GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.8

Based on 1.094 opinions finded in 4 websites

site_photo4

Nº 889 in 1383 in Leicester

Nº 17 of 24 Asian in Leicester

CUSTOMERS TALK ABOUT DISHES WITH..currylambchillimustgarlicmeatricepayprawnsfishspicybutteroldchickencooked

comment_iconOpinions

The food was delicious!! Especially the woolpack mix grill will suggest for sure!! The ambience was really calm and serene with good music. Great service. Perfect place for amazing food and to have great time.

site_logo

Priya Ah . 2024-12-06

MORE AT Google

The food here is delicious core ! Would 100% suggest the woolpack mix grill and their Lamb Rogan Josh. Great service. The ambience is calm and serene. Perfect spot for family and friends to have amazing food .

site_logo

Priya . 2024-12-06

MORE AT Google

I had a take away and tharun the manager went out his way to make sure it was delivered and as I’ve eaten there before my level of spice was remembered and my food was ordered to my taste and I really can say the food is always as good . Photos don’t do it justice

site_logo

kerry derham . 2024-11-25

MORE AT Google

Food is great it’s quite improved and lovely staff and new atmosphere. Good place for family and friends dining.

site_logo

Pankaj Makwana . 2024-11-16

MORE AT Google

incorrect order and then they state that we don't give refunds. we will give you a Free dish when you order again. I won't be ordering again as the service was poor.

site_logo

Mehul . 2024-11-02

MORE AT Just Eat

Food is great but service is bad it takes long to get served

site_logo

Shashikant Nagar . 2024-11-02

MORE AT Google

I took the veg biryani and tarka daal for takeaway and i enjoyed the most authentic food i have ever ate.Thank you woolpack and the team.

site_logo

Pragya Lamsal . 2024-10-29

MORE AT Google

Qualify and flavour of food is always good.

site_logo

Ranjana . 2024-10-26

MORE AT Just Eat

amazing food. Friendly driver and great delivery

site_logo

Shital . 2024-10-11

MORE AT Just Eat

Sorry but I should have checked the food hygiene rating before we went. So will not be eating there again.

site_logo

Peter . 2024-10-07

MORE AT Google

Good portions and nice tasty food. They just need to work on their hygiene rating.

site_logo

K P . 2024-09-22

MORE AT Google

Had a great meal, food was super tasty, thank you chefs, all the staff were excellent, the young lady from Leeds made us feel so welcome, and I recommended a visit.

site_logo

Cartwright Anthony . 2024-09-17

MORE AT Google

missing chutneys from our poppadom tray- not a huge issue, just left with poppadoms on their own

site_logo

Stanley . 2024-09-12

MORE AT Just Eat

I have visited the place and received a great food and service.

site_logo

vijay garapati . 2024-08-29

MORE AT Google

Shocking food … shocking service and will never return again ! Disgusted by the prices and service ! Poor management

site_logo

Jessy Messy . 2024-08-22

MORE AT Google

It was great hospitality by the lovely staff and food was completely new taste with lots of flavours my family members enjoyed it a lot and they got nice cocktails as well it was a great place for chilling with family and friends with large garden as well.

site_logo

vikky . 2024-08-12

MORE AT TripAdvisor

Been there a few times now and must mention that the service is so lovely, cool ambiance and anyone who’s planning to go there should try chilli fish!!! It’s the best!

site_logo

Velore Jahnavi . 2024-08-12

MORE AT Google

I was there with my friends had a great experience in the garden, they changed there menu and food it was lovely new flavours and different new options. Great service by the staff. Thanks for the lovely hospitality.

site_logo

Vikky P . 2024-08-12

MORE AT Google

it was good experience with family children had a great time in garden and staff was friendly sujjested great food and drinks want to visit it soon again.

site_logo

Ramesh B . 2024-08-10

MORE AT TripAdvisor

Best curries and sizzlers in leicester Service was good Butter chicken is the speciality Tandoori mix grill was very tasty Nice garden sitting for summer

site_logo

Explorer54281221784 . 2024-08-10

MORE AT TripAdvisor

Nice food and good service, friendly staff

site_logo

Jaya teja . 2024-08-10

MORE AT Google

Amazing food and service. Thank you

site_logo

Vaibhavi tailor . 2024-07-12

MORE AT Google

Food ordered is not what is described and staff don't want to know about it! Worst service and food and I will never ever return to Woolpack! Avoid them at all costs!!!

site_logo

Rimit Sedani . 2024-07-07

MORE AT Google

Great food and very friendly staff. Highly recommended 👌

site_logo

Dev Singh . 2024-07-02

MORE AT Google

Very tasty food. One of the best chicken madras that I have ever had. Will definitely be back!

site_logo

shamsher chohan . 2024-07-01

MORE AT Google

Such lovely people who run this pub , we couldn't find no where to take the dogs for a drink after our walk we decided to try the wool pack, they let us sit in there garden even though no dogs are allowed and there's signs to say so , someone even came out and offered to get some water for them but they already had some but I thought it was lovely of them to ask. Thankyou so much.

site_logo

Abbie May . 2024-06-30

MORE AT Google

Don't bother you will wait forever for your food beer tastes waterd down to. And the toilets stink plus the waitress took a big bin to be emptied in to the big dustbin outside put it back and did not even wash her hands just carried on how disgusting 😑

site_logo

Tellstars . 2024-06-21

MORE AT TripAdvisor

this is the first time I've ordered and I love their food it is amazing thank you so much keep up the good work.

site_logo

Keiran . 2024-06-18

MORE AT Just Eat

A good pub is defined by its quality food and drink, but what truly makes a pub great is the sense of belonging and warmth it offers. From the moment my wife and I stepped into Woolpack Pub, we felt like family. As someone who has always lived in the area, I have a deep appreciation for local establishments. However, my wife, who comes from the north where Indian pubs are less common, was initially anxious about fitting in. Woolpack Pub dispelled all her fears by welcoming us both with open arms. What sets Woolpack Pub apart is its exceptional family-friendly and woman-friendly atmosphere. The staff go above and beyond to make everyone feel at home, fostering an environment where all can relax and enjoy. This inclusive and inviting atmosphere is as important as the delicious food and drinks they serve. Woolpack Pub has become our go-to spot, not just because of its great cuisine, but because it treats every customer like a valued member of the community. For its outstanding hospitality and warm, inclusive environment, it’s what makes them so great Additionally, I would like to give a special shout out to Alex for his hardworking service. His dedication and friendliness significantly contribute to the welcoming ambiance that makes Woolpack Pub so special.

site_logo

S R . 2024-06-05

MORE AT Google

Really great service and beer . Alex is always welcoming and the food is also on point . Highly recommended

site_logo

Anup Tejura . 2024-05-31

MORE AT Google

Pints are brill & so is the staff. Have had 4 different dishes since the new chef has come in & the food is top notch.

site_logo

Mukesh Tailor . 2024-05-31

MORE AT Google

(take away) Food taste average and atleast salad has been served fresh. disappointed.

site_logo

nirmal dalpat . 2024-05-29

MORE AT Google

To the Head Chef: Navy Seals “drop the weapon now” P.S. how come I never c u drift

site_logo

Riley Mackrory . 2024-05-27

MORE AT Google

I’m here to offer the head chef a peaceful solution… a race

site_logo

Aaron Matthew . 2024-05-27

MORE AT Google

I ordered food absolutely horrible, small portion big price wouldn't recommend

site_logo

anant madhav . 2024-05-19

MORE AT Google

Always a pleasure coming here for great food and a great experience! The new menu is absolutely fantastic, a great range of choices to cater for all. The staff were extremely hard working and accommodating for all dietary requirements. We love the new cocktail menu! A great addition to the already array of beverages and beers on draught. I would highly recommend taking advantage of the beer garden in the summer!!!

site_logo

Harvean . 2024-05-18

MORE AT TripAdvisor

The food wasn’t as great as I thought it was going to be. We ordered the paneer butter masala and naan and the mixed veg sizzler. The sizzler wasn’t nearly as hot as I thought it would be. The food cooled down way too quickly which made me doubtful about whether it was microwaved. The service was quite slow to be fair once the food had come out. After we got the bill, one of the waitresses told us she’d be right back so we could pay but we waited at least 10-15 mins before we got up and just went to the front. The lady was tending to other customers and clearing up so I think she’d forgotten we were there. There was hardly anyone around at the front that we could have easily not paid and left and I don’t think anyone would have noticed!

site_logo

Khusbu M . 2024-04-20

MORE AT Google

Food is excellent, but the service is extremely poor. We had to wait nearly 3 hours for the food which never came in sequence. Not going there again Disappointing

site_logo

Sanjay Savjani . 2024-04-17

MORE AT Google

Overpowered with spice barely warm and unappealing to the eye, would recommend the broadway anyway over this

site_logo

Nathan . 2024-04-13

MORE AT Just Eat

THE NEW CHEF MAKES THE FOOD TO SALTY

site_logo

ARJUN . 2024-04-12

MORE AT Just Eat

Absolutely horrendous! Avoid! They stuck us in a little corner A drunken man kept coming to our table and harassed us. Staff did nothing about it. We waited 1 and a Half hours for our food. And not even the starters had come!! The waitress kept smirking and saying “Just 10 minutes more” every so often We then proceeded to just walk out Apparently they have a new chef and new management. I won’t ever go again.

site_logo

Sportsmaduk . 2024-04-07

MORE AT TripAdvisor

Absolutely horrendous! Avoid! They stuck us in a little corner A drunken man kept coming to our table and harassed us. Staff did nothing about it. We waited 1 and a Half hours for our food. And not even the starters had come!! The waitress kept smirking and saying “Just 10 minutes more” every so often We then proceeded to just walk out Apparently they have a new chef and new management. I won’t ever go again.

site_logo

AP UK . 2024-04-07

MORE AT Google

ordered by phone spoke to 3 different people to order when I paid they repeated all of my card details out loud despite asking them not too rang again when food hadn't arrived after an hour and 45 minutes spoke to 3 people again last one hung up.food arrived 2hrs after order one dish missing curry sauce filled at least a fifth of the container it came in and all the other dishes were nothing like the food I've had from there before which used to be excellent. not so this time best thing was the nan bread binned half of it .massive disappointment all round .NEVER GOING BACK.

site_logo

Andrew M . 2024-04-06

MORE AT TripAdvisor

Ordered a fish curry as per Deliveroo. Was delivered Battered fish in a curry sauce. It was not described as such on Deliveroo or on their menu online. Called the restaurant to ask how their fish curry usually is prepared. They stated tilapia fish in a curry and no battered fish (fish pakora) is used. Essentially given lots of batter with a tiny amount of fish in a generic curry sauce. When I called I was told a host of lies such as “maybe the chef was trialing another recipie” absolute load of rubbish. Would not recommend the food or the service. Advised them to state what they serve if they intend to serve the wrong dishes.

site_logo

Mitul M . 2024-03-16

MORE AT TripAdvisor

Order never came, I called twice and I was advised I will get my food. Felt so embarrassed in front of my guest. Food never turned up. Why much disappointment

site_logo

Sanky . 2024-03-11

MORE AT Just Eat

I really didn't mind that it was late as it was still very hot when it arrived the food was absolutely amazing the chicken in the chicken curry was so tender and the aloo Gobi was out of this world thoroughly enjoyed it can't wait to order again

site_logo

Elizabeth . 2024-03-07

MORE AT Just Eat

been a few times lately and tried different things and enjoyed them all the staff have been friendly and polite the prices are average to most other places. we recently went as a table of 17 and all the meals came out around the same time and no one in the group had a complaint.as our favourite restaurant visual has closed down this is now are new favourite.the new drinks prices are a deffo plus.

site_logo

antscully . 2024-02-28

MORE AT TripAdvisor

Nice friendly staff good food and serving good good manners friendly atmosphere we will come back with more friends must try mix Grill platers Garlic Naan chicken samosa and Haryali chicken curry...and many more.....

site_logo

punit modha . 2024-02-26

MORE AT Google

Top place for a Saturday Sizzler. Sky sports, decent priced beers and top food

site_logo

Rob Mcleavy . 2024-02-12

MORE AT Google

It was always good to be at woolpack

site_logo

Birju Patel . 2024-01-18

MORE AT Google

Extremely tasty king prawn curry balanced by fragrant rice - excellent!

site_logo

Chris . 2024-01-16

MORE AT Just Eat

Great food and great beer! Easily the best curries in leicester

site_logo

Inn Supplies . 2023-12-25

MORE AT Google

Butter chicken and boneless sizzler

site_logo

Shahbaz Rahim . 2023-11-27

MORE AT Google

Ordered £70 food from this Restaurant. Was told 35 min wait. 2 Hrs & 2 phone calls later the food turns up. Not acceptable . Will not use again 👎

site_logo

Si Kinch . 2023-11-24

MORE AT Google

Lovely fish methi curry, poppadom, salad and dip but the roti was very tough. Still tasty though!

site_logo

Chris . 2023-11-17

MORE AT Just Eat

Good value Indian restaurant and sports bar. It is divergent, depending on factors like what season, or celebration, or what live sports is on the big TV etc Nice food.

site_logo

Michelle Alner . 2023-11-11

MORE AT Google

Portion had little meat and the veg in the curry was cut up too big will not be ordering again

site_logo

Sameer . 2023-11-07

MORE AT Just Eat

Always a great experience and time coming here! The staff are so welcoming and the food is always fresh. If you are looking for somewhere for great service, beers on draught, Indian cuisine and top notch service. Shout out to Thaun for always making us feel welcome!

site_logo

Harvean Dulay . 2023-11-04

MORE AT Google

Very disappointed with service. Was not busy yet services were slow. Men's washroom pathetic Very dirty no soap in dispenser, drinking glasses were dirty, I'd rather do takeout have food at home no complaints with food good food

site_logo

Bhavin Sidpara (Bhavz) . 2023-11-03

MORE AT Google

Lovely food, good atmosphere, and the service was brilliant

site_logo

Dhru Sidpara . 2023-10-30

MORE AT Google

went as a group of 8 last week and 4 of us ended up having food poisoning from the food. im only recovering now. deffo wont be eating from there again!

site_logo

Levi McCartney . 2023-09-18

MORE AT Google

Amazing food! There are alot of options for vegan dishes which i love! i always get a Chana Masala, high recommend!

site_logo

Herbalist Hut . 2023-09-16

MORE AT Google

Good was fantastic and plentiful however the salad was very small not even enough for one person.

site_logo

Prakash . 2023-09-14

MORE AT Just Eat

Got recommended to go to the woolpack for dinner wish we had not gone we decided to try the beer garden we ordered drinks first before our meal. There was kids running around all over the tables jumping up and down on them and customers have to eat there meals of them + rowdy men swearing and shouting 😳 we decided to leave after our drink 🍸 and decided to go to the Martin Inn down the road wich was definitely 5 stars ***** let's hope the management see this review and stop this happening.

site_logo

Voyager00612092631 . 2023-09-13

MORE AT TripAdvisor

Left clear instructions for no butter on my nan to receive it with butter! Didn't eat!!! I hate butter on my nan! Can't follow simple instructions, greatly disappointed!!!

site_logo

Rimit . 2023-08-11

MORE AT Just Eat

Great food as always. Very friendly and helpful staff. Food cooked to your choice of heat with level of spice.

site_logo

Ash Pankhania . 2023-08-06

MORE AT Google

Meal was very nice, always up to scratch. Delivery driver very competent and knocked on door, as requested ,well done .

site_logo

Patricia . 2023-08-01

MORE AT Just Eat

Food is great, good drink selection too, no parking though but parking available in residential streets nearby.

site_logo

Amit C . 2023-08-01

MORE AT Google

Lovely food. Reasonable prices. Packaged really well too. Will definitely be ordering again.

site_logo

Maria . 2023-07-29

MORE AT Just Eat

Great vegan options and very tasty 😋

site_logo

Nitu . 2023-07-28

MORE AT Just Eat

Delicious food delivered quickly... Excellent!

site_logo

Chris . 2023-07-15

MORE AT Just Eat

Fab food as always and plenty of it. Delivered hot and very tasty.

site_logo

Patricia . 2023-07-02

MORE AT Just Eat

Emma for food and Chris at the bar amazing service can’t fault it .. food is banging lamb tawa amazing off the hook 🤩deffo recommend

site_logo

Amardeep S . 2023-07-02

MORE AT TripAdvisor

Fab food as always thank you and well done

site_logo

Patricia . 2023-06-27

MORE AT Just Eat

Lovely food excellent staff just abit dated inside still a good place to eat tasty food 😋 and will always come back

site_logo

A BURNETT . 2023-06-27

MORE AT Google

No one speaks English. Just got sat on a table for a long time. No one seemed interested in taking our food order. Absolutely shocking service.

site_logo

Aaron Vegh . 2023-06-03

MORE AT Google

Food was good enjoyable night out 😇🙏🙏🙏

site_logo

david farnsworth . 2023-05-30

MORE AT Google

Terrible dining experience - Asked us to move tables - Had to ask for someone to come over - We asked how long, they stated half an hour, took over a hour - Staff seemed confused about their own menu and asked multiple times about what we want - Butter chicken was waterery and did not taste right at all - Sizzler was a kids sized sizzler (do not order) - Ordered a lemonade and only gave half a cup until asking to fill it to the top - Overpriced food overall - Messed up the order/receipt - We simply asked if we could turn on the TV which we could see was on standby but they stated they couldn't cause it's broken - The sofa seating was extremely uncomfortable and way too low to eat on the table

site_logo

Kush Patel . 2023-05-09

MORE AT Google

Well be going there has a regular very good

site_logo

Peter Timms . 2023-05-08

MORE AT Google

Meal lovely but bit expensive , delivery man very nice knocked on door, which I appreciated, instead of sitting in car and ringing me which some other places do.

site_logo

Patricia . 2023-05-07

MORE AT Just Eat

Always good food and again top service and good meal 👍

site_logo

David . 2023-04-23

MORE AT Just Eat

The food was well packaged when it arrived and hot. Delicious as usual from this place.

site_logo

Manoj . 2023-04-22

MORE AT Just Eat

Will order on a Saturday now as the curries seem to be much better and tastier than when I have ordered in the week

site_logo

nikki . 2023-04-22

MORE AT Just Eat

Punjabi chicken was bland and tasteless, I asked for the food to be made hot and spicy, it was mild!!! Asked for the nan to have no butter which it did! Not your usual service, greatly disappointed!

site_logo

Rimit . 2023-04-21

MORE AT Just Eat

Amazing, clean place, great food, superb service, food delicious

site_logo

Faisal Parekh . 2023-04-19

MORE AT Google

The attentiveness to our table was pretty poor. I had to call the chap over a few times to get the drinks order. Starters came out over an hour, the Jeera wings to me by surprise "lovely" another hour then the mains came out which were mediocre.

site_logo

Inderjit Singh . 2023-04-17

MORE AT Google

Food was decent for decent price as well. Good place to sit and e.g. watch football. Indian food very tasty. Recommend for everyone

site_logo

Konrad Pieta . 2023-04-11

MORE AT Google

Just popped down for a drink… always on point…

site_logo

Ketan Dusara . 2023-04-08

MORE AT Google

Abit pricey on drinks didn't try the food staff seemed friendly my brothers liked the food Edit= tried food, it was OK, the price was shocking, small portion big price and standard food 😳 do not order the samosas 🤦🏽‍♂️

site_logo

pdiddypop esco . 2023-04-08

MORE AT Google

Food was lovely. Hot when arrived, very tasty, large portions. Will definitely be ordering again. Thank you

site_logo

Jodie . 2023-04-01

MORE AT Just Eat

Tasty food, and they lessen to your instructions to make food mild, 100% as all ways

site_logo

Jay . 2023-03-30

MORE AT Just Eat

I am allways in woolpack and it's my second home 🏡 and all staff are very friendly allways smiling good food and allways best beer 🍺

site_logo

Naresh Vaghela . 2023-03-25

MORE AT Google

Excellent food,great staff, and lovely service.

site_logo

sam kashmir . 2023-03-25

MORE AT Google

Usually order a curry on a Saturday and it is always nice and tasty and spicey, todays curry was nothing like it, it lacked colour, was bland with a bit of spice with chunks of onion in, different chef perhaps? Anyway I was disappointed and did not enjoy, I even found a pea in it!

site_logo

nikki . 2023-03-24

MORE AT Just Eat

Went early and place had a few people in, decided to roder food, and owner said no tables only outside avilable. I did smell a rat there. Anyhow elected to eat outside and even when we went into the building to order drinks the bloody place was still empty. I had been going to this place which Dev kept and and it was a shipstones Breewary neary 30 years and it have been under unw management. Come Back Dev all is forgiven. Food was rubbish drinks were terrible. I will not be going back the Price is extoritionate too!

site_logo

Bina Garten . 2023-03-21

MORE AT Google

Food was really good and the staff very polite

site_logo

Santoshan Sangha . 2023-03-20

MORE AT Google

Tasty,nice an warm, will be ordering again

site_logo

Jay . 2023-03-15

MORE AT Just Eat

Onion bhaji very hard little onion. Couldn't eat

site_logo

Adele . 2023-03-14

MORE AT Just Eat

Went to the woolpack for my wifes birthday she had a biriyani and i had a mix sizzler both where to die for great portions great value very good staff very polite and friendly and they had a happy hour until 8pm so beer and soft drinks where cheap i e 1 lager and a glass of lemonade £6 10p will be going back.

site_logo

redmen005 . 2023-03-01

MORE AT TripAdvisor

Firstly when I called them they just pick the call and just didn’t answered properly and kept the phon a side, it’s not too busy and still they are not attending the tables properly, they are not treating us properly and they are treating us by our looks.

site_logo

divyakant kanti . 2023-02-25

MORE AT Google

Similary restaurants in East Midlands

restaurant_img
3.9

529 Opinions

location-icon197 Green Lane Road
Asian
outdoor_seating_229407takeaway_229407delivery_229407

Amazing food. Me and my husband are regulars. Excellent service! The food is always hot because it’s made fresh and tastes delicious. I rate this place 11/10… We don’t bother trying other places now because you can’t go wrong with this place! From Fatima Khatri ( Fatima’s Beauty Salon )

restaurant_img
4.0

220 Opinions

location-icon22 High Street
Asian
outdoor_seating_203021takeaway_203021delivery_203021

Lovely staff and quick service , no need to queue too long

restaurant_img
3.6

6449 Opinions

location-iconUnit 8 Haymarket Towers Humberstone Gate Humberstone Gate, Leicester LE1 1WA England
Asian
outdoor_seating_245458takeaway_245458delivery_245458

Kept extending time not the delivery driver fault tho

restaurant_img
4.0

1603 Opinions

location-icon194 Evington Road
Asian
outdoor_seating_79653takeaway_79653delivery_79653

The food was served awfully - the naan bread is cut up and added to the box along with the sauce, rice and meat etc. so everything is soggy. The worst 'curry' I've ever had tbh.

restaurant_img
3.5

1047 Opinions

location-icon52 Uppingham Road
Asian
outdoor_seating_79427takeaway_79427delivery_79427

Nice restaurant with authentic desi food. Recommend book table as busy. Refurbished recently, buffet is available.