GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 650 opinions finded in 2 websites

site_photo4

Nº 268 in 491 in King's Lynn and West Norfolk

Nº 52 of 131 British in King's Lynn and West Norfolk

CUSTOMERS TALK ABOUT DISHES WITH..porkroastmeatchickeneggfishladyvegetablespieoldmustpotatoespastrycookedsteaksalad

comment_iconOpinions

A good pub for locals to hang out in. There's always a friendly and chatty friend or local to talk to. Though sometimes, there's the occasional rowdy and gritty bunch being a nuisance or just raising some raucous noise. Nice place to chill out in the evening and weekends, though...✌🏽

site_logo

Nnamdi Osigwe . 2025-05-02

MORE AT Google

Great pub, nice atmosphere and they serve John Smith's

site_logo

History Academy . 2025-04-11

MORE AT Google

Very pleasant visit, Fridays disco ok until dj changed the music to trance. Tables needed a wipe once glasses were collected. Staff friendly and smiling. Cheers Prices Very good,

site_logo

john TEE . 2025-02-03

MORE AT Google

Good pub on a Saturday night, music loud and party atmosphere will use again

site_logo

Paul L . 2025-01-25

MORE AT Google

NO FOOD Anymore, real shame as dog friendly pub & nice drinks. Had to go elsewhere for lunch.

site_logo

Hev Lor . 2024-11-04

MORE AT Google

Not busy on a Tuesday night but pleasantly surprised by the number of screens to watch different sport on.

site_logo

Cycli Gert . 2024-10-24

MORE AT Google

Nice pub in centre of town, changed into a more trendy style attracting mixed clientele. DJ til late

site_logo

Andy Donley . 2024-08-14

MORE AT Google

Really lovely food thanks. Enjoyed our lunch very much really good price. Lovely setting and thoroughly enjoyed our lunch

site_logo

Marie S . 2024-08-09

MORE AT TripAdvisor

Great pub, travel from wisbech to come here several times in the year, price of drinks are cheap aswell.

site_logo

Gary Ellerby . 2024-07-30

MORE AT Google

Friday 5pm. Nice pub. Thought I’d have a quiet drink but…. vey quickly the pub began to fill with very loud and very sweary men. I am talking f*** words and variants with no respect or consideration for any other customers. As a single older female I was ‘treated’ to a ‘balance a beer on a large stomach’ competition, again with lots of swearing. Loud false laughter and talk of ‘getting hammered’. OK you don’t get younger people I might be told but the majority of these men were 40 plus. I guess I am not the custom they are aiming for.

site_logo

SALLYSEAGULL . 2024-07-19

MORE AT TripAdvisor

Only had drinks as I was at Festival Too. Not the cheapest in town for drinks, but fairly quick to serve even though it was busy.

site_logo

Anthony Cook . 2024-07-11

MORE AT Google

No food. Great staff good for a giggle.

site_logo

Kev Kevin . 2024-07-06

MORE AT Google

Bar staff outstanding, serving in order not ones pushing in. Cheap too

site_logo

steve nichols . 2024-07-03

MORE AT Google

Excellent beers very clean and welcoming

site_logo

John Chaplin . 2024-05-23

MORE AT Google

9 people endedup with bad stomach's after a night out at the maids head it was the alcohol which did it

site_logo

Desmond George . 2024-05-12

MORE AT Google

Maids Head always been a popular joint,, always on my list for entertainment

site_logo

jonathan howlett . 2024-04-22

MORE AT Google

Nice young lady behind the bar, all nails and makeup, the landlady, totally accommodating for the Grand National, and I got a good clean lovely pint of Abbott very cheap indeed. The place is very clean, it's got a varied clientele from office workers to regulars and families, and I would recommend a visit when you're in Lynn.

site_logo

Sean Casey . 2024-04-20

MORE AT Google

The surface was good in staff were good the Sunday lunch was amazing

site_logo

Robert Vincent . 2024-04-01

MORE AT Google

Haven't tried the food however a lovely atmosphere and cheerful staff 😊

site_logo

Jayne Phillips . 2024-03-29

MORE AT Google

Lovely pub it's worth the trip from the crown and anchor

site_logo

Keith Knight . 2024-03-27

MORE AT Google

Excellent food. Hot and tasty. Bought cakes to takeaway. Thought a bit expensive as they wasn't the best. Recommend eating in .

site_logo

Kevin Roberts . 2024-03-23

MORE AT Google

No food, drinkers hole. Great beer. Nice place

site_logo

Phillip Clemmit . 2024-01-13

MORE AT Google

Been a few times lately and a very well presented pub. Clean and tidy with a mixed crowd. Beer selection is ranged and well tasted. Great setting in town centre.

site_logo

Harry Whitmore . 2023-12-20

MORE AT Google

Great atmosphere and good prices, sky sports too

site_logo

simon lill . 2023-12-06

MORE AT Google

Very pleasant, reasonably priced for both drinks and pool.

site_logo

Jeff Prescott . 2023-09-14

MORE AT Google

Fantastic pub on the historic Tuesday market place, we didn't try the food, but the beer was good and you can take your glass outside and sit on the pleasent seating area.

site_logo

Dom Self . 2023-09-08

MORE AT Google

Really good pub great for sports. Made to feel welcome

site_logo

Alan Hendry . 2023-09-05

MORE AT Google

Good night for drinks nice place will visit again.

site_logo

chris thompson . 2023-08-27

MORE AT Google

Definitely a venue to visit. Friendly bar staff and Door Staff

site_logo

1/14th truck builder . 2023-08-20

MORE AT Google

Great pub apart from one male member of staff discussing human I've ever met

site_logo

Scorpioelite . 2023-08-07

MORE AT Google

Service was discussing Staff ignored me and my wife when asked for service waited over 20 minutes never go there again. Won't let it spoil our holiday terrible ignoring pensioners.

site_logo

Graham Mchale . 2023-08-03

MORE AT Google

Хороший старый паб, с запахом старого паба. Цены на пиво гуманней, чем у соседей по площади. Бокал Гиннеса 3.5£

site_logo

виталий петров . 2023-07-16

MORE AT Google

So my husband and son went to kings Lynn music festival and went to have a drink in the maids head, my son went to use the toilet and was ordered by the bounser to get to the back of the non existent queue he went back to the bouncer and said he wanted to use the toilet and was violently pushed into the railings and landed on the floor, the bouncer and another one jumped on top of my son grabbing him by the throat and was literally strangling him only letting go when his dad intervened. When is it nessesary to use these tactics when a customer asked to use the toilet. I certainly won't be recommending this pub to anyone and most definitely won't drink in there again. Their bouncers are appalling

site_logo

Sheena White . 2023-07-09

MORE AT Google

My favorite pub. Very relaxed, great for meeting family and friends, pool tables and affordable drinks. Will always stop here for a pint when I'm in King's Lynn. :)

site_logo

Victoria Cleaves . 2023-07-03

MORE AT Google

Very nice and clean, friendly bar staff differently go again

site_logo

John Frost . 2023-06-16

MORE AT Google

Visit here every time I visit King's Lynn

site_logo

craig Gibson . 2023-06-03

MORE AT Google

Fantastic pub, awesome beer, good prices... and the pool table is a good quality. My first visit in a few years, but will definitely be back... Great 👍

site_logo

Mad Andy . 2023-05-30

MORE AT Google

Very rude bar manager. Drinks were poured in a warm glass which I understand cannot always be helped however when queried as my drink appeared flat I was told to go to another establishment if I didn’t like it.

site_logo

Kelly Marie . 2023-05-28

MORE AT TripAdvisor

Ordered drinks at the bar and was served the incorrect drinks. Asked for the correct drinks to be provided only for the barmaid to vacate the bar and come back with landlord. Landlord acted like a complete child and radioed for the bouncers to remove myself and two friends. We then asked if they would remove people elsewhere for asking for the correct drinks they agreed and said it was a joke. What a way to run a pub!!!

site_logo

Will Lowry . 2023-05-14

MORE AT Google

Would have been nice if you served food but otherwise it was really nice.

site_logo

Tony Rand . 2023-05-02

MORE AT Google

I use the Maids during afternoon and early evening before it comes to lively. Always have a great time and Harry and the team look after customers well.

site_logo

Daniel Dennis . 2023-05-01

MORE AT Google

Great atmosphere. Lovely staff. Highly recommended

site_logo

Tanya Tanya . 2023-04-09

MORE AT Google

Friendly staff lovely local quaint pub

site_logo

Sarah McHale . 2023-03-25

MORE AT Google

Cheap beer. Lots of TVs. Not my cup of tea, but it was clean.

site_logo

Darren Cole . 2023-03-23

MORE AT Google

Attended this afternoon, barmaid dosent understand how to operate her bar, 4 people in the bar, steps to serve number 5! When questioned she says I am rude rather then say sorry and rectify the situation. Doesn’t apologize but rude back: further staff training required.

site_logo

maddyaust . 2023-03-18

MORE AT TripAdvisor

Dog friendly and very social place to be

site_logo

Pam Loydall . 2023-03-16

MORE AT Google

Good pub and atmosphere is very good.

site_logo

James Gatt . 2023-03-15

MORE AT Google

Just had a drink quite quiet but good value

site_logo

Roger Link . 2023-02-16

MORE AT Google

A lovely lively place to go, for a social drink

site_logo

Rachel Collins . 2023-02-12

MORE AT Google

Приятный паб,приветливый персонал

site_logo

Игорь Дмитренко . 2023-01-30

MORE AT Google

Really nice sports bar, loads of screens, darts boards, pool table, loads of seating, friendly bar staff, nice lighting, well decorated, nice clientele

site_logo

Barbecue Sausage . 2022-12-20

MORE AT Google

A good experience in my visit from NE England to King's Lynn. Busy, with an excellent choice of beers. I will definitely visit again the next time I am in Kings Lynn .

site_logo

Stephen Black . 2022-12-17

MORE AT Google

Old world pub with friendly staff

site_logo

David Popely . 2022-12-12

MORE AT Google

very friendly, great music, a most enjoyable night

site_logo

Anita Cairns . 2022-12-10

MORE AT Google

Very nice friendly pub excellent bar staff

site_logo

Lee Garner . 2022-12-01

MORE AT Google

Great service, lovely staff and friendly customers.

site_logo

Tony Andrews . 2022-11-29

MORE AT Google

Was there to watch the football and enjoy a couple of pints with friends. It was friendly and reasonably priced.

site_logo

godfishy . 2022-11-29

MORE AT Google

Manager and barmaid sooo rude. Gave me the wrong wine and then called me a liar. Will never go again. The place has gone downhill since the new management. Such a shame.

site_logo

Allison Peace . 2022-11-27

MORE AT Google

Miserable barmaid, rude manager. Asked for a particular wine and got something different. Returned to the bar and was told that I was lying. Very poor service. Not pleasant at all.

site_logo

Meander137626 . 2022-11-27

MORE AT TripAdvisor

£2.85 for a pint of post mix soft drink £2.85 for half a pint of post mix soft drink and a packet of scampi fries crips I won’t be back at those prices

site_logo

Charles L . 2022-11-05

MORE AT TripAdvisor

Cheap booze, funny smells, common people. If this sounds like your thing then you're on for a winner. Has the footy scores on too.

site_logo

adam s . 2022-10-22

MORE AT TripAdvisor

Great staff good beer well laid out pub

site_logo

Michael Chopping . 2022-10-01

MORE AT Google

Great to see the pub reopen good prices and beer thanks

site_logo

Steve Taylor . 2022-09-30

MORE AT Google

Cheap drinks friendly efficient staff wild 90s night what a buzz lol . Sports bar really with many tvs showing sports .if you want a pub with atmosphere this is it not for the faint hearted lol would defo go back if I visited again .

site_logo

marcus bailey . 2022-09-25

MORE AT Google

This is the second time I have eaten here and is still amazing.. I was served by the blonde waitress both times who is so helpful and friendly which with the good food made the visit well worth while.. will be eating here again

site_logo

Digibluephotos . 2022-09-22

MORE AT TripAdvisor

Nice to see the new owners have invested in giving it a refurbishment to a good standard, drinks and staff really good

site_logo

Jeff Sutton . 2022-09-03

MORE AT Google

Pub was good but toilets look like they haven't been cleaned for a couple of days and no toilet paper. Seats of ladies had traces of feaces on them

site_logo

Jackie Adams . 2022-07-30

MORE AT Google

Love it here, the bar staff were very attentive and the drinks were lovely. Since we weren't allowed to take drinks outside by a certain point in the night, the bouncer lady was more than happy to watch over our drinks while we went for a smoke, massive thanks for that. :) The music is also amazing and the pub itself felt very welcoming and comfortable. Great experience. :)

site_logo

blue bo . 2022-07-23

MORE AT Google

Been here a couple of times to meet up with friends while on holiday. Nice clean traditional pub with good choice of drinks. Food very nice too. Definitely worth a visit. Will be returning.

site_logo

Tom Valentine . 2022-04-28

MORE AT Google

What a pleasant surprise, under new management and what a difference. Sparkling clean, and comfy.Staff were helpful and obliging. Sunday roast was the best we have had in and around Kings Lynn, great choice of 8 different vegetables , meat was tender and tasty, home made Yorkshire puds. Brilliant. Already booked for next week.

site_logo

Marionbird . 2022-04-13

MORE AT TripAdvisor

Ideal area for after funeral buffet,comfortable and friendly.

site_logo

Helen Hutchinson . 2022-04-02

MORE AT Google

Lovely, traditional pub, great staff and reasonable prices.

site_logo

Jane Attwood . 2022-04-02

MORE AT Google

Good food but bloody cold get that door fixed

site_logo

David Lake . 2022-03-17

MORE AT Google

First visit in 2yrs, lovely Sunday carvery, 3 meat choices and good selection of vegetables, highly recommend.

site_logo

GBeavis . 2022-03-06

MORE AT TripAdvisor

Excellent quality food and comfortable atmosphere

site_logo

Nick Harper . 2022-03-05

MORE AT Google

Start to finish a pretty awful experience. Every basic ask was too much of an inconvenience. Barman had no idea what they could or couldn’t do at all. Food was average at best. Terrible service. Was clear we were unhappy with everything but no acknowledgement whatsoever

site_logo

D C . 2022-03-04

MORE AT Google

Best roast I’ve had out the beef was cooked to perfection. Wide range of tasty vegetables. All staff very friendly and we’re very cheerful. It was a lovely atmosphere.

site_logo

diana b . 2022-02-28

MORE AT TripAdvisor

Wonderful little pub - very friendly and helpful staff, delicious food and good drinks selection. Highly recommended.

site_logo

peter ficken . 2022-02-26

MORE AT Google

Absolute dreadful & disgraceful meal last night 18/02/22 Both mine and partners meals were of a very poor standard Steak and ale pie that was just about OK, Brocoli and Mash that was indelible, never tasted anything as disgusting as red onion mash,the gravy came with thick skin on it disgusting and extremely poor value. Fish was disgusting and my partner said the bread that came with it was stale,left most of meal. The chef and management should be ashamed of them selves.

site_logo

Tango White . 2022-02-20

MORE AT Google

We popped in this pub as we were staying next door at the Dukes head hotel and we thought just how nice it was inside for our first visit ! I had such a tasty pink gin with fresh strawberries I popped back in a few hours later and had another tasty pink gin ! We sat by the window and watched the Mart fun fair outside ! X

site_logo

debbie budd . 2022-02-15

MORE AT Google

The place is absolutely gorgeous now. Lots of lovely antiques which you can buy. We went for a cavery roast, which sadly was a bit of a let down. The beef was a bit over cooked, the veg was not great at all, carrots overcooked, there was peas and sweetcorn,and cabbage, cauliflower cheese which was coming to the end of the tray, but the server scraped out enough for me, the roast potatoes were okay but dry. My daughter in law went next and she was shocked that he literally scraped the tray either all the end bits. I think they need more choice of vegetables. Such a shame that we were all disappointed. The saving grace was a very nice and delicious choice of puddings.

site_logo

Shirley Rumens . 2022-02-01

MORE AT Google

Called here for an evening meal and it certainly did not disappoint, the food was excellent, the staff were friendly and polite. The place itself was lovely and clean. Highly recommended for an evening meal.

site_logo

Daisy Moss . 2022-01-24

MORE AT Google

Nice little pub on the square in Kings Lyn. Also a small Carvery. Surprised they only excepted card payment.

site_logo

Robert Rolph . 2022-01-23

MORE AT Google

Just popped in for a light lunch after a walk around kings lynne, food was lovely and reasonably priced. staff were lovely and helpful.

site_logo

kennyh182 . 2022-01-18

MORE AT TripAdvisor

Food was great,lots of vegetables, a bit slow in service because of covid but worth the wait

site_logo

Me McGee . 2022-01-15

MORE AT Google

Very welcoming staff and a lovely local public house. We opted for a toasted baguette with different fillings which were all perfect. Will recommend this place for any who are in the area.

site_logo

Damian Howlett . 2021-12-31

MORE AT Google

I booked this restaurant for Christmas Day & a payment of 50% (£69.95) was taken from my account at the time of booking. However, despite my telephoning/emailing on many occasions, I was never sent confirmation of my booking - nor any indication of any Terms & Conditions. I also did not receive any menu from which to make choices for our meal - which I had been advised needed to be done in advance. Any attempt to access the website threw up a message that the domain did not exist! I was beginning to lack confidence that my booking had been properly processed & concerned that there might not be a meal available - but, then, unfortunately I had to cancel when my partner tested positive for Covid. On contacting the restaurant, I was advised that none of my advance payment would be repaid. To retain £70 seems an excessive amount, given the way the booking had been dealt with and the fact that no food choices had been specified.

site_logo

Chrisvkns . 2021-12-30

MORE AT TripAdvisor

Had super carvery after Thursford Show choice of three meats six Vegas etc massive yorkies pleasant staff all good puds will be back when in Kings Lynn thankyou all

site_logo

Rita Dunmore . 2021-12-13

MORE AT Google

I've been in Kings Lynn for 4 year and never came here before because someone told me it was dodgy. But it isn't! The friendly barman had a Christmas jumper on. There are clocks everywhere, all telling the wrong time, and chairs. There's one big round table at the back where you might imagine Yakuza guys playing cards.

site_logo

Dan Tansey . 2021-12-09

MORE AT Google

was a lovely dinner good service and very friendly

site_logo

Cass . 2021-11-29

MORE AT Google

Amazing food definitely going back again

site_logo

Jamie Sandom . 2021-11-25

MORE AT Google

Great atmosphere and friendly staff

site_logo

neville luck . 2021-11-14

MORE AT Google

Very quiet, friendly staff member.

site_logo

Pamzilla C . 2021-11-10

MORE AT Google

Lovely old pub and staff very friendly 😀

site_logo

Ray Jenkinson . 2021-11-09

MORE AT Google

Popped in for a pint of Guinness while shopping. Very nicely decorated throughout. But very pricey for me £4.75 for my pint . Pay that in London not King's Lynn . Won't be back

site_logo

Gazzanorfolk . 2021-11-06

MORE AT TripAdvisor

Food is good and value for money, beer is also good. We went in twice, staff nice and welcoming, they could maybe make the dining area a little more inviting.

site_logo

pne2163 . 2021-10-30

MORE AT TripAdvisor

Went yesterday for our grandson birthday. The barman could not have been more polite or helpful. Venue was nice enough but really let down by the fact they have hardly any staff at all. The poor barman was ran off his feet, serving customers at the bar, taking food orders and clearing of all the tables. What was difficult for him on top of doing everything else was that just about ALL the menu was unavailable, we ended up having burgers...the food took well over an hour to arrive, when it came it was ok Y

site_logo

Sharon BARNES . 2021-10-29

MORE AT Google

After my previous review I was messaged by the new owners to tell me that much had changed and they were worth a revisit. So took a gamble on it, as we were out for a show at the corn exchange. Just drinks for starters. On arrival it was clear that there were not enough staff, only one person behind the bar, and there was a queue even at 6pm. The person infront of me had to order 3 different meal options before one of them was available, this did not bode well. I had a Pint of Wherry which was very nice, and was going for a second, however the pub was getting busier and the one bar person was now even more under pressure to wait tables and bar serve. I watched as 5 people entered the bar, waited patiently and then left because they simply could not get served, as the bar person was having to stop serving drinks and go serve food. I gave up on the idea of a second pint of Wherry, and left. The experience could have been so much better with just one more person behind the bar.

site_logo

Derek H . 2021-10-29

MORE AT TripAdvisor

Great place, decor mixed old and new, very good. Bar man fantastic. So friendly. Food was amazing. Tasty, hot and large portions. Excellent value for money.

site_logo

pat turner . 2021-10-27

MORE AT Google

Nice pint and nicely refurbished pub, recommend a visit.

site_logo

paul grainger . 2021-10-23

MORE AT Google

Similary restaurants in East of England

restaurant_img
4.1

814 Opinions

location-iconHanse House, South Quay
British
outdoor_seating_140821takeaway_140821delivery_140821

Booked using the booking app for 23rd Dec using the Dojo booking app to find the restaurant closed and now our Radio West Norfolk Voucher is out of date as is our friends who turned up twice to find the restaurant closed even thou advertised. Both of us are now out 9f pocket. No answer on the phone and email not recognised

restaurant_img
4.0

75 Opinions

location-iconThe Duke's Head 5 Tuesday Market Place
British
outdoor_seating_233900takeaway_233900delivery_233900

Great food and atmosphere very relaxing

restaurant_img
4.1

459 Opinions

location-icon70 Main Road
British
outdoor_seating_140831takeaway_140831delivery_140831

Wasn't open, been shut for ages now 😒

restaurant_img
4.0

902 Opinions

location-iconMain street
British
outdoor_seating_186516takeaway_186516delivery_186516

My regular stay for relaxing and lovely walks with my dogs , always feel welcome and room always perfect . Food very good too! Nothing too much trouble …

restaurant_img
4.0

439 Opinions

location-iconHeacham England
British
outdoor_seating_251197takeaway_251197delivery_251197

We were coming out of Heacham wondering what to do for lunch when we stumbled across the unsigned carpark on the Heacham side of the traffic lights, there's a crossing to Norfolk Lavender . We had a lovely seafood salad from the specials board which was surprisingly good value for a tourist attraction.Gluten free bread was available with it and they were able to remove any onion (low fodmap required) . There's not much else open yet apart from the farm shop which had surprisingly few lavendar-related foods for sale.