wagamama (わがまま) is Japanese for "self-indulgent", "self-centred", “picky”, “fussy”, "disobedient", "wilful" or “thinking about yourself and your own needs instead of others”. Some define it to mean “naughty child”. Their philosophy is said to be based on kaizen which means "continuous improvement". We went to the Wagamama in Sevenoaks for our Valentine’s lunch. The staff were polite and helpful, hence this review is not a reflection on them but rather on the ordering system operated. We were hoping to have a “romantic” lunch together to celebrate the Valentine’s day. Duly the orders were taken, using the electronic system. The drinks came then my wife’s lunch followed soon after but there was no sign of my order. This could have been noticed at that point and rectified but it wasn’t . After my wife had finished her lunch, on enquiring it transpired that my order never went through. Eventually my lunch arrived, mostly bean sprouts with few noodles. All in all an unpleasant experience. One hopes that this is a one off “naughty child” and the norm is a "continuous improvement".

site_logo

Ahmet Ozerek . 2024-02-14

MORE AT TripAdvisor

Travelled from Medway to this location for a Valentine's lunch. Placed our order . Mine arrived promptly but my partners meal didn't so I offered him some of mine. We had been delayed in traffic due to a major accident so we were starving! We waited and waited but my partners meal never arrived so we alerted a staff member who said she would investigate. Twenty minutes later whilst I had finished my meal we were told there had been an error and the second meal would be another ten minutes. We were given complimentary drinks but to be honest we didn't really want them . Eventually the second meal arrived . On Valentine's day of all days we wanted to eat together but didn't have that privilege and to be honest the staff were polite enough but not exactly empathetic. Really disappointed 😞

site_logo

Fareeda O . 2024-02-14

MORE AT TripAdvisor

Out of 5 trips, 3 times we’ve been waiting over 35 mins from ordering to getting the food (multiple times the kids food 30 mins after adult food - once our 4 year old actually fell asleep and fell off the seat). I just don’t know what is so hard that they cant serve people in the restaurant.

site_logo

Richard T . 2024-02-08

MORE AT Google

The manager was absolutely amazing, thankyou for taking care of us!

site_logo

E22 CHRIS . 2024-02-08

MORE AT Google

Wonderful food! Lots of options to choose from, vegan, vegetarian and allergen free. My favourites are the crispy chilli mushrooms, king oyster mushroom skewers,mixed mushrooms buns, and the Karen burosu ramen. Highly recommend!

site_logo

Megan Woodgate . 2024-01-30

MORE AT Google

I popped in for a meal after work with my daughter. 5* rating all round. The staff working last night were exceptional. One particular manager was so kind helping us use mu daughters voucher

site_logo

Joanna Murray . 2024-01-27

MORE AT Google

We had an excellent meal the other week and our server Hannah went above and beyond to ensure our time here was perfect. Massive thank you to Hannah for always being attentive, happy, positive and overall a great server!

site_logo

Rachel . 2024-01-25

MORE AT Google

Consistent, good value and the kids love it 👍

site_logo

Dominic O'Connor . 2024-01-03

MORE AT Google

One of my favourite chain places. Always bustling, always great service and the food is never disappointing. Accept it is a chain and fast food and enjoy it!!!

site_logo

Trevor Hudson . 2023-12-30

MORE AT Google

I came here yesterday and back again today it was that nice. The service is very fast, the servers are incredibly attentive and the food was fresh and tasty at healthy calorie ranges. The food came quickly and the cocktail was delicious. The children’s menu provided exactly what all children like in terms of food and was perfect for their tastebuds (not over flavoured). I came yesterday as a date night with my partner and found a 2 seater intimate seating table which was lovely and tonight with my 4 year old at the larger tables where families were sat. The squid was really lovely too. I highly recommend this restaurant.

site_logo

Hazel Louise Robinson . 2023-12-12

MORE AT Google

Excellent marriage of tastes. I brought a vegetarian (and fish) friend who had never been before and she was delighted with her experience!! We were well looked after, and those edamame beans with garlic and chilli were as more-ish as ever!!!

site_logo

Annie Macmillan . 2023-12-05

MORE AT Google

I love Wagammas but this branch is disaster. I've visited 4 times in the last year and none of those visits went well. The staff all seem to deliberately avoid making eye contact with you, hide out of site, and don't bother checking up on you; It makes getting service a frustrating process. This last time my partner orders her usual Raman and specifically requests no, chili, and nothing spicy, just as she's done a dozen times before. When the order arrives its drowned in chili, It was so bad I couldn't even swap meals with her and when I tell them this their response is "that s just how it comes." (no it ain't. I can damm well see the chili in the bowl.) We're not going back and we recommend you don't either.

site_logo

kronic meerkat . 2023-12-04

MORE AT Google

We came here for a quick dinner before an evening book event at Sevenoaks Bookshop. We always like the food, they have a new menu which was lovely. However Bella who served us was AMAZING. She was efficient but we were not rushed, she answered any questions, made recommendations to tweak our food to our taste. She was also funny, friendly with a dose of cheeky that made the whole evening both memorable and delightful. As staff go she was the best we've ever had at a Wagamama"s anywhere we've been. Thank you Bella and it would be more stars if we were allowed :)

site_logo

Chris Murphy . 2023-10-22

MORE AT Google

They seem to be unable to cope with even a slightly raised level of business, particularly the host on the front, she made it quite a chaotic experience. For what is already teetering on the side of overpriced chain food, they could at least make the dining experience smooth and not rushed

site_logo

tomgV8988GK . 2023-10-13

MORE AT TripAdvisor

Lovely food and good service. Have been there before several times and will return. Staff were very friendly. The restuarant was lovely and the staff.

site_logo

Lesley Ward . 2023-10-09

MORE AT Google

Great food. Nice atmosphere. Friendly staff.

site_logo

Maxwell Emmanuel . 2023-10-07

MORE AT Google

Super speedy delivery and really good food and staff.

site_logo

Daniel . 2023-10-06

MORE AT Google

My last day working in Sevenoaks, decided to try this branch out. It was such a good choice. The reason I can give 5 stars on service with confidence, I had a problem with my food...replacement in front of me within 7mins (yes I timed it lol)

site_logo

Siobhan “ShiZzy” McGrath . 2023-09-19

MORE AT Google

The food was average and expensive. Chicken and prawn pad thai contained crispy onions but no peanuts and was pretty bland. Broccoli in the wok greens was raw. Chicken dumplings were tasteless. I think this has establishment has moved from being about the quality of the food to cater for youngsters. The music was really loud and it felt like being in a nightclub rather than restaurant. We couldn’t really hear what the waitress was saying. The lady who served us was really nice, but when the side arrived we didn’t have any cutlery and we then had some randomly dumped on out table. There wasn’t enough, so we had to ask again. They want you to pay your bill by some barcode scanning system whatever that is. We asked for a normal bill, which was no problem at all but there was confusion when we wanted to split the bill in half and pay with two cards whilst adding a tip. And finally, £7.80 for a bootle of beer! 1.5/5

site_logo

73Tonbridge . 2023-09-18

MORE AT TripAdvisor

Never had a bad dining experience at this eatery. I just want to say that the customer service in this outlet is of the highest of standards. The staff were polite attentive and on point with their service. The food was top class as well and worth the price. Very satisfying experience.

site_logo

Steven stennett . 2023-09-09

MORE AT Google

It could potentially be a nice place. However if you are more than one the food ordered arrive just randomly so when your partner is about to finish what he got you are about to start! Also the place is way too noisy. We could barely talk to each other. I understand they want to keep the atmosphere informal but it’s close to be painful to be there. Finally the bill for what you get is quite high. Used to be better, both the place and food.

site_logo

Giacomo Novara . 2023-08-18

MORE AT Google

Wasn't explained that the food would be served as it's cooked, so main course arrived before sharing plate. That was a little odd and should have been made clear. Otherwise, good was good, walked in on a Saturday night no reservation. Overall pretty good.

site_logo

Jim Jefferies . 2023-08-06

MORE AT Google

Food was soggy and expensive but fast to make and tasty. My order was messed up but quickly fixed. And the free green tea is good.

site_logo

Felix R . 2023-07-31

MORE AT TripAdvisor

bella was amazing! super informative and lovely, kept checking back on us and an asset to wagas x

site_logo

rose russell . 2023-06-28

MORE AT Google

Really enjoy eating at Wagamama’s, I must have been Japanese in another life. Anyway food is good staff on the ball. I tested my waitress (Mary) and asked if I could change the desert to another sauce , she was happy to see if the cooks could accommodate my change. (They did.) I enjoyed my ice cream so much I forgot to take a photo before I started it.

site_logo

LEE BON (leebon.uk) . 2023-06-26

MORE AT Google

We prefer Wagamamas at Bluewater, from an atmosphere viewpoint, but that's just our own preference and the Sevenoaks branch still has a great atmosphere. The food is good, with lots of vegetarian and healthy options. My main criticism is that they have a policy of delivering your food one person at a time, so if I visit with my wife, and get my meal first, it starts going cold whilst we wait for my wife's meal to arrive some time later.

site_logo

David . 2023-06-25

MORE AT Google

beautiful food and atmosphere!!!

site_logo

coco bell . 2023-06-22

MORE AT Google

We had a take out. We had a teriyaki steak soba. Which we always have. It was nothing like it normally is. The noodles were all mushed up and there wasn’t any sauce.

site_logo

David Hopps . 2023-06-18

MORE AT Google

Food was great. Service was on the slow side, especially as it was quite quiet. They were all polite and friendly but difficult to get their attention if needed.

site_logo

Harry Woodhams . 2023-06-11

MORE AT Google

Good standard high street restaurant . Our server hanna is amazing very knowledgeable and bubbly person . Good asian food to try.

site_logo

dakshan24 . 2023-05-31

MORE AT TripAdvisor

Always a great place and a great time

site_logo

Kade Edwards . 2023-05-25

MORE AT Google

Good food but hopeless delivery service. On 2 occasions I have ordered food and never received it. The delivery service never phoned to say they had trouble delivering or couldn't find the address. They were happy to provide a refund but were't concerned about the loss of business or wasting over 1.5 hours of their customers time. Overall rating - food good, service attitude deplorable.

site_logo

Steve Mullinjer . 2023-04-18

MORE AT Google

I liked Pad Thai with udon noodles and ginger.

site_logo

Irina Moskalyk . 2023-03-28

MORE AT Google

I’m only giving Wagamama 5 star rating this time because one of your staff (waiters) saved the day with their customer service care ,but I still need to raise the issue here , came here with a friend and their food came out and by the time mine came out they had finished their meal and I was not impressed, slow service and my friend had asked for a sauce and it never came my food came when they had finished , the chef had been told what had happened and they removed my main from the billing but I would absolutely prefer a normal service where we both eat at the same time not watch one finish their meal and wonder what is happening Lack of coordination and communication but I was really happy with the server’s attitude I hope he goes far

site_logo

Marco Anderson . 2023-03-04

MORE AT Google

Delicious food, we all enjoyed the chilli squid, soya beans and different Donburi 's. Nice to be offered green tea on more than one occasion as usually you have to ask then it takes such a long time to arrive. Not this time, well done Sevenoaks. Yum.

site_logo

Leigh . 2023-02-27

MORE AT Google

Right from the start we didn’t feel welcome by the guy who ‘greeted’ us. No smile, no eye contact. Didn’t get any better throughout-food was bought to the table in a perfunctory way, no interaction whatsoever. My husband asked for his Jasmine tea to be topped up with hot water as it was a bit strong-this was refused on the basis that he would have to charge for another tea. When he complained about this he didn’t say that much, just that he was following rules and brushed us aside with a ‘sorry guys’ in a sarcastic way. The food was actually good and we enjoyed it but we will only remember the poor service.

site_logo

Sally A . 2023-02-22

MORE AT TripAdvisor

Becky and Breck smashed out the service tonight. So friendly and accommodating. The food was also on point and the best chilli squid I’ve had in a LONG time. Will be back sooon!

site_logo

Saznorbs12 . 2023-02-17

MORE AT TripAdvisor

A brilliant wagamamas, staff all very friendly and food excellent. Steak yaki soba cooked particularly well. Love the new chicken gyoza ramen and doughchi :)

site_logo

Cassandra Beckley . 2023-02-16

MORE AT Google

Disappointing Visit 😞 Service: The main staff member that helped usxwas uninterested, no smile and didnt want to be there (very poor). Not the same for all staff to confirm. Food: Katsu Curry was tasteless, not sure how this can go wrong. Ginger Chicken Udon had barely any chicken. Atmosphere: Staff were eating Pizza Express 🍕 on the restaurant floor. 🧐 I am a loyal Wagamama fan and I eat at other restaurants regularly, this restaurant needs an overhaul, I did visit this restaurant years ago and had similar issues with food quality.

site_logo

Christian Cole . 2023-02-10

MORE AT Google

greeted unenthusiastically at the door after a considerably long wait. Then had to wait a long time to order food as our server was more interested on the happenings around what I presume is the staff eating area. After waiting this time food wasn’t to standard and tasted bland and dry pad tai had nothing to it and my daughters allergy wasn’t considered the server simply said are you sure it’s an allergy. Also upsetting to overhear said member of staff blatantly disrespecting another woman inside of the restaurant to his fellow team members. The word will be spread and we will not be returning.

site_logo

971matildak . 2023-02-01

MORE AT TripAdvisor

Lovely staff, and delicious ramen! Highly recommend the pork belly ramen. The dessert (chocolate brownie option) was a bit small for the price, but tasted great! I will definitely be coming back.

site_logo

Marzanne Dijkstra . 2023-01-27

MORE AT Google

Known for being a bit pricey but the food is good, service a fast, the food as it is cooked for you comes when it is ready so we got our food about 7-8 minutes apart but all OK.. Nice experience... Oh and it is a bench seat and table so elbows in!!

site_logo

Adrian Bond . 2023-01-06

MORE AT Google

I was so surprised by the number of really good sounding dishes for vegetarians and vegans. I found it hard to choose what to have and was very pleased with what I chose. It's obviously a popular place with young people and had a good atmosphere. The service was a little slow but they were pretty busy when we arrived. They even had some decent cider on the menu.

site_logo

HillySpollands . 2023-01-03

MORE AT TripAdvisor

We went in at about 5 p.m after going to the pantomime, got seated quickly, food was tasty and served quickly, there were 8 of us and the cost was very reasonable

site_logo

Simon Raikes . 2022-12-29

MORE AT Google

Cold uncooked Ramen.... Have been to a lot better locations

site_logo

Elkin Fricke . 2022-12-23

MORE AT Google

Jacob who served my son and his friend this evening, helped with the menu and gave top quality service. My son & friend had a great time, thank you , they will be back with more friends and family.

site_logo

Amanda Dunn . 2022-12-16

MORE AT Google

Good food, excellent staff, great for gluten free. Nice and warm too.

site_logo

Selina Nurse . 2022-12-13

MORE AT Google

Great food, quick service, good value

site_logo

Samuel Thomson . 2022-11-30

MORE AT Google

This is the second time we come along to the restaurant yesterday and was disappointed once again. The squid was like rubber , nothing like squid and the curry dish was sent back as it was like a bowl of water. Waggamumma in lakeside is a whole different ballgame. We will definitely not be returning. Food was horrendous.

site_logo

joanne mills . 2022-11-30

MORE AT Google

Great Service. Average food. Would be a five star review if this restaurant chain would serve food as a starter and then main course as ordered as opposed to the food arriving randomly. It's not a unique selling point. It's pretentious, sloppy and arrogant. Why? If you like to have no idea when your starter or main course is going to arrive, this is the place for you!

site_logo

Serdar . 2022-11-29

MORE AT Google

Always love a Wagamamas - everything we order from there is delicious! Plus great vegan and veggie options too.

site_logo

Samantha Herriot . 2022-11-29

MORE AT Google

I am a usual customer, always very good. Although, I ordered a glass of tap water at the start of my meal and only recieved it (after asking multiple times) when we were finishing.

site_logo

Mia Weeks . 2022-11-27

MORE AT Google

Poor service. Bad etiquette, Lousy staff. Very limited Vegetarian Food options. We waited in the restaurant and waited at the entrance for 10 minutes before somebody could come and talk to us. After 10 minutes, the staff came and without asking us to sit, spent 15 minutes telling us that there is hardly any vegetarian food and if we are still interested in coming in. His subtle message was that don't eat here - not sure if it was due to racism or in general it was like this. We said to him that we want to eat whatever is available and can we sit and then only he took us in.  Finally, we ordered the food and advised them that in our food we do not want any onions. The staff said no problem they will ensure this. The food came, but it was full of onions. We called the staff to show that this has onions.  The staff told us that she had already advised the chef not to put the onions. She took the food away and brought another bowl of food, but this time again onion. We decided to eat and tried our best to take out the onions.  I asked the staff if you can not take care of one simple request how on earth do you address requests when somebody has allergies or is vegetarian?  His simple response was - "Oh apologies, I can give you ice cream for free"

site_logo

Nidhi Kansal . 2022-11-14

MORE AT Google

I had grilled duck donburi , and didnt like at all. I had it several times in the past and was ok but today the chef fai. led . I am a bit dissapointed.

site_logo

Brenda Mullins . 2022-11-13

MORE AT Google

Marc our waiter was awesome 👌 recommended new dishes to try that were absolutely amazing, Will definitely be going back

site_logo

Rich Johnson . 2022-11-12

MORE AT Google

It's wagamamas, you know what you are going to get and it is consistent in terms of food, service etc Never gonna set the world alight but can't complain.

site_logo

Paul Anderson . 2022-11-10

MORE AT Google

We were sorry the wok chef was not there so some dishes were not available. I always find the Sevenoaks restaurant disappointing compared to other Wagamamas. The food was good what we could get. The service was attentive.

site_logo

Annewhe . 2022-11-02

MORE AT TripAdvisor

Always good here but busy. We were seated and served straight away which was great with a 9 month old. Staff attentive and interested.

site_logo

colin foster . 2022-10-30

MORE AT Google

After attempting to go out for Sunday lunch but foolishly not booking we were left hunting for somewhere to eat. We thought we’d try a Wagamamas as it’s been recommended by friends many times. We were given a warm welcome and seated promptly. Then we were served by a very helpful guy called Nathan who talked us through the dishes and gave us a good idea of what to get. I can honestly say that we were not disappointed. Had a surprisingly flavoursome and pleasantly satisfying meal. My eyes have been opened and this goes high on my list to return to try the other dishes on offer. Can definitely recommend this place for excellent food and superb service. Well done Nathan and the rest of your team

site_logo

G3451NMvictort . 2022-10-30

MORE AT TripAdvisor

Our waiter Nathan was so polite and nice, thank you! my girlfriend and me enjoyed a very nice dinner here, we will be back! Vegan options just on point :)

site_logo

Mireyeraella . 2022-10-20

MORE AT Google

Great range of vegan food on an updated menu - Enjoyed the service from Sunny and Rebecca nice to have such a friendly team - see you again soon

site_logo

Barnsleh . 2022-10-14

MORE AT Google

Lovely staff and great food. Will be back

site_logo

Karen Borrie . 2022-10-13

MORE AT Google

Similary restaurants in South East

restaurant_img
4.0

2864 Opinions

location-iconHigh Street
British
outdoor_seating_134307takeaway_134307delivery_134307

The White Hart is our regular go-to local pub, whether for a drink in the sunshine in the garden, dinner or a take away. It’s always a very pleasant trip, very dog friendly, and the staff are always super friendly (shout out to Danny!).

restaurant_img
4.0

778 Opinions

location-iconChurch Road
British
outdoor_seating_133980takeaway_133980delivery_133980

Nice little pub, had one of their sandwiches which was very good as was the dessert. Friendly staff, what more would you want. Car park is small but there is space in the church car park next door.

restaurant_img
4.0

331 Opinions

location-iconMain Road
Other cuisines
outdoor_seating_161336takeaway_161336delivery_161336

Well, that was simply the best meal I've eaten in England since I went to Gravetye Manor a few years ago and it's less than half the price of that. Apt though, because the chef, Ollie, was pastry chef there a while back (hint - leave space for some dessert!). My two guests and I shared 3 starters between us and each one was sublime - the Soufflé clinching top place for all of us. This was followed by Bavette Steak and hand made frites. Ollie is French so, don't worry, he knows how to cook a Bavette. We were stuffed already, but took a short break and finished off with a Chocolate Fondant. I wouldn't usually touch this in most English restaurants, but trusted Ollie to do it justice. We were all wriggling with pleasure at each mouthful and wishing we'd had appetite for a dessert each. Sue and her staff were friendly and welcoming so the service gets 5*, but don't expect it to be fast because everything is freshly and lovingly prepared in their recently extended kitchen. "The best things come to those who wait" and this beats Heinz Ketchup by a dozen country miles and there's plenty of beautiful ones of those to wander along in the local area after your meal.

restaurant_img
4.1

93 Opinions

location-icon93 High Street,
Asian
outdoor_seating_171201takeaway_171201delivery_171201

One of the best curries I've had, highly recommend this place!

restaurant_img
4.0

739 Opinions

location-iconLondon Rd, Dunton Green, Sevenoaks TN13 2TD, United Kingdom
outdoor_seating_381316takeaway_381316delivery_381316

Tesla chargers are very slow. Don't even bother charging here. Customer service at the cafe is terrible. They'll start serving other people that came in after you and make you wait. Then when you question it they'll just smile at you. Id go elsewhere.