GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.9

Based on 3.794 opinions finded in 2 websites

site_photo4

Nº 476 in 731 in North Somerset

Nº 87 of 146 British in North Somerset

CUSTOMERS TALK ABOUT DISHES WITH..paybaconsteakcurryoldchickenladycreamsteakspiecheesepastafishburntcookedmustroast

comment_iconOpinions

We went to have a meal for my son’s birthday. The pub was semi clean and busy! The food arrived very fast after ordering it! And after we started eating it you can see why it was so fast? We all had mixed grills apart from one, but the food was clearly pre cooked and held in a hot plate! Peas were looked like they was cooked in the morning! The chips were very over cooked and dry. The sausage was also dry and hard and also seemed like it was from breakfast time! The chicken! Clearly was cooked and held a long time before serving as it was falling apart and a brown/gray colour. Gammon was chewy, and the pineapple ring felt like it was straight out of the tin and touched the grill and then served. The steak was supposed to be medium? But was well done. The only thing that we could say positive was the 2 little onion rings and the egg Wer cooked to order! Again everything else was CLEARLY PRE COOKED and VERY DISAPPOINTING. Very POOR and SHODDY EFFORT. Sorry to say! But we wished we’d have slummed it and gone to WEATHER SPOONS? VERY POOR SHOW..

site_logo

Lee Brimble . 2025-04-18

MORE AT Google

Deb was lovley ! Really smiley and friendly. Food was great as always

site_logo

T Burgess . 2025-04-18

MORE AT Google

Lovely server Debs and food a bargain 👍🏻💈❤️

site_logo

dean fuidge . 2025-04-18

MORE AT Google

Who is he? He is in front of the station. It's cold. This good ice cream

site_logo

Stacey The Leroy . 2025-04-17

MORE AT Google

Jayne was lovely and very attentive. Made my nephews 13th birthday a very special day. One little food complaint was sorted straight away. X

site_logo

Genevieve Cronin . 2025-04-17

MORE AT Google

Food was very good, only had to wait about 10 min for a whole breakfast

site_logo

Finley . 2025-04-16

MORE AT Google

Food came out very quickly and was enjoyed by all in our party. Jayne was great at helping with any requests we had and didn’t make us feel like a burden for asking for things we needed as well as ensuring the empty plates were cleared promptly between courses.

site_logo

Kate . 2025-04-15

MORE AT Google

Amazing atmosphere, lovely food and the best service from the staff, also dog friendly!! Yuka, one of the bar staff, is lovely!

site_logo

Terri-lee O'Reilly . 2025-04-14

MORE AT Google

Had good food and drinks and was dog friendly, staff were lovely

site_logo

Shhh . 2025-04-14

MORE AT Google

Deb was great today great service, very friendly and lovely food.

site_logo

Tina Nelmed . 2025-04-09

MORE AT Google

Busier than a bee realise by its extremely late for the honey season and the queen is fully fuming. That said oh the nectar. Delicious.

site_logo

Jastacasta Prius . 2025-04-07

MORE AT Google

The food was great and the recommendations made by chloe were excellent, will definitely be back!

site_logo

Mitchel Bidder . 2025-04-07

MORE AT Google

Always a good time at the lodekka!

site_logo

Gabby Ruggiero . 2025-04-07

MORE AT Google

Not the best,,, combo starter ok,,, fish main course was good ,,, my son had 3 chicken mix with fries salt and pepper seasoning was crap and served in dirty bowls,, when I mentioned it to the server he disappeared quickly, safe to say we won't be back.

site_logo

Joan Batt . 2025-04-06

MORE AT Google

Nice food, and some history to the place!

site_logo

Theapc06 . 2025-04-06

MORE AT Google

An amazing place to come and eat some food and get some drinks all the staff are very helpful and polite it was a good experience and I will definitely be coming back

site_logo

Diego Osmond . 2025-04-05

MORE AT Google

Was my first experience at a hungry horse was super excited after having lots of positive reviews from friends suggesting I go try. Ended up being a massive disappointment, food came out cold and incorrect to what we had order, extras had been forgotten but charged. the food came out cold, when we asked the waiter to take the food back he was hesitant to take the food back to the kitchen, we had to ask several times. When the food came back out it had just been put into the microwave the dish was dry greasy and flavorless. No one came to check again if the food was okay, no refund was given, we ended up just leaving. Such a shame since it’s seems like a lovely family pub/restaurant

site_logo

Antonia Kennington . 2025-04-04

MORE AT Google

We come regularly for breakfast, they have a good menu for breakfast, service is always good we get served by Deb who is always very efficient the cornflake chicken breakfast burger is lovely

site_logo

Julie Wring . 2025-04-04

MORE AT Google

Deb was lovely and attentive as always so kind and helpful really lovely.

site_logo

Luke Smith . 2025-04-04

MORE AT Google

Very nice food and customer service as always very friendly. A Very nice environment to be in while enjoying a meal too. Staff is always nice.

site_logo

Jack Pearce . 2025-04-03

MORE AT Google

Yuca is the best so friendly and help. Jamie also makes a fab blue lagoon

site_logo

Gamz . 2025-04-02

MORE AT Google

We tend to go here for a Sunday lunch, lunch and a drink for £11, it used to be £10 but £11 is still excellent value. The roast is about average to what you would expect but plenty good enough for the cost. The other items on the menu look great, such a lot to choose from so will be back. They also have daily deals on food to, if it was closer to my house I would be in there more I'm sure. Also have tvs around one side of the pub for sports and the other side is more for dinning. Staff always happy and helpful so all in all a good all rounder

site_logo

Phil S . 2025-03-31

MORE AT Google

Great experience with lovely staff and good customer service. Would come again.

site_logo

Emily Jordan . 2025-03-30

MORE AT Google

Mothers day meal for 4 generations was lovely today. Sunday roast was very tasty.

site_logo

Richard Hartles . 2025-03-30

MORE AT Google

Laura went above and beyond to keep us happy 10/10 would eat again

site_logo

scott jones . 2025-03-29

MORE AT Google

Great time at lodekka, bar staff always helpful and friendly.Good food and very good customer service from Clare and Laura. Top notch..

site_logo

Andrew Tripp-edwards . 2025-03-29

MORE AT Google

Came for food. It was brought out by Ellie. The service was great was approached by Laura who asked if food was okay and it was excellent. Will definitely come back

site_logo

katherine porter . 2025-03-29

MORE AT Google

Service from the team is always excellent. Food is always to standard.

site_logo

Martin Beard . 2025-03-28

MORE AT Google

Yuka was amazing, always smiling excellent service!

site_logo

Maryam Ali . 2025-03-26

MORE AT Google

Very busy if you like that sort of pub

site_logo

Neil Tanner . 2025-03-24

MORE AT Google

Get what you pay for… can’t complain

site_logo

Ethan Boucher . 2025-03-23

MORE AT Google

Nice garden. Fast service. Toilets were pretty clean.

site_logo

Matt P . 2025-03-21

MORE AT Google

Excellent food and service from Deb I love this place good food good prices

site_logo

Leon Perkins . 2025-03-19

MORE AT Google

I had a great experience today. Jamie, a lovely staff member was super kind and thoughtful and restored my faith, that there are still some decent people in the world. Thank you Jamie 💙

site_logo

Lou Mac . 2025-03-18

MORE AT Google

The service was good. Food heated up, it was quite dry.

site_logo

Caroline Steadman . 2025-03-17

MORE AT Google

Great service, like the fact they have sports on across the pub, the adult mains are good value, kid's Bolognese was a bit disappointing.

site_logo

Victoria Hinde-Taylor . 2025-03-16

MORE AT Google

Six of us had a lovely lunch thankyou Lodekka

site_logo

Patricia Morel . 2025-03-15

MORE AT Google

Fantastic as always, thank you Scott and team!

site_logo

Beccy Morrish . 2025-03-15

MORE AT Google

Brilliant pub Chloe and Claire was amazing will come again

site_logo

Destiny Osmond . 2025-03-14

MORE AT Google

Popped in here for a drink with some colleagues. Just had a coffee, no food. It seems a basic family place to come.

site_logo

Christine James . 2025-03-14

MORE AT Google

Great service, amazing food and overall great environment. Definitely recommend

site_logo

Will Osborne . 2025-03-13

MORE AT Google

The food was very nice. Big portions to. The deserts were huuuge! The service was good. We had a dog with us and they brought over a bowl of water. Good way to win us over. The atmosphere was just your average atmosphere realy. Nothing special realy to note.

site_logo

Thomas Caddick . 2025-03-12

MORE AT Google

Went there for a family birthday. Five adults. Four of us had roast. One asked for no peas. We did laugh as they gave all of us no peas. Meat was a bit tough. The main complaint was 2 of us had a glass of wine. I know dishwashers can leave a residue on the glass. These two glasses were covered in lipstick all around the rims. It was that bad have no idea how the staff member didn't see it. Put all of us off going there again. I would not recommend any going there for a meal. Was about to say, just go for a drink, but that was worse. We won't be going there again. Not like the other Green King pubs.

site_logo

Anniemac Osmond . 2025-03-10

MORE AT Google

On a buget? Great place to eat.

site_logo

malcolm . 2025-03-10

MORE AT Google

Nice place, had a lovely Sunday lunch and Kyle was super helpful with his recommendations! Will be back soon

site_logo

Ugne Mi . 2025-03-09

MORE AT Google

We booked a table for 17 people for a birthday and we had the best family day to celebrate. There was a slight mix up with the table but no big deal and it was dealt with quickly. A lovely, relaxing and comfortable atmosphere. All staff were helpful and thoughtful. Great food with great prices as well. Thank you!

site_logo

sam Keegan . 2025-03-08

MORE AT Google

Generally a good place with generally good staff (some are really good). A little pricey for what you get perhaps. If you prefer to order through the app, that can cause problems as it can be misleading/not clear particularly where allergies are concerned. They also have a weird policy of not topping up coke if you don’t want ice which kinda points to a head office which values penny pinching over an overall more straightforward customer experience. The play area outside is a handy addition too although it has seen better days. Overall I’d say the thing holding this place back is the bean counters at head office.

site_logo

Stuart Fear . 2025-03-08

MORE AT Google

Came here today but have been here many times in the past. I can honestly say this has been the best visit ever!! The staff was friendly, always smiling and can see the staff have a good team spirit, very jolly, laughing with the customers. The food was came out fast and very hot, which was surprising compared to last visits which was about a year ago. Debbie your waitress was lovely, asked if everything was ok, cleaned our table straight away, when we came in to sit down. Answered our questions, when it came to recommendations, letting us know the offers we had on too, just very helpful 😊 Atmosphere was so warm, comfortable and welcoming, I won’t wait again so long to come here again. Thankyou to the whole Team. Linda x

site_logo

linda ewart . 2025-03-07

MORE AT Google

Outstanding value and 5 star for its banding of cheap and cheerful pub grub. Excellent variety of combo meals and different cuisines. Typical order at the bar with table number, Had the Ultimate sharing platter between 3 and we all went for the Burger Sizzler Combo and Sizzler is right! Skillet was searingly hot in a great way! Food was nicely comforting and filling a cheeky Guinness Zero to wash it down, great company chatting movie shiz with me pals while sport was on in background. Defo will go back, and all the staff were smiley, friendly and talkative! Great Thursday break from life. Highly recommended.

site_logo

Christopher Baker . 2025-03-07

MORE AT Google

Ellie was amazing at serving even though she doesn’t like Guinness

site_logo

Toby Swaffield . 2025-03-06

MORE AT Google

Really yummy food and great service from Ellie! Will be returning very soon!

site_logo

Kyle Price . 2025-03-05

MORE AT Google

Great pub with a great atmosphere, we were served by yuka today who was lovely.

site_logo

David Hopkins . 2025-03-04

MORE AT Google

I visited the Lodekka today and was served by Deb. Service was excellent and she even went out of her way to engage with the kids, nothing was too much trouble.

site_logo

Rachel Stenner . 2025-03-02

MORE AT Google

It was very busy when we arrived but we managed to get a table. The kids loved the play area in the garden and my husband loved the football was on the tv. Food was quick and cooked well. Overall, great and we will be back.

site_logo

Joanne Black . 2025-03-01

MORE AT Google

Love coming here the food is great nice and hot. Friendly staff special thanks to Deb for looking after us today

site_logo

Pauline Stone . 2025-02-28

MORE AT Google

Lovely service provided by the one and only lovely lady, Jayne. 👍🏼

site_logo

Adrian Janowski . 2025-02-28

MORE AT Google

Food and service from Jayne very good. Only complaint is the door to garden being rather violent and drafty!

site_logo

Sam . 2025-02-28

MORE AT Google

Ellie and Robyn served me. Lovely staff. Welcoming atmosphere. Good drinks suggestions.

site_logo

Mya Campbell . 2025-02-27

MORE AT Google

Had a lovely meal in here with a friend. Yuka gave a fabulous service and was very friendly and so did Karl. They were both polite and professional willing to help with anything needed.

site_logo

Annabelle Huntx . 2025-02-26

MORE AT Google

Excellent value breakfast and coffee. The pub could generally do with a refit as carpet and furniture is very tired but this is reflected in the price you pay. The food and service is always very good at Lodekka. I enjoy a breakfast here on a Friday morning as it's not too busy. It can get very busy during the evening and at weekends.

site_logo

Hans Gruber . 2025-02-24

MORE AT Google

Deb was very accommodating to the questions we asked about the food definitely coming again.

site_logo

Hannah Smith . 2025-02-23

MORE AT Google

Great pub, we come here every Saturday, always served quickly and everyone is happy to help, saw Chris today who was attentive.

site_logo

Char Silsbury . 2025-02-22

MORE AT Google

Gran restaurante para comida sabrosa, bien precio especialmente "ofertas diarias" y nos parece que el personal es muy amable. ¡Las alfombras podrían hacer con la limpieza / reemplazo!

site_logo

JS-JN . 2025-02-21

MORE AT TripAdvisor

It's always good value, and the staff are lovely - they always make us feel welcome.

site_logo

Lucinda Smith . 2025-02-21

MORE AT Google

Came here this late afternoon on the off chance and was absolutely amazed by the quality of food. Outstanding service and was quickly served. My 2 sons had steak which was like 7/10 as it was overdone as they wanted medium but they eaten it and mine and my partners food was outstanding.

site_logo

Nicola . 2025-02-20

MORE AT Google

Foo nor cooked properly, not tasty and cold .

site_logo

pedro santos . 2025-02-20

MORE AT Google

Lovely meal and great service from Deb

site_logo

Elize Maratty . 2025-02-19

MORE AT Google

A chain... but well run... Good food and excellent service....well done ✔️

site_logo

Pete Franklin . 2025-02-18

MORE AT Google

Yuka is my favorite member of staff. Always happy and very helpful.

site_logo

Sam Lewis . 2025-02-17

MORE AT Google

Great service from all the staff. Always welcoming and drinks are a good price

site_logo

David Hulcoop . 2025-02-16

MORE AT Google

Friendly atmosphere decent food. Food could have been a bit warmer but that’s probably my preference! The cauliflower cheese was very lacking in cheese so it was a bit bland. Venue itself is clean and tidy and staff are welcoming and friendly. Despite the ‘porch’ area, there still seemed to be a cold draft coming in from the front door whether that was the door being left open, I’m not sure. But otherwise a good place to meet with friends and family.

site_logo

Deniece Wheatley . 2025-02-16

MORE AT Google

All staff provided brilliant service, especially Kyle & Charlie. The food was the best that I have had in a Hungry Horse, and they were very accommodating for my dietary requirements. I will be coming back again when I am in the area!

site_logo

Austin Richardson . 2025-02-15

MORE AT Google

Great location. Typical pub food with generous portions. Lots of very friendly staff. Very reasonable prices.

site_logo

Susan Robinson . 2025-02-15

MORE AT Google

The food and service was amazing! Thank you Chris for your welcoming and warm service!

site_logo

Rebekah Wright . 2025-02-13

MORE AT Google

Lovely staff. Making sure we had what we needed. Very friendly place

site_logo

Laura Nelmes . 2025-02-13

MORE AT Google

Out for birthday meal and it was lovely

site_logo

Jayne Brown . 2025-02-13

MORE AT Google

Could the staff not speak foul with customers, wasn’t pleasant to listen to while eaten ,

site_logo

Neat Carter . 2025-02-12

MORE AT Google

Great food, great service, great selection

site_logo

Little Kernow . 2025-02-09

MORE AT Google

Food was out within 15 minutes. No issues with food. Great service.

site_logo

Beginner Tutorials . 2025-02-09

MORE AT Google

£1.40 ish for 1 piece of toast with an already expensive breakfast??! More than £3.50 for a lemonade (not bottled, from their pumps). Cheap ingredients, small portions, and not cheap prices

site_logo

Anthony Noble . 2025-02-08

MORE AT Google

Food was good, came out very quickly and was hot. Good portion sizes as well

site_logo

Rachel Burrett . 2025-02-08

MORE AT Google

Always enjoy coming here with my toddler on a Saturday morning, good value and he loves the breakfast! Always welcomed here by Clare and Chris

site_logo

Chris Jones . 2025-02-08

MORE AT Google

Every time we come in to eat we receive a great meal and fantastic service.

site_logo

Jane Tolhurst . 2025-02-07

MORE AT Google

Service was quick and very friendly, food was hot and served well and portion size is very good, would highly recommend for lunch or dinner for all the family

site_logo

Emma Richardson . 2025-02-06

MORE AT Google

Great value meal, friendly and quick service. Kyle was especially attentive and we loved his dulcet Welsh tones.

site_logo

Alanna Mcdonough . 2025-02-05

MORE AT Google

Went to the Lodekka on Monday for lunch with the wife had a great meal served by cholle the food was out real quick lovely and hot had jerk chicken and the wife had mixed grill we will definitely be back

site_logo

Mark Allyne . 2025-02-04

MORE AT Google

Always great service from all the staff especially Yuka, food fab, lovely pub will definitely recommend and be returning 👍

site_logo

Ian Rooker . 2025-02-03

MORE AT Google

Lovely staff very nice food and reasonable priced will be returning here in the future 😀

site_logo

Frank Chandler . 2025-02-02

MORE AT Google

Cornflake chicken was delicious

site_logo

greta fortune . 2025-02-01

MORE AT Google

Came in for bogof burgers. The quadzilla is the best!! Great live music and amazing staff working really well under pressure on a busy Friday night!!

site_logo

kelly dunn . 2025-02-01

MORE AT Google

Went to lodekka had burgers with my family. Service was quick and the staff were really nice. Live music was a nice touch as well.

site_logo

Samuel Murray . 2025-01-31

MORE AT Google

Had a great night the lady at the door was amazing showed us to our table cleaned it for us the fish and chips was outstanding the fish itself was amazing ,the toilets were very clean, ladies that was and being a NVQ qualified cleaner I pick u on everything,the atmosphere was electric ,there was a band playing called High Fly ,all the staff were so helpful I really had a great night ,thanks for a great night ,we will return soon 😀.

site_logo

Angie Davis-Hutson . 2025-01-31

MORE AT Google

I booked for my Husbands 50th birthday. We had about 16 in our party. The staff were very accommodating in allowing us to decorate and bring the cake prior to the arrival time. The food was brought out for everyone around the same time so we all ate together. The food was cooked to perfection. No complaints from anyone. All staff we interacted with were amazing with us all. We all had a really good time. Thank you

site_logo

Natasha M . 2025-01-31

MORE AT TripAdvisor

Lovely breakfast and continuous coffees very good price lovely staff

site_logo

Natasha Pitarella . 2025-01-30

MORE AT Google

Just had a great evening at the Lodekka, our curries were lush, and Jamie looked after us to make the evening perfect.

site_logo

Annette . 2025-01-29

MORE AT Google

Just had a lovely evening meal at the Lodekka, food cooked perfectly and with a lovely pint, well looked after by Debs, and the team.

site_logo

Christopher Bennett . 2025-01-29

MORE AT Google

JAYNE WAS AMAZNG AND FOUND US A TABLE AWAY FROM NOISY BOISTEROUS CHILDREN AND DRAFTY COLD BANGING DOOR OUR SAVIOUR THANK YOU JAYNE 🙏

site_logo

Sheila snook . 2025-01-29

MORE AT Google

Best service ever by Yuka. She’s very polite, pleasant always have a smile for all of her customers.

site_logo

Sabah Ahmed . 2025-01-28

MORE AT Google

Yuka was amazing. Shes the best!!!

site_logo

Karl Radford . 2025-01-27

MORE AT Google

Grim furniture, grim tables, grim cleaning, grim cutlery, grim drinks, grim toilets, grim food. All in all, proper grim.

site_logo

Cruiser592245 . 2025-01-26

MORE AT TripAdvisor

Similary restaurants in South West

restaurant_img
3.9

780 Opinions

location-icon1 High Street
British
outdoor_seating_99464takeaway_99464delivery_99464

Main attraction is the location. Beautiful little village pub. Lovely garden, friendly staff and nice food but a tiny bit pricey but that said everything was quality. Would go again and recommend!

restaurant_img
4.0

259 Opinions

location-icon1-3 Birmbeck Road
British
outdoor_seating_149655takeaway_149655delivery_149655

Watched the Euros here over the summer, great deals and friendly staff, been in for food and it was lovely. Can't wait to try the carvery

restaurant_img
4.0

106 Opinions

location-icon5-7 Birnbeck Road, Weston-super-Mare BS23 2EE England
British
outdoor_seating_260555takeaway_260555delivery_260555

Lovely service food couldn't be better

restaurant_img
3.9

478 Opinions

location-iconHigh Street
British
outdoor_seating_168474takeaway_168474delivery_168474

Proper pub; getting rarer these days.

restaurant_img
3.8

227 Opinions

location-icon20-24 Knightstone Road, Weston-super-Mare BS23 2AW England
British
outdoor_seating_241276takeaway_241276delivery_241276

Came with my wife, daughter and grandchildren.Everything is wonderful, great beer, amazing food and beautiful scenery,can't recommend enough 🙏