GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3,50

Based on 222 opinions finded in 2 websites

3.5Ambience3.5Cuisine3.5Price3.5Service
site_photo4

Nº 194 in 234 in Purbeck

Nº 70 of 77 British in Purbeck

CUSTOMERS TALK ABOUT DISHES WITH..eggcurryoldmuststeakcookedfishladypiechickensaladvegetablesroastmeat

comment_iconOpinions

Had booked a table for Sunday lunch. Arrived to find the floor was still being vacuumed and only one table was laid and we were the only customers. Gave drinks order then, when brought , gave food order. It arrived between 5-10 minutes later. We were convinced the food had been heated in a microwave, my husband’s beef was tasteless and veg was undercooked and gravy was watery and flavourless. My chicken was a chicken portion not even sliced. When we left about 40 minutes later there were three more tables occupied.

site_logo

Fiona M . 2024-04-22

MORE AT TripAdvisor

Family and I decided that we didn’t fancy cooking on a Friday night, so made the commute to the Holme bush. Atmosphere was ok, there was an awesome guy doing karaoke, honestly the high point of the experience. Me and my dad have a sort of tradition to always get a burger wherever we go, so thought why not get a “gourmet burger”(£15). Service was good, tables were greasy, making you have to uneasily sit with your hands on your lap. Before our food had even been set down, we both could already tell what we were in for. To put it simply, I would expect a better quality burger for £3 from a fairground stand. The patty was made of gristle, was underwhelming in size, and lacked any sauce in the burger, not even toasted or buttered buns, just dry, defrosted 5p slabs. The burger was missing fried onions and had a measly slice of American cheese thrown on top of the patty. If that doesn’t properly put into perspective how awful it was, this might: I was about to empty the contents of my bowels into my trousers within 20 minutes of finishing the burger. Honestly worst burger I’ve had in my life.

site_logo

James S . 2023-11-16

MORE AT TripAdvisor

Had an amazing experience & food at Holme Bush in, new chef & new menu. Staff where very welcoming, & they where happy. Yes was quiet but they where always doing something they came over to the table & took my drink order they where given quickly & food order was taking & the food was absolutely beautiful couldn't fault the food or service

site_logo

Shanice T . 2023-10-27

MORE AT TripAdvisor

Arranged to meet here when family were visiting the area from various locations around the UK. I was a little bit apprehensive TBH, but I have to say it was a very enjoyable evening. The young lady behind the bar, who doubled up as a waitress did a sterling job and was a genuinely nice person. The food was what I would expect from a pub, wholesome and not overpriced. We all thoroughly enjoyed the evening and would recommend the Holme Bush Inn.

site_logo

David H . 2023-10-23

MORE AT TripAdvisor

I really loved this pub. On a holiday weekend in the area, we called in for Sunday lunch after a long walk. The service was really friendly, but also very respectful. All five of us ordered the roast beef Sunday lunch. Nothing fancy, just really good, high quality British food. Very generous proportions, everything you could wish for in a Sunday lunch. And good value too. Very difficult to fault. Well done!

site_logo

Michael P . 2023-10-01

MORE AT TripAdvisor

Very poor service and food was not as you would expect compared to other pubs of the same price. Will not return

site_logo

Trevor D . 2023-09-17

MORE AT TripAdvisor

We decided to visit our local pub to see the live music that was taking place in the afternoon particularly the Rogues and Vagabonds Band. The garden is great in the sunshine and a perfect place to soak up live music while enjoying the wide variety of beers and ales and enjoying the afternoon barbecue. All well priced. A top music pub.

site_logo

davesL6016SK . 2023-09-01

MORE AT TripAdvisor

I have passed this public house on numerous occasions, so decided to take my mother for an early evening meal on a Friday. Although there was a limited menu, there was enough variety to satisfy most people. I booked a table and as met by a friendly member of staff who showed us to the table. Ordering was by table service, which was prompted and courteous. I had Hunter's Chicken, whereas my mother has a starter (prawn cocktail with marie rose drizzle) as she has a small appetite. The food was served promtly and was delicious. The staff were very attentive and made sure that everything to our satisfaction. Payment was made att the bar, and there were two very satisfied customers.

site_logo

Sara D . 2023-08-14

MORE AT TripAdvisor

Landed by there by serendipity; I was out of luck that fay: the pub is plain dirty and the food is horrible. I am more than ok to pay 13.95 for a burger, but when the food feels like the £1 deal you get from IKEA, this is a rip off. Soggy bread, not even toasted in the pan, Aldi mayonnaise (I saw the 5l tin in the kitchen), faded salad and burnt low quality frozen burger. There you go. The next table (6 people) ordered fish and chips and carbonara, and they were looking at each other when the food arrived. Side note, they also have a campsite: 20£ for a single person tent. No showers, and the only toilet you can use is the pub's, which was full of Pisa and shot on the floor.

site_logo

dv272 . 2023-07-28

MORE AT TripAdvisor

What a little gem. Popped in for a quick pint with the family. Nice, spacious garden out the back. Stayed much longer than expected as there was a great live band (Vagabonds) playing. Barbecue was tasty and well priced. Very friendly staff. good range of beers. Will be coming back for sure.

site_logo

davesL6016SK . 2023-06-27

MORE AT TripAdvisor

Dont bother, the live music is so loud you can't hope to hold any kind of discussion. It could be amazing if they simply turned down the volume. I personally feel really sorry for any neibours as we could hear the music from the middle of Corfe Mullen while dtiving. Shocking disregard for others living nearby

site_logo

simon t . 2023-06-03

MORE AT TripAdvisor

Went for a drink and a bite to eat. Sorry, no chef tonight. Had a couple of rounds of drinks, served by as miserable a barman as you would ever come across. Shame really. It's a nice pub, with live music, classic car nights, etc., and supposedly decent food. I was told that the staff on other nights were generally pretty cheerful, although the miserable barman was usually there as well.

site_logo

hughkevilldavies . 2023-05-07

MORE AT TripAdvisor

No Pork or cauliflower cheese. Lamb was nice. Meatless roast is just that. No meat alternative. Friendly staff. Make you feel welcome. I love craft beer. Would have liked more of an offering. Tins in fridges maybe. You have draft 8 arch brewery who are excellent. Why not some Tin’s? New management at the pub who are definitely moving in the right direction. Definitely got potential to be an excellent pub.

site_logo

Kevin A . 2023-04-09

MORE AT TripAdvisor

We stayed in the field attached with our caravan group. The Sunday roast was excellent value and others said the steak and ale pie and fish and chips were equally good. The staff were so helpful and friendly both to us and our dog (Lily) who was treated with a slice of roast beef whilst we had our roast. Andy, you have a friend for life! Good selection of beer and looking forward to going back in June, when it should be a bit warmer and drier! Live music most weekends which is a real treat. Excellent pub. Give it a visit

site_logo

Thewal2ns . 2023-03-29

MORE AT TripAdvisor

Excellent Sunday Roast cooked by Anne hope to see you all next Sunday. Good selection of beers and largers and friendly atmosphere don't forget to come along on Friday nights for the music and maybe a bite to eat .

site_logo

U5059HDronc . 2023-01-09

MORE AT TripAdvisor

Group of friends decided to give this pub a go as they have advertised a new chef! . The food is pub grub , but the quality of food on the night we visited was disappointing. The pasta in the lasagna was hard and raw, the hunters chicken was inedible and the meat in the pie was not steak! We have always visited pub that serve homemade/ home cooked food and . In our group of 10 not one person enjoyed their meal as reflected by the food left on plates The pub was empty apart from our group and there was no atmosphere friendly welcome . If you are looking to eat , we would not recommend this venue based on our experience - there are several other pubs in the area offering good food and much better value for money. Hopefully with a new chef on board the food will improve

site_logo

Lesley M . 2022-12-10

MORE AT TripAdvisor

We were served off-tasting beer and several reasons why three of us couldn’t be right that it was off. Manky glasses with lipstick marks and crusty residue. Decidedly average food. Will not be back... so disappointing we chose to break our lockdown here.

site_logo

alunfowler71 . 2021-04-16

MORE AT TripAdvisor

The plan was to go for a nice Dinner for two. Sadly the place was overrun by loud foul-mouthed yobs with their children who ran amok, continually effing and blinding (the adults, not the kids!). No masks worn and no attention to COVID precautions as they went through the pub to the outside every few minutes for a cigarette break. The evening was ruined and we left half way through the main courses. The staff should take action against shouting and swearing and kids making a racket . They certainly should intervene when masks aren’t worn and customers disregard precautions. No wonder only one other table was occupied, and this was a Saturday night. The food (or what we tasted before leaving) was ok.

site_logo

PDgooner . 2020-10-10

MORE AT TripAdvisor

My Wife and I have stopped on this campsite before and can recommend it, We can also recommend the restaurant here as the food is always freshly cooked to order, we also feel safe because they are sticking to the Covid guidelines as regards track and trace and social distancing whilst other pubs around here don’t seem to bother much with that kind of thing.We would highly recommend The Holme Bush Inn, as nothing is any trouble at all and the food is excellent Martin & Sue 2nd September 2020

site_logo

435martinr . 2020-09-03

MORE AT TripAdvisor

Been there a number of times and it's always pleasant, with a beer garden, several rooms inside, and a good selection of beers and ciders, including draught Purbeck Cider. It's also nicely set up for our socially distancing times, unlike some pubs who clearly don't take it seriously!

site_logo

daveydor . 2020-09-01

MORE AT TripAdvisor

There aren't many places these days where you can pop yourself in front of a real fire. One with wood, and flames, that bring a smile to your face, and make you feel warm before you sit next to the fireplace. Coffee was good. The pate was exceptional...just a starter but a meal in itself, lovingly prepared, and cheerfully served

site_logo

JPMcLMartin . 2020-01-08

MORE AT TripAdvisor

Grate atmosphere and lovely food clean toilets and baby changing is so clean will recommend this place to anyone.

site_logo

90Kirk . 2019-12-29

MORE AT TripAdvisor

Excellent pub with very good food especially the sunday roast all very tasty, locals all friendly and staff very polite and helpful , very clean throughout, good site for the motorhomes and caravans.and a lovely garden as well.

site_logo

John A . 2019-08-18

MORE AT TripAdvisor

We met there with friends for a lunch stop and had allowed 90 minutes but that proved to be too little even though the pub was not very busy. When it arrived, the food was good but the service was so slow it has put us off going again.

site_logo

DinoC61 . 2019-07-27

MORE AT TripAdvisor

I had a great time at the holme bush inn, i enjoyed all the food we ate, I would highly recommend their chicken medley, and Jills homemade curry was amazing. We had really good service and the staff were very accommodating for us, i would definitely return here again! Their beer garden was great for a drink or two after, on what seemed like a brand new patio, with great seating outside with views of lovely green fields beside us.

site_logo

Gf1998 . 2019-06-13

MORE AT TripAdvisor

My wife and I where a week's holiday and found that the Holme Bush Inn has a CS Camping and Caravan Club site. We stayed for the whole week. The pub is also dog friendly.There is good range of real ale's which change regular from Razor Back, Proper Job, various ciders and lagers.We ate there few times there is s good menu and reasonably priced, certainly not disappointed all food is freshly cook, that gives you time to enjoy time with friends and chat.On most weekends there live music certainly well worth checking out.We will certainly be visiting again.

site_logo

David H . 2019-05-08

MORE AT TripAdvisor

Had to go to Corfe Mullen and decided to pop in and try out the restaurant, we were the only 2 eating so no rush! The menu and specials were interesting and varied. Our food was freshly cooked and piping hot. My gluten free desert was lovely and came with 2 scoops of ice cream.The barman made us feel very welcome. Having been unsure reading some of the older reviews we are very pleased we stuck with decision and didn’t go on somewhere else.

site_logo

ElizabethEnglish . 2019-02-16

MORE AT TripAdvisor

We visited on a Thursday lunchtime, big mistake. Only one young lady serving drinks at the bar, taking orders and bringing out the food. We ordered and waited for what seemed an age. When the food did come I was told my chips would follow shortly, needless to say I had almost finishes my Baggett when they arrived. They were the cheapest chips from the lowest grade of supermarket,tastles and greasy. My wifes salad consisted of a lettuce leaf a slice of tomato and a few carrot shavings! Perhaps things are better in the evening.

site_logo

irishrover42 . 2018-12-21

MORE AT TripAdvisor

Massive congratulations to Jill and her team for a magnificent evening on Weds 19th December.19 teams competed in a cheerfully challenging Corfe Mullen Carnival Committee Christmas quiz.Many had lovely meals prior to the quiz commencing just after 8pm.Bravo all concerned !!!!!!Nurse Gladys

site_logo

NurseGladys12 . 2018-12-21

MORE AT TripAdvisor

Have passed many times and haven't considered stopping but our visit was a surprise. Starting with the food (we had a roast) which was perfectly cooked it looked as though the menu and specials were inviting

site_logo

bradders242 . 2018-11-12

MORE AT TripAdvisor

Thanks to Jill and her team for catering for a wake. The buffet was an excellent spread and covered any and all dietary needs. The setting was perfect and was given a nice area to ourselves.

site_logo

Departure30394878415 . 2018-11-09

MORE AT TripAdvisor

Very nice stay over the last 2 days, Beautiful little place with a great traditional pub had a couple of meals there and they where lovely.The whole pub and outside was spotless and toilets where very clean, will be going back again as the roast on Sunday was the best we have had in years, all fresh tasty and hot. 5 stars.

site_logo

John A . 2018-10-28

MORE AT TripAdvisor

The moment you enter the bar, it is clear that the place is cared for clean and well run. We arrived at lunchtime at a time the pub had been closed for 36 hours. the first pint out was superb as were the subsequent ones. I had a a steak, perfectly cooked, my wife had a chicken dish. We were staying on the campsite at the pub which is also very good. it enabled us to have a few beers with the locals who were friendly and welcoming. This is how a country pub / restaurant should be run. Thank you to all.

site_logo

Gary D . 2018-10-25

MORE AT TripAdvisor

Sunday lunch at its best plenty of well cooked meat, veg and potatoes all served in a rich gravey. Followed by a great selection of sweets.

site_logo

pegman64 . 2018-10-14

MORE AT TripAdvisor

Great meal service and real ale as allways Steak chips peas onion rings my favourite meal I would not anywhere else

site_logo

mark1958n . 2018-09-29

MORE AT TripAdvisor

Worst food ever and made me feel ill after eating it. Dirty glass and things floating in my drink. Used to be a favourite place to eat when the previous owners were there but never again.

site_logo

Angel18Dorset . 2018-09-28

MORE AT TripAdvisor

I don’t know where the last reviewer actually ate his roast that day but it couldn’t have been at The Holmebush I frequently eat at!!! When Jill serves up food it is ALWAYS delicious, fresh and her gravy is never watery!!

site_logo

NurseGladys12 . 2018-09-27

MORE AT TripAdvisor

The beef was a pale grey colour and looked like it was out of date. The vegetables were vile and the potatoes stale. The gravy was clear and had no flavour! Luckily I got my money back. I will never return not even for a drink. Terrible

site_logo

Adam F . 2018-09-10

MORE AT TripAdvisor

Visited for on Sunday lunch time . A very warm friendly welcome. I had the chilli with home made Nachos,they were delicious. My partner had the roast beef which she said was lovely . We both had desert which were both top notch . Very pleasant lunch in deed can recommend enough . Excellent team with fantastic food who could ask for more.

site_logo

nickjd22 . 2018-08-14

MORE AT TripAdvisor

Nice welcome, good selection on menu and very enjoyable meals especially the chilli! Pleasant surrounds, helpful staff and even the toilets were a pleasure to use!

site_logo

thedaphneholmes . 2018-08-09

MORE AT TripAdvisor

I visited the Holme bush inn with friends and it was simply perfect, the food, the drinks and atmosphere was just great. We sat in the garden enjoying the sun and live music (which I believe they have on every Sunday afternoon)

site_logo

Sebastien C . 2018-07-14

MORE AT TripAdvisor

Fantastic Ultimate burger! Jill was really friendly and helped me choose the best meal for my hunger level!!

site_logo

sunsetsandsailboats . 2018-06-12

MORE AT TripAdvisor

Called in to have a bite to eat in what has become one of our favourite stops....

site_logo

mace-and-mace . 2018-04-02

MORE AT TripAdvisor

Myself and my partner were staying nearby so came here for dinner after viewing the menu online. A lovely little country pub with friendly staff. The beef lasagne was delicious as was the chicken burger, excellent quality of food and perfect portion size (despite being described as ‘lite bites’ they were full meals). The Doombar was “the best pint of doombar” my partner had drank and it was all definitely worth the reasonable prices.

site_logo

amd397 . 2018-03-18

MORE AT TripAdvisor

Friendly welcome and good food..... Beef lasagne tonight.which was delicious... Pie of.the day is always a good choice.

site_logo

Paul T . 2018-03-13

MORE AT TripAdvisor

Great pub and great atmosphere although surprisingly quiet this evening although that suited us perfectly.

site_logo

Gary C . 2018-03-08

MORE AT TripAdvisor

We took the kids out for dinner and decided to go to The Holme Bush Inn as local to us.

site_logo

bay29 . 2018-02-22

MORE AT TripAdvisor

My husband and I went tonight for our Valentine’s meal. It was absolutely delicious especially the sirloin steak and chocolate pudding. Very attentive and friendly staff too. Thank you so much Ronnie and Jonathon, we’ll be back Friday for the meat draw! X

site_logo

Emily698 . 2018-02-14

MORE AT TripAdvisor

I went for an early valentines dinner with my partner. The food and service were excellent and the staff friendly and very helpful. The meal was very good value for money. The chocolate mousse was to die for! Will definitely be going again.

site_logo

Sue C . 2018-02-10

MORE AT TripAdvisor

Superb meal at an amazing price for 2. The Beef Wellington was amazing along with the Mango cheesecake. Complements to Mario the chef and the great landlord's Jonathon and Ronnie.

site_logo

Dave M . 2018-02-10

MORE AT TripAdvisor

Came with a friend for a Saturday evening meal. Jonathan, Ronnie and family were very welcoming. My friend had the pie which was obviously homemade, packed full of filling and very tasty. I had the steak which was tender and melted in my mouth. A hidden gem in Corfe Mullen.

site_logo

A TripAdvisor Member . 2018-02-10

MORE AT TripAdvisor

The starter had two important parts missing egg and avocado on two persons starters The portions small had to ask for more meat only had one peace this was three meals When I got an extra meat pork it was very bloody sent it back...

site_logo

Pjchin53 . 2018-02-04

MORE AT TripAdvisor

We came to the Holme Bush is Corfe Mullen as we had heard that it was under new management and the food was consistently good. We received a warm welcome and we were seated in the open plan restaurant and waited on for drinks and food by Ronnie and Jonathon the manager made us feel very welcome. Although this pub had a local feel you will be made to feel welcome even if you have never visited before. We had grilled mediterranean vegetable and goats cheese bake and a simple ploughman’s which was excellent followed by drinks in the bar where we were joined by our dog who was made to feel welcome also. Keep up the good work. We will return.

site_logo

Fhjj . 2018-01-24

MORE AT TripAdvisor

We had booked a table for 7 people. Hadn’t ever been to the Holme Bush before but what a lovely evening we had.

site_logo

NikNik82 . 2018-01-10

MORE AT TripAdvisor

Love the fact we have our pub back after years of miserable and very unwelcoming hosts, its alive again, quite literally, especially on a Sunday afternoon. Well, that was until a 'decision' was made to cease the live music, which has now put many locals and others off spending their time and money here. Whoever thought it a good idea to 'kill the golden goose' think again, and give us our Sundays back. If we're happy and loving the music, we are spending money, surely that has to be a sound business proposition.

site_logo

happycampers465 . 2018-01-08

MORE AT TripAdvisor

Great choice of venue for buffet and refreshments after our beloved mums funeral. Couldn’t have wished for better buffet food, service and Ronnie and Jonathon made us feel very welcome. Everyone there commented on the excellent food and cosy venue. A great send off for our mum. Will certainly be returning under different circumstances.

site_logo

Jean O . 2018-01-06

MORE AT TripAdvisor

The Holme Bush Inn ticks all of the boxes of a proper village / country pub. Great Beer - tick, Friendly Locals - tick, Roaring log fire - tick, Dogs welcome - tick, Welcoming staff - tick, Great food - tick. Plus a campsite within the grounds.

site_logo

Nige_G4 . 2017-12-31

MORE AT TripAdvisor

We travelled down to meet our Bournemouth family for a Christmas get together and a meal and chose The Holme Bush Inn as it was had an adjacent campsite for us to stay and the food reviews were good. We were not disappointed. A lovely warm, cosy friendly pub with cheerful hosts and we were made most welcome as was our doggie. Everyone’s food was excellent and they even catered for me as a vegan. Nothing was too much trouble. We will definitely be staying here again when we visit our family. Thank you Ronnie and Jonathan

site_logo

Karina G . 2017-12-31

MORE AT TripAdvisor

I took my family and in laws to this pub today. I like proper traditional pubs....and this fits the bill!

site_logo

George S . 2017-12-22

MORE AT TripAdvisor

The Landlord made us feel very welcome from the moment we walked through the door. Food was excellent, service excellent and the atmosphere was cosy. Will definitely go back again. A real birthday treat. Thank you Landlord and staff.

site_logo

aveida1 . 2017-11-29

MORE AT TripAdvisor

Called in here on a whim, as we were heading somewhere else, but pleased we did. Very quiet, Tuesday lunchtime. Very friendly staff. Spotlessly clean. Ordered light bites which were more than ample for us for lunch. There was a wait for the food but when it was served this was explained by the fact that it was all freshly cooked and piping hot. Would certainly recommend and will go again.

site_logo

Mary C . 2017-11-28

MORE AT TripAdvisor

Just a nice Monday evening , but the manager was rather intoxicated ,to say the least , me and my friends visited for a meal and were surprised when then man drinking at the bar came to clear our table , the other lady was lovely and I couldn't fault her in the slightest , we as a group felt very sorry for her working under the drunk of a manager , lovely atmosphere to the place , locals seemed welcoming when we entered and food was amazing shame that one thing could ruin an evening , we requested to speak to someone about the gent but unfortunately I was told that he was the landlord and the owner is based in los angles , we as a group hope that he checks these reviews ,because I think something needs to be done about this drunk

site_logo

850stephen . 2017-11-22

MORE AT TripAdvisor

First visit for a year and with new management Big changes Service and food great - will be going back soon! Thank you

site_logo

HaAC13 . 2017-11-16

MORE AT TripAdvisor

Got to say a massive improvement on this pub of late. New menu which is really good, have finally got some decent New Zealand Wine by the glass and even better Rhubard & Ginger GIn!!!Sunday night is live music night and the band we saw were really good! You can bring well behaved dogs too which is really nice.Well done!

site_logo

sandynoeljane . 2017-11-07

MORE AT TripAdvisor

Visited the Holme Bush Inn tonight on the recommendation of a friend and we were not disappointed. As soon as we walked through the door we were made to feel welcome by the Landlord, he took us to a table and talked us through the menu. Monday night is pie night, so my mother and husband had the homemade steak and ale pie which they said was delicious, I had a very tasty burger and my 11 year old granddaughter had chicken goujons which were huge and thoroughly enjoyed. We will definitely return!

site_logo

Skidswife . 2017-11-06

MORE AT TripAdvisor

Sometimes, just sometimes, everything is just so pleasantly perfect that the most simple things in life are still a great pleasure. So, a warm and friendly welcome, a couple of soft drinks, a filled ciabatta, a salad and a bowl of chips can, and does here, leave us content and relaxed after a VERY hassled morning! Thank you both! (Sad the Jag is gone!)

site_logo

Jeff P . 2017-10-21

MORE AT TripAdvisor

Drove past this pub many times over a few years following bad experiences in the past. Finally decided to try it again as it is under new management and very pleased I did. Excellent home cooked home and perfectly cooked vegetables. The owners are very friendly and welcoming. Will be returning on a regular basis.

site_logo

Jenny H . 2017-10-18

MORE AT TripAdvisor

We wear staying on holiday just down the road from the Holme Bush.So we thought we would give it a try.The staff greeted us and were very friendly.Showed us to our table I had the pie and my wife had risotto. I am afraid my wife’s meal was very stodgy and Luke warm.We mentioned this to the waiter.And the owner came and said he was sorry and said he would take the price of the meal plus one sweet of the bill. Which we wear happy about. Mine was lovely with big chunks of meat.

site_logo

Kevin M . 2017-10-14

MORE AT TripAdvisor

Lovely food.. It is, or was a nice pub after all. But I have been completely dissatisfied with the recent rude, ignorant attitude and inappropriate actions and failings of Jonathan - the manager.This was once a nice pub. But I have already informed the management that I never intended to return for the ongoing failings, and more recently the absurd rudeness that has been directed towards myself.I shall be contacting Godiva Leisure Group personally, as I do not wish to post any details here in a public forum.1☆ rating

site_logo

JimKHS357 . 2017-10-07

MORE AT TripAdvisor

Return visit as recently changed hands and we live near by, and it's convenient for the other friends A very good meal, and the waitress was fine, but the service was very slow, But would return again,

site_logo

Sue B . 2017-09-18

MORE AT TripAdvisor

Fabulous food. Best Tuna Nicoise salad I've ever had and the lemon posset equally delicious. My husband had the fish and chips - fish very fresh and chips very good. All at very reasonable prices. Even the ladies loos had fresh flowers with scented roses. The new owners certainly have a high standard. Thoroughly recommend.

site_logo

Oslo24 . 2017-09-15

MORE AT TripAdvisor

The pub was chosen as it was rated dog friendly, which indeed it was, however we were delighted with the quality of the food.Two of us had Tuna Nicoise, which had a good salad, excellent tasty new potatoes (best I've had in a long while) and a real tuna steak, cooked perfectly. The other two had fish in beer batter with home cooked chips, which were also lovely. We were really full but the food was so good we had to try the lemon posset, which came with home made shortbread, both truly scrumptious!The only negatives were a rather long wait for the food to arrive (but obviously freshly cooked), and the plate the fish was served on was too small, so made eating it rather difficult - lovely plates so suggest a separate dish for the chips.We will definitely be back, hopefully to up the rating to 5 if there is no long wait.

site_logo

Lynda A . 2017-09-15

MORE AT TripAdvisor

Not been here for years and was pleasantly surprised. The new management were very welcoming, good pub food and the service was excellent, will defiantly go back

site_logo

Julie D . 2017-09-11

MORE AT TripAdvisor

Bumped into this place accidentally on the way to a festival, and glad that we did. The food was fresh and plentiful. A lot of choice for a veggie like me, which is unusual for a pub. The couple who run the place are very welcoming and nice. Will definitely be back

site_logo

NelyaM . 2017-09-07

MORE AT TripAdvisor

Had an excellent evening meal at The Holme Bush. The food was presented well and the staff were very helpful. I am gluten free but there was no problem with that. The portions were very generous and we'll cooked. A very friendly atmosphere. Well worth a visit.

site_logo

Marcia B . 2017-09-05

MORE AT TripAdvisor

Went in here for a few beers , as we do every fri eve, we sat in the rather tatty beer garden ( very noisy traffic + even noiser music from the poor quality speakers, ) couldn't help noticing a customers dog ( not on a lead ) urinating nearby to us , ) was amazed that ale was £4.10, Lower parstone isn't that expenxive ! . We looked @ the food menu & decided that if i will the lottery soon we MAY return !, , then a very rude Landlord interupted my conversation too make a stupid remark about a healthy snack that we had consumed on his premisis ( stand on the naughty step ) in fact i won't go back in their again after that, so i hope his new venture fails with an atitude like that.

site_logo

Martin H . 2017-09-03

MORE AT TripAdvisor

Had a perfect lunchtime here today with my wife and youngest daughter, absolutely without fault. The owners are complete stars, make you so very welcome, and were very accomodating when we said we wanted the perosecco and meze which is supposed to be a special available after 5pm, and we were there at lunchtime. We added some whitebait, a whole camembert and a huge bowl of great chunky chips and with the prosecco for the ladies and a couple of ice cold lime and sodas for me, we spent a couple of hours in Dorset Countryside heaven! (OK, I'm biased, we are all Dorset born and bred!) Splendid!

site_logo

Jeff P . 2017-09-01

MORE AT TripAdvisor

The Holme Bush is a lovely pub to have a lovely meal. Myself, my husband and 2 of our children decided to have our evening dinner there.For our main course I had the 10oz Gammon Steak, yummy yummy... My husband had the Cajun Tuna Steak, our son had Beef Lasagne and our daughter had Scampi. The food was cooked perfectly and we thoroughly enjoyed every mouthful. For dessert I had Apple and Rhubarb Crumble, my son had had Chocolate Brownie with Ice-cream and my daughter had Belgium Waffle with Toffee sauce and Ice-cream, and believe me they were absolutely delicious... The portion sizes were perfect for all of us. The service from Jonathan and Ronnie was brilliant. Ronnie is a lovely wonderful lady who is fantastic with every customer, and Jonathan is great as he loves making the customers laugh which makes the evening more enjoyable.We will be eating there again.

site_logo

MandyT74 . 2017-08-31

MORE AT TripAdvisor

We popped into The Holme Bush a couple of weeks ago and I ordered mussels and my Hubby had Steak pie. I thought the meals were pricey to be honest. For just a pub meal anyway. Mussels were nearly £15 and by the time I sifted through the broken shells and picked very small mussel meat out there wasn't a lot there. Very disappointing. I have had better portions for less money. They didn't bring a finger bowl either and I had to stack the shells on the side of my plate. The staff didn't ask if everything was OK for us otherwise I would have commented. My Hubby's pie was nice but very small amount of meat, and portion of veg on the side, again, we have had better portion size for less money elsewhere. Will not be returning as I felt uncomfortable about the whole experience.

site_logo

janegDorset . 2017-08-30

MORE AT TripAdvisor

My dad found this pub on his travel and we decided to give it a try. Within the space of a week my husband and I had been twice and my parents had been 3 times. The service was great and we were made to feel very welcome. The food is all freshly prepared on site and we couldn't of asked for a nicer meals, the Sunday roast was a favourite of my husbands. Was great portion sizes and all had amazing flavour and seasoning. Hoping to go back next year if we get back down.

site_logo

Alana C . 2017-08-27

MORE AT TripAdvisor

Having grown up locally I've seen the Holme Bush change over the years but this current incarnation is really great. On entering it still looked like the Holme Bush of old but felt somewhat brighter and cleaner. My husband and I came in for a meal while we had a rare evening without our toddler and weren't disappointed. All staff we encountered were very friendly and helpful, I'm just sorry I can't name them. The food was absolutely delicious. We had warm bread with oil/vinegar dip and pan fried chorizo in balsamic vinegar as a starter. A very tasty start. Our mains were the burger and the pie of the day. Both were so tasty. The pie was clearly a proper homemade pie and was packed with meat. The burger was one of the best I've had. We finished with the crumble and roulade. It was a really good meal and I would definitely recommend eating (and drinking) here. We'll be back!

site_logo

Kitten_in_socks . 2017-08-26

MORE AT TripAdvisor

Had lunch last Friday with my family. The starters were great but a very long wait for the main course. My pie was burnt and my daughter had pate as her main and the round bits of toasted bread looked grey and tasted stale. I complained quietly and asked if it was possible to have some bread instead. The gentleman who brought the bread said that we didn't know what melba toast was and that we needed to be educated in the matter. My daughter assured him that we did know what it was. In fact round bits of a baguette are not melba toast. A rude response was not needed and we will not be returning.

site_logo

siobhancoleman22 . 2017-08-17

MORE AT TripAdvisor

Made to feel very welcome and were provided a very friendly and efficient service. The young chef there did an outstanding job - the food looked good and didn't disappoint on taste. The owners, Jonathan and Ronnie, made us feel very at home. Excellent pub and we will definitely return when we are next in the area.

site_logo

Stephanie H . 2017-08-17

MORE AT TripAdvisor

Returned to the Holme Bush last night for a meal after what must be 7 years, The last visit put us off the place, the PREVIOUS owner / landlord was rude and not at all customer orientated. We found last night completely different, the food was delicious, hot and freshly cooked. My husband and I had the pie of the day ( chicken and ham) which is probably the best we have had for many years in a pub. It was a "proper" pie, pastry top and bottom, not a bowl of meat with a puff pastry topping - which we hate. The service was very good, we were looked after by Stewart / Stuart, who did admirably., Would definitely recommend and will go back again soon.

site_logo

Jane P . 2017-08-15

MORE AT TripAdvisor

Under new management, and wow what a difference!. We were welcomed immediately and shown to our table. Very attentive service and very friendly. Nothing was too much trouble. Quite a simple menu, but something for most tastes. The garlic mussels were lovely, although could have had a little more garlic for our taste. My husband chose the steak, and said it was the best steak he had had in a long time, so tender, just melted in the mouth. We were asked for feedback, and when I stated that we would prefer a little more garlic, Jonathan told us we only had to ask for any requirements and they would do their best to accommodate. Living locally, we will certainly return very soon, with our family, it is great to have a such a "gem" on our doorstep.

site_logo

Lorraine2812011 . 2017-08-12

MORE AT TripAdvisor

We keep coming back hoping to be impressed but sadly no change. Good well priced food! How hard can it be? Shame as cracking location and with the Lambs Green doing its best to upset it's customers with poor service this place should be laughing. Back to basics and more relaxed atmosphere would be a good start.

site_logo

jesm20 . 2017-08-11

MORE AT TripAdvisor

Six of us visited this pub which we havent been to for quite a while. What a very pleasant surprise. The food was wonderful. Great portions, nice and hot and reasonable price. The new landlords have revitalised this pub and put it back to being one of the best around for food. A special thanks to Ronnie who stayed on and made us the best coffees ever. Thank you for the friendly and welcoming service. A place we will all definitely be returning to. See you soon.

site_logo

tl1964 . 2017-08-10

MORE AT TripAdvisor

Attended here this week for a meal service good food well cooked portion size not that great tuna steak about 10mm thick although tasty but could of done with being thicker especially when the vegetables overtook the main item home made pie over shone both of our meals put together.

site_logo

arranson . 2017-08-04

MORE AT TripAdvisor

So I have frequented this pub over many years,.. when passing by, and the new landlords Jonathan & Ronnie are possibly the nicest I have ever met.Friendly. .chatty.. and most importantly very welcoming.. and it is possibly the first time I have enjoyed getting to know a landlord of a pub.I have treated my daughter to a nice meal here recently and she loves the food.. and the menu overall looks rather gorgeous I have to sayWith a great choice to choose from and a lovey beer garden to relax in on a nice day.Poole tableTable tennis table. .Private Hot tub hire..seriously. . OMG!! I must check it out.And if the weather is good.. BBQ food served on Sundays! Also a glamping tent or two for hire, i shall enquire about these next time we visit.Overall a Great atmosphere and it feels like a second home to me.. lovely and relaxed.Woth great bar and waiting staff.. Stewart and Alex.. give them a payrise ;0) I very much look forward to visiting this perfect pub again soon.Jim & Kaitlyn

site_logo

Jim S . 2017-08-04

MORE AT TripAdvisor

After doing a spot of shopping in Poole my wife and I decided to stop for lunch on the way home. I remembered that the Holme Bush had been recently refurbished and under new management, seeing as we were practically passing the place we stopped to take a look. The pub is light and airy with a nicely laid out dining area overlooking the garden we were greeted by friendly staff , handed a menu and shown to a table by the window. The menu was nicely laid out with dishes grouped according to price ,not a huge choice but something for everyone. We both decided on a salad my wife had prawn Marie rose while I had the chargrilled chicken breast everything was fresh and portions were of a good size staff were very attentive and made sure we had everything we needed. All in all a very pleasant lunchtime experience and will definitely be paying another visit and will be recommending to others. I also noticed that there is a camping/caravan area adjacent to the pub which would make it an ideal base for holiday makers visiting the area

site_logo

ericshire . 2017-07-29

MORE AT TripAdvisor

A spur of the moment midweek lunch for two having stopped by a few months ago just for a drink.Ordering two mains and a pint of cider topped with lemonade we sat in the beer garden which was pleasant.Our scampi and chips arrived. The chips didn't seem cooked through. There was a thin sliver of lemon (the type you would put in a g&t) not the sort to squeeze over your scampi. The dishes were accompanied by peas.Sadly, we found the drinks overpriced and the food disappointing. Can two pints of cider with a dash of lemonade cost £12? We probably should have queried this at the time.

site_logo

H6896GQdebc . 2017-07-29

MORE AT TripAdvisor

We live not far away but this pub has never looked very appealing. Seeing that it looked recently spruced up, we had a Saturday supper here. Can't fault the host and hostess, friendly efficient. ringwood ales and a guest ales. Seem interested in sourcing local ales, which is good. Menu was limited but covered most options, better to have less choice freshly made than everything out of prepared freezer portions. My steak was fine tasty and tender, my husbands local mussels were good though not as full as Atlantic mussels. Puddings had a good choice. Yes we will go back and just hope it doesn't get so popular we can't get a table.

site_logo

Alex B . 2017-07-23

MORE AT TripAdvisor

First time here. It was midweek and mot too busy so didn't have to book. Friendly staff showed us to the table and drinks order taken. I had gammon steak and all the trimmmgs. Food was cooked properly and tasty and hot. We all had a desert too. I had chocolate brownie and ice cream. Very nice but perhaps a little on the small side. £108 for 4 mains 4 deserts and 2 drinks each.All in all ok. Not sure I'll rush back but nothing wrong it just didn't stand out to me.

site_logo

Adrian S . 2017-07-21

MORE AT TripAdvisor

Nice pint, with choices from independent breweries. shame about the awful music choice!!!!! Forced us not to have a 2nd pint.

site_logo

Emzdorset . 2017-07-21

MORE AT TripAdvisor

My mum and I stopped here for lunch and were not disappointed. I had the rump steak which was cooked perfectly medium rare as requested, my mum had the chicken, bacon and leek pie which was also excellent. Service was extremely efficient and the management were lovely, not a bad word to say! Will certainly be visiting again!

site_logo

Gemma19915 . 2017-07-19

MORE AT TripAdvisor

We ate here a couple of times and whilst its not the cheapest, nor the poshest eatery nearby the food and service was excellent.

site_logo

AndiPayne . 2017-07-19

MORE AT TripAdvisor

Excellent Sunday roast, great hosts and staff. Good choice of beer too. In addition they had fantastic live entertainment with a jazz blues performance from Zoe Schwarz backed by Rob on the guitar, outstanding all round. Great venue, worth a visit.Nigel & Bev

site_logo

Vic F . 2017-07-18

MORE AT TripAdvisor

We (4 adults and 1 child) arrived at the Holme Bush Inn on a Sunday evening recently to a warm reception. We were immediately shown to our table and placed our drinks order. We ordered 3 starters, 3 roast beef dinners and a child's roast beef. Couldn't fault the service or the food - the vegetables were a good mix and cooked correctly. Absolutely no hesitation in returning here for another enjoyable dining experience.

site_logo

David L . 2017-07-04

MORE AT TripAdvisor

The pub is friendly & welcoming, but we found the dinner menu a little limited, but we did managed to persuade the owner to order a Lasagna from the lunch time menu for my Wife.I ordered a Rump steak, baby new potatoes, salad & a Port & Stilton sauce, mine was excellent & I thoroughly enjoyed it. My wife's Lasagna however was very dry. We didn't like to complain, especially as we had ordered from the lunch time listing. Our Waitress though detected her displeasure & insisted that she told the owner, who immediately struck it from the bill & offered a replacement. The Customer service was excellent & very much appreciated, Thank you.

site_logo

Stephenallberry . 2017-06-26

MORE AT TripAdvisor

I came here for a meal Sunday evening, roast dinner was amazing as was the burgers! The staff are always smiling and very helpful and the food looked top notch, will definitely be coming back when I'm in the area!

site_logo

Paul M . 2017-06-26

MORE AT TripAdvisor

Similary restaurants in South West