GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.5

Based on 333 opinions finded in 1 websites

site_photo4

Nº 481 in 682 in Sunderland

Nº 72 of 87 British in Sunderland

CUSTOMERS TALK ABOUT DISHES WITH..cookedfishsteakcheesepaymeatfriedpiebreastpotatochickensaladsteaksoldburnt
Score
OpinionsNoteTripAdvisor3333.5

comment_iconOpinions

It asks you to pick when i was there every night but doesn't give that option Drinks rubbish been telling them for months even asked the new manager to sort the drinks out nothing done then complained again about flat rotten drinks then barred me think she wants me to just give her money and say it's best pub I've ever been in she is sadly mistaken

site_logo

Ian B . 2024-11-02

MORE AT TripAdvisor

Pub looks great. Delicious chicken gyros flatbread meal as usual and exceptional service from Helen as usual. Washed down with a perfect pint

site_logo

jjd7210 . 2024-10-24

MORE AT TripAdvisor

Service was fantastic, staff were lovely and very welcoming. Quick service at the bar and food came quickly and was piping hot. Will definitely be returning

site_logo

linda b . 2024-10-15

MORE AT TripAdvisor

Fantastic service from entering the doors to leaving, very attentive staff and great atmosphere. Will visit again very soon

site_logo

Matthew C . 2024-09-16

MORE AT TripAdvisor

Terrible! I never complain or leave reviews but shocking food and staff! Waited ages for food, me and 4 family members. 1 got fish and chips, me and the other 3 got gammon. The only thing that was warm was the chips! Side of garlic bread was burnt! We complained and she brought 'fresh' meals out which was just the same! Luke warm at best, all gammon cold! My sister left all of hers, my nanna left most of hers, the others were ate as we were so hungry! Complained again to be made to feel like a liar by the woman who said it had just came off the grill and was probed. I even told her to go and look that most of it hadn't been ate as made to feel like she didn't believe me! We got a refund for the meal prices and had I not been made to be feel like a liar I wouldn't of left this review!

site_logo

sclaire825 . 2024-09-13

MORE AT TripAdvisor

Not even deserving of the one star I'm forced to give it. Despite it being lunchtime there was a total lack of staff. One serving/taking orders behind the bar and one young girl around 18 years old having to serve all the tables their food. Had a wait of almost 45 minutes from ordering to food being served and apart from the fish the meal was cold. No control over children and toddlers being allowed to roam freely by mothers without parenting skills. Then you have the idiots who read a menu at their chosen table and then take the menu to the bar where they change their minds more times than the wind! Can't blame the staff, it's clearly the owners who set staffing levels, rotas, etc. but they obviously ignored the fact that children will be taken out for lunch as it was a school holiday. Don't see me hurrying to visit ths place again!

site_logo

Alix_McClitty . 2024-04-05

MORE AT TripAdvisor

The service was very good, the staff exceptional, and we were made very welcome. The food was very good and fairly cheep. Good value for money.

site_logo

William7636 . 2024-02-19

MORE AT TripAdvisor

Food is beautiful as always,my favourite being the stake, or fajitas, kids meals are good too kids get a lot to chose from and then there’s the meal deal mains,dessert and drink, staff always friendly and welcoming 😊

site_logo

Effy G . 2024-02-01

MORE AT TripAdvisor

simply the best greeting when we walked in speed at till when ordering for 5 of us waitress service could not be faulted food was cooked to our individual tastes and was perfect

site_logo

myangelal . 2023-11-17

MORE AT TripAdvisor

Came here for the kid’s Halloween disco,the kids loved it, the DJ was fab, the staff were friendly and very helpful, and the food was even better, also have the kids asking to come back for the Christmas Disco so see you then ☺️

site_logo

Hannah C . 2023-10-29

MORE AT TripAdvisor

Was here for the kids disco today, absolutely fantastic atmosphere, DJ was fantastic and the kids loved it, the food here is also brilliant. Can’t wait to come back!

site_logo

Mobile52501872896 . 2023-10-28

MORE AT TripAdvisor

Ideal local..... Great food.. Great staff.. wide range of drinks... Happy days This is my local and never have a complaint... if I did the staff are quick to rectify any issue... What more could ya want

site_logo

Big-Fella0607 . 2023-10-28

MORE AT TripAdvisor

We had a great time here for a family meal, food was excellent quality and great value. Staff were fantastic and very welcoming. We will definitely be returning

site_logo

Alice H . 2023-10-28

MORE AT TripAdvisor

Always take our kids for the Halloween discos and any event.. lovely pub, great staff, even better food and drink. Roll on Christmas events Keep it up guys.

site_logo

Lyndsay C . 2023-10-28

MORE AT TripAdvisor

We come every week and the food is incredible always. Always unbelievable service from Jason and the rest of the team

site_logo

bethcN2351PQ . 2023-10-16

MORE AT TripAdvisor

so we have came for years as a family my aunty comes up from north yorkshire and we always choose here but this time we can omg was absolutely shocked how bad the food was some came out cold and others didn't taste right my fish was nice but payed for it later i've never ever had bad food from here but that had put us off and the desserts well the crumble was burnt and choc cake tasted stale other two were ok though but like i say last time we there

site_logo

moxytup . 2023-10-13

MORE AT TripAdvisor

Very good food, excellent service especially Kara, she was quick and worked exceptionally well .Would recommend.

site_logo

Travel265960 . 2023-10-08

MORE AT TripAdvisor

My local pub I visit here a lot and it’s nice atmosphere drinks are a good price and the app is good also if you scan it every time you’re in you get free drinks 20% &40% of bills It’s a nice family pub and the food is lovely too strongly recommend the chicken hot clucking stack Staff are lovely too!! Xx

site_logo

Cody R . 2023-09-30

MORE AT TripAdvisor

Hunters Chicken was excellent today and the staff made it extra special as they are so helpful. The Cappuchino was an excellent way to complete the experience.

site_logo

Derek C . 2023-09-30

MORE AT TripAdvisor

A great time was had by all! A large group of us enjoyed some excellent meals, really good value for money. Shame they don't do real ales but the Stones is a nice pint.

site_logo

SIMON R . 2023-09-29

MORE AT TripAdvisor

I’ve been in a few times now for meals and drinks and the food, the service and the atmosphere are always very good. The chicken skewers are my personal favourite and I always try to make room for a delicious chocolate fudge cake afterwards

site_logo

Penelope S . 2023-09-18

MORE AT TripAdvisor

Lovely meals as always, nice friendly staff and takeaways are great through Just Eat when I can’t get out. It’s my favourite food pub by far.

site_logo

Jason D . 2023-09-18

MORE AT TripAdvisor

The food was nice but the team coach’s attitude was disgusting. Speaking to member of staff about customers loud enough so they can hear, staring at us enough that it was intimidating and put us off eating. When I wanted to make a complaint she...

site_logo

Ellie H . 2023-09-17

MORE AT TripAdvisor

We both had a 2 course meal at teatime staff were pleasant and attentive Nothing was too much trouble Food came out in a timely manner Both courses were tasty and hot It was great value

site_logo

jacquelinejN5383WQ . 2023-09-07

MORE AT TripAdvisor

Enjoyed meal out tonight. Break from the normal weekday diet. Food well presented and tasty. Wine cool and crisp on

site_logo

Valerie P . 2023-09-07

MORE AT TripAdvisor

Really enjoyed our evening. Great food and drink which arrived quickly, staff were very friendly and prompt with everything.

site_logo

Matthew S . 2023-09-07

MORE AT TripAdvisor

Lovely meals, great atmosphere excellent bar staff definitely recommend. Fast food service with a great taste.

site_logo

Margaret C . 2023-08-19

MORE AT TripAdvisor

Excellent meal as always with great service by all the staff. I am on every day and I always enjoy my day.

site_logo

Margaret C . 2023-06-02

MORE AT TripAdvisor

Absolutely shocking food, freezing cold, stale and chewy. Tasteless and cheap. Will never go here again.

site_logo

659charlottea . 2023-04-22

MORE AT TripAdvisor

We visited the hollymere with my children for the Easter disco the kids really enjoyed it. The food was delicious with lots to choose from and well worth the money. Staff were hardworking and very pleasant. Would definitely recommend to family and friends.

site_logo

Kayleigh S . 2023-04-11

MORE AT TripAdvisor

Called here for a spot of lunch with my daughter and her three children. I’d read somewhere there was a Easter party/disco on for the kids and what a brilliant couple of hours they had! Our food was lovely nice and hot just the way...

site_logo

kendrasT3411MI . 2023-04-08

MORE AT TripAdvisor

We went for Mother's day at tea time myself,hubby and 2 teens 3 of use had starters and burgers 1 just had a dessert the new sweet shop waffle all the food was hot and tasty. We will be back to try the new hotdogs...

site_logo

Weir428 . 2023-03-21

MORE AT TripAdvisor

Absolutely fantastic food and staff was absolutely fantastic they could not do enough for us as a large party of 15 they certainly had there hands full With us In our party there are two autistic children who will only eat certain foods The foods...

site_logo

GoPlaces03571592980 . 2023-03-19

MORE AT TripAdvisor

Regularly visit the Hollymere as its my local go to restaurant. They have a great menu and fantastic selection of drinks Always warm and welcoming atmosphere with a lovely team of staff making sure everyone's visitors is a enjoyable one. Always polite and very well...

site_logo

Big-Fella0607 . 2023-03-17

MORE AT TripAdvisor

Love this place simply because of the kind atmosphere and polite staff.. always made to feel welcome Food great and wide selection of drinks Always full after a meal. Thankyou to the staff

site_logo

Lyndsay C . 2023-03-17

MORE AT TripAdvisor

Excellent all round tonight. 3 lovely meals and great friendly service. Value for money and a nice environment to spend the evening in. Will definitely be returning.

site_logo

Jason D . 2023-03-10

MORE AT TripAdvisor

Celebrating our daughters 18th just a select few didn’t stress this had a lovely experience the young girl attending our table was very friendly and asked us all the time If were ok shout out to her enjoyed our food overall good time x

site_logo

Joanne M . 2023-03-04

MORE AT TripAdvisor

We visited this evening with our children and I ordered steak which was full of fat and gristle. Staff seemed very unapproachable storming about. One was small and plump about 40 and the other wearing glasses fair hair not a smile on their faces. Alas...

site_logo

kendrasT3411MI . 2023-02-26

MORE AT TripAdvisor

Just been to the hollymere for food, my 10yr old son ordered a BBQ chicken of the over 5s menu. After he finished eating his chicken and chips he went to eat the corn on the cob, he noticed a black dot on the end,...

site_logo

G7594MTleed . 2023-02-05

MORE AT TripAdvisor

Came here today for tea, last minute, had a steak which was really nice, better than other chain pubs I won’t mention. My boyfriend had a salad which he enjoyed and my daughter had Mac and cheese which was tasty, nice warm atmosphere and friendly...

site_logo

jillarmstrong . 2022-12-23

MORE AT TripAdvisor

We visited relatives today and went to eat at the Hollymere what a mistake we ordered 2 mega mixed grills 2 chicken dishes 2 normal mixed grills and a pizza. Where do I start the mega mixed grills were terrible non existent chips i.e about...

site_logo

Carl G . 2022-12-04

MORE AT TripAdvisor

They brought the cutlery and there was a hair on the plate where the cutlery was. The nachos didn't even taste like nachos. The stake was burt black and the onions didn't taste like onions and the chips were full of eyes. And they were...

site_logo

548vickyj . 2022-08-25

MORE AT TripAdvisor

Had a £10 off £30 spend voucher please don't go what a waste of money even with the discount chips were cold steak was grizzle just your normal pub rubbish my advice delete the app and eat in the house 👍👍

site_logo

Neal H . 2022-03-12

MORE AT TripAdvisor

Food was outstanding and would definitely return .. staff was amazing and made us feel very welcome .

site_logo

L2315XCsuzannel . 2022-02-09

MORE AT TripAdvisor

Booked here for Christmas Day for three of us & it was lovely. Food was spot on, the staff were attentive & plentiful. Highly recommended.

site_logo

Maiden9950 . 2021-12-27

MORE AT TripAdvisor

Visited for lunch today. Great welcome, service and lovely food. We got exactly what we ordered. Warm and welcoming. Very nice indeed.

site_logo

doreencop . 2021-09-30

MORE AT TripAdvisor

Went in to have a drink and a dessert, manageress came over, asked my 18 year daughter, very rude won't be going back, double chocolate dessert so try

site_logo

U5024OXkarenr . 2021-08-30

MORE AT TripAdvisor

Came as a family of 6. Food was nice, hot and arrived promptly. The place seemed understaffed (I'm assuming due to covid) but staff present was pleasant and helpful. Overall nice place and would visit again.

site_logo

gosiah652 . 2021-08-22

MORE AT TripAdvisor

Normally enjoy it here but haven’t been for a while, Ordered a over 5 kids chicken nuggets, they came they were small chicken chunks full of black batter, completely over cooked, and looked disgusting, I felt more embarrassed for the chief allowing it out of...

site_logo

580amirat . 2021-06-27

MORE AT TripAdvisor

Went for food here with the hubby and was not disappointed, staff was friendly and food was rather fast

site_logo

Max_35ie . 2020-09-22

MORE AT TripAdvisor

Rang to book the Hollymere the week before and although they very busy, fitted us in at 6pm. Service was prompt at the bar, drinks spot on, starters arrived within 5 minutes and were hot and tasty - really love the peri peri chicken bites here. Sauces and cutlery brought to the table - only minor gripe is we got no separate cutlery for the starters, so we had to use the cutlery brought for the mains, on both. Starters demolished and cleared, mains promptly arrived, double gammon was superb, hot and tasty. Triple hunters chicken was gorgeous, again the most minor of gripes was the sizzling platter was so hot the onions were black (but I only eat a few anyway), To be honest though it was the nicest meal we have had here. Great service too from all staff. £14 in total including discount.

site_logo

17Amber . 2020-09-10

MORE AT TripAdvisor

Absolutely brilliant service, food was top notch, overall a great pub, brilliant pint Mitch age 12 Yh

site_logo

Suckmyb00bs . 2020-08-26

MORE AT TripAdvisor

We were really apprehensive about coming for a meal for our wedding anniversary but we were really surprised at how well the hollymere had put safety measure in place and how the y made it a normal experience. Clare and Ryan hats off to you both as you were very helpful and reassuring through out the whole night. Thank you

site_logo

Emma R . 2020-08-01

MORE AT TripAdvisor

We have come here regularly quite recently and always really enjoy the food on sale here. Initially we came over Christmas and had the Christmas fair meals. Great value 3 courses was just over £10. Since then we’ve visited a lot and have 2 meals for £9 which is brilliant as well. I had a steak the other day which was cooked perfectly. My wife enjoys her wine and she says the white pinot is tasty and reasonably priced. She’s happy so I am. Keep up the good work Hollymere

site_logo

I3205XLbenjaminp . 2020-02-10

MORE AT TripAdvisor

After an early appointment, wife and I stopped here for much-needed breakfast. We feasted on fried egg, bacon, sausage, tomato, hash brown, beans accompanied by a slice of toast and butter all washed down with a large mug of tea. Amazed at bargain-basement price, excellent service too.

site_logo

David C . 2020-01-23

MORE AT TripAdvisor

Visited with my wife this morning for breakfast. Had been told that the sizzling plate breakfast had been stopped but this was not true.We ordered two sizzling platter breakfast which were first class.Two Bacon, two sausages, two fried eggs, mushroom and half a tomato, a boat of beans all served on diced onions and peppers. Also two slices of toast.The meals were cleared by the two us and will return soon.

site_logo

sharpleyman . 2020-01-19

MORE AT TripAdvisor

Came here twice for two Christmas visits with friends and family. We enjoyed both visits. Relaxed atmosphere perfect for socializing. Food was good and music wAs very christmassy. We really enjoyed it and was a perfect place for us. Always empty glasses on bar which meant a lot of people were enjoying it. Recommend coming here again

site_logo

Z225ARlaurat . 2019-12-29

MORE AT TripAdvisor

Had a lovely festive meal here today. 3 causes all lovely. Atmosphere perfect and all staff were welcoming. We were made to feel welcome immediately on arrival. Starter came out quickly (we had booked our meals in advance I think to make it easier for the pub to deliver it. Main was lovely and dessert was rich and delicious. We all agreed it was good value.

site_logo

Harrypondlife35 . 2019-12-17

MORE AT TripAdvisor

We had the 3 course Christmas lunch special on the 3rd dec. What can I say. Excellent value 3 courses is only £10 per head. Portion sizes were good and we all left feeling very full and satisfied with our experience from the afternoon. We will be recommending and potentially be back before Christmas to sample the offer again. Thanks

site_logo

766grege . 2019-12-03

MORE AT TripAdvisor

Had a very nice meal here over the weekend. Place was very busy which is always a good sign. Drinks were tea and coffee and Pepsi all served quickly and efficiently. Toilets were clean and perfunctory. Didn’t go outside to check the beer garden as weather was terrible. When food arrived after 30 mins we found it very tasty and filling and some of the portion sizes were massive which pleases my husband no end. Desserts we had to queue for (would like table service but understand not always possible) and came out. The sundae was massive. We all left very full and happy. Will call again soon.

site_logo

davidrF7636WM . 2019-11-27

MORE AT TripAdvisor

The last time we visited this place was a few year back. We decided to give it another try hoping it might have improved after receiving some vouchers from them by email. On arrival we were given drinks one of the glasses was filthy so they changed one drink no problem. One of us ordered a medium rare sirloin steak. It turned up medium well done with a great big thick streak of fat through it with some items missing. we thought this place specialised in steaks cooked to perfection. Thought it may have improved but much to our dissappointment it hadn't. Yeah it's cheap pub food and you get what you pay for. Luckily for us we didn't pay full price so didn't really complain. We won't be going back. Shame because it's a handy little place for us to call in when passing.

site_logo

_adele5516 . 2019-11-26

MORE AT TripAdvisor

Had a lovely visit here the other day for friends of ours who are emigrating to Australia. Food was lovely all served together even though we ordered separately. Staff friendly. Toilets clean and tidy. Baby changing was very good as well. Car park is good with easy access. We haven’t always been regulars but we think we will be coming more often from now on. It was a perfect send off for our friends leaving. Thank you

site_logo

Elli W . 2019-10-13

MORE AT TripAdvisor

Walking into this place today it was quite nice. Practically empty which should have told its own story as we are used to reserving or waiting for a table for Sunday lunch. After a considerable wait we were presented with cold vegetables , roast parsnips which were so raw in the centre the knife struggled with the task of cutting them. Road potatoes that were whiter than the mashed potatoes. And the mash , if it wasn’t instant out of the packet stuff it was made 1st thing this morning and warmed up. Pushing my folk down through it was unsuccessful. I believe it’s customary to return to a table after 5 minutes and ask if everything is ok with your meal, none of this, maybe they know what the answer was going to be. We even sat for 20 minutes after we’d finished and no one came to clear our plates away ,considering the place was empty suggests they seen the amount of food left and took the safe option and waited until we had gone.

site_logo

Marc-Pike . 2019-10-06

MORE AT TripAdvisor

Visited on a Friday evening, the place was very busy and we struggled to find a table. Finally got sorted after cleaning the table and seats ourselves as the unclaimed tables hadn't been cleared. Ordered starters and they took almost 30 minutes to arrive 3 sharers between the two of us which was 5 battered prawns, 3 small pieces of coated chicken, and 4 decent potato skins. We demolished them and then sat, and sat... finally the waitress took the plates and after another 30 minute wait we got the mains. The other halfs double gammon was decent but the chicken ham and double cheddar pie was terrible. It was a mountain of thick solid pastry that you had to carve your way through, and was solid it was almost inedible. I failed to find the double cheddar in the sauce which was just bland, chips and peas were ok but the gravy was lukewarm and very strong in flavour. Very disappointing. It was just over £30 including 2 drinks, and we felt let down as previous visits have been good. Food not great, generally not clean - maybe on busy nights they need more staff? Disappointing.........

site_logo

17Amber . 2019-08-19

MORE AT TripAdvisor

Had excellent food and drinks here last night. Staff were polite and friendly from the welcoming hello when we first walked through door to the affable goodbye we received upon leaving. Food looked and tasted amazing OMG. The ribs were juicy and tender on my meal and the steak my partner had looked lovely as well. Both kids had build ur own meals with ice cream desserts which looked and tasted amazing they said. Highly recommend will be back.

site_logo

Terrydobinson36 . 2019-08-11

MORE AT TripAdvisor

First impressions are a good nice well-decorated pub, beer is good and well kept. We ordered food which was served quickly, my Hunters chicken was served on a steel plate which was so hot it continued to cook for 10 minutes after it was put down. as a result, the chicken was burned on the bottom, very dry and totally tasteless. The portion size was very poor and the meal was presented on a very unhygienic wooden platter/

site_logo

bobc252 . 2019-08-10

MORE AT TripAdvisor

Came in with my partner just for a bit of tea and a drink and i ordered our food and drink and thats where the bad experience began. I ordered a jug of purple rain cocktail and when we got it, it didnt taste right it had soda water in it instead of lemonade and when my partner questioned the barman he was told it was definitely lemonade, it clearly wasnt I know the difference (and what happened to the customer always being right). When your paying nearly £10 you expect to get what you order thankfully the manager was more helpful than the barman and it was changed. As for our food we decided to go for something off the two for £9 menu and while the food we had was lovely it wasnt what we ordered it was meant to be the pie with MASH and peas but instead when it chips...WE WASNT GIVEN A REASON AS TO WHY IT WAS CHIPS AND NOT MASH as the menu read nor was we given this option and finally when I went to order dessert the same barman as earlier told me they didnt sell the dessert we wanted anymore....IF THIS IS THE CASE TAKE IT OFF THE MENU. MY WOSRT EXPERIENCE OF THIS PUB WHICH I USUALLY LOVE VERY UNHAPPY.

site_logo

Rina8684 . 2019-08-09

MORE AT TripAdvisor

Went for drinks and food here last week when it was really hot. Beer garden for a cold cider was great and sizzling skillets were great later on when we ate. Will definitely be returning here again. Staff polite courteous and welcoming not to in your face if you know what I mean. Car park spacious with good access to the pub if you struggle to walk long distances like my father. All in all see you again soon.

site_logo

Johnlisty . 2019-07-02

MORE AT TripAdvisor

Popped into hollymere for a late tea , all I can say is I won’t be back , expensive for what we had and the portions were very small , poor quality pub meal , restaurant prices , avoid if you can

site_logo

johnkelly2 . 2019-06-29

MORE AT TripAdvisor

Nice place, clean and welcoming. Sunday lunch - Chicken over cooked. Rosties was not crispy and parsnips under done. Desserts in my opinion was ok. Several was not available.

site_logo

Lou Lou M . 2019-06-23

MORE AT TripAdvisor

I have to start by saying that I have never been a fan of the food served at the Hollymere. I do not know why but despite several changes of staff/management, they have never seemed to be able to get the food right. However, having enjoyed a pleasant pint the day before I decided to return and give the food another try. I ordered the all day breakfast, as it is the easiest of dishes to get right, I thought it was a safe bet . How wrong I was! The breakfast was swimming in grease, so much so I had to use a napkin to soak it up. The bacon was covered in black residue from the grill and the sausages where over cooked one side and just done on the other. It is a real shame but I can confirm that nothing has changed as regards to the food in the Hollymere and it is still one to miss.

site_logo

Awaythelad . 2019-06-23

MORE AT TripAdvisor

Went for food and drink here re entry when calling at family we haven’t seen for a few years. Venue was very welcoming and staff very friendly. Toilets and other amenities were all very clean and made us feel confident we were going to enjoy our stay.

site_logo

DerekC3555 . 2019-06-20

MORE AT TripAdvisor

Meals were beautiful. Good selection on the menu. Kids have a good selection. Its always nice and friendly service. Would recommend to anyone

site_logo

Len C . 2019-06-06

MORE AT TripAdvisor

Poor food quality, poor service, not good. There are better places to eat in Sunderland than this. Very Poor

site_logo

eddieprice13 . 2019-06-05

MORE AT TripAdvisor

We visited this establishment last week whilst we were on holiday in the area. Planned a quick bite to eat however ended up having a longer visit as the staff, service and atmosphere of the pub was amazing. our food was served hot and the knife just slipped straight through the steak lvely and tender. I had scampi with it and it was nice. My husband had chicked with his and he said it was equally good. Drinks are reasonably priced and the frose wine (which i had never heard of before) was that good i had a 2nd glass. Next time we are back in the area we will visit

site_logo

Holly S . 2019-04-12

MORE AT TripAdvisor

I ordered the Ultimate Mixed Grill and I must say it was the best meal I've had in years, utter perfection, hats off to the chefs. The service staff were also lovely and were really helpful and welcoming to me and my family. A great place for kids too with a range of meals for them. A definite 5 out of 5 for me :)

site_logo

DStepho123 . 2019-04-12

MORE AT TripAdvisor

Called in for food and drinks this afternoon. Was greeted by a member of staff who explained our menus and how to order food. Food was absolutely fantastic, red hot and well presented, only wish I’d taken a picture before! Lovely atmosphere made us stay for a few drinks! Will definitely be returning!

site_logo

Emma H . 2019-04-12

MORE AT TripAdvisor

Me and my partner came for dinner. Good menu variety and very reasonably priced. Food was lovely, fast service. They have a big beer garden and a smokers shelter. Will definately go back. Great atmosphere with things going on through the week, a pool table and darts board. Lots todo and be involved in.

site_logo

501kimd . 2019-04-02

MORE AT TripAdvisor

Went here last Sunday with my parents and the kids. Was quite busy but staff were all helpful and polite. Mains came fairly quickly and were lovely especially my steak! We even decided to have desserts. The fudge cake is amazing! Would definitely recommend!

site_logo

Josied1234 . 2019-02-18

MORE AT TripAdvisor

not the best pub meals, had a lot better in other Sunderland pubs, probably won't go again, you only get what you pay for but had better for same

site_logo

bryanranton . 2019-02-09

MORE AT TripAdvisor

We rang to ask if the pub was serving food, it being New year's eve. Lovely girl called Clare said yes, some tables booked but it was quiet and they had tables for people dropping in so we made the 20 minute drive. Pleased we did. Very friendly chap asked if we wanted a table and approx how long for, all night or just a meal. We guessed we would be an hour or so and so he put us on a booked table that was 2 hours before the party would arrive.... perfect planning! Ordered our food and within 15 mins we had hot starters at the table. All were tasty and well presented. 10 mins after and our mains arrived and boy, does this place do a good steak. Rib eye and surf and turf perfectly cooked. 30 quid in total plus 2 Pepsi. Great atmosphere and well organised on a busy New year's eve....

site_logo

17Amber . 2018-12-31

MORE AT TripAdvisor

This busy, pub and grill is an excellent place for food and as regular visitors we always enjoy our meals, whatever we choose, and the staff are first rate. The service is very excellent and only slows when there is a a large influx of customers.

site_logo

Derek C . 2018-12-18

MORE AT TripAdvisor

Decided to visit after calling to another pub in the area and couldn't get a table, we were passing here so called in. Very pleasantly surprised. The place is spacious, well laid out, and homely. We sat and perused a more than ample menu then ordered at the bar - served by a very friendly and helpful young man. Food arrived promptly, piping hot and well presented - but where was the cutlery and napkins? Nowhere on the table. We looked around, the server had disappeared, and having never been before, we didn't have a clue....where did we look for a knife for our potato skins? Decided to go the bar and ask, and by chance spotted a stand at the back of the pub with cutlery and napkins, and all the condiments - bingo! Perhaps this should be mentioned when food is served, especially as we were newbies? With cutlery and napkins obtained, we tucked in. Lovely starters, peri peri sauce with the chicken particularly good. Plates (and cutlery) cleared, our mains promptly arrived, and again were excellent. Double gammon and hunters chicken, both hot and tasty, excellent chips, and now that we had found them, an amazing range of condiments. Portions so good, we were sadly beaten and left a few chips. Cost just over £28 for starters, mains and drinks which was outstanding value, and the food was better than where we had planned to visit that night. Service good, surroundings pleasant though the table could have done with a wipe over - and we would have liked to have been told where the cutlery was! We will know for next time though as we will visit again

site_logo

17Amber . 2018-11-03

MORE AT TripAdvisor

Had a good meal I had the classic mixed grill and my partner had the chicken burger both really nice and very reasonable priced

site_logo

John P . 2018-08-27

MORE AT TripAdvisor

A nice atmosphere with pleasant surroundings. A good range of food and beer . Tvs showing up to date sports events and live football.

site_logo

Colinca C . 2018-08-27

MORE AT TripAdvisor

On Tuesday the 17th July 2018 we celebrated our 47th Wedding Anniversary. We just wanted a quiet night out for the two of us. We enjoyed the meal. The service was very good. Afterwards there was a karaoke on. The atmosphere was wonderful, nice and relaxed. Most of the singers were very good, and provided good entertainment.

site_logo

William7636 . 2018-07-22

MORE AT TripAdvisor

Lovely breakfast from small one to big one, good value for money and pleasant atmosphere, staff friendly, pub clean and bright and amenities also clean. Definitely go back again

site_logo

Kim T . 2018-07-09

MORE AT TripAdvisor

had a very relaxing meal with drinks and food here early evening. The ambiance was just right and it is easily accesible with a good car park and easy access to toilets for my husband who struggles walking unaided. We sat down and shared a bottle of house wine which was very reasonably priced at about £8. Then we had starters of brie and potato skins. Very good pub food. I had steak and chickenc with chips for my main and my husband ate the scampi. We both said chips were very good and straight out of the fryer so they were nice and hot. The staff said goodbye to us at the end which made us feel special nd welcome which is a nice touch in a pub and you dont always get that. We will return Hollymere

site_logo

tomlancashire1 . 2018-06-22

MORE AT TripAdvisor

Went to the hollymere on Leechmere road Sunderland today and had a wonderful time there. Food was cooked exceptionally. We came for a party and nothing was too much trouble for the people working. They were v accommodating. I had the sirloin steak with peppercorn...

site_logo

tonyhadders15 . 2018-06-20

MORE AT TripAdvisor

Food took an hour to come and was dry, I had the chicken and two others had steak, they were all dry. Kids had toad in the hole and could not finish their meal, had to come home and make them something else.

site_logo

kdalton5 . 2018-06-19

MORE AT TripAdvisor

Went with friends for a bite to eat and some drinks. Food is good and very reasonable priced especially the starters offer. Drinks are well priced as well. Service was a little slow at the bar but food came out fairly quickly. Not going to win any awards but really good value

site_logo

MrJessam . 2018-06-13

MORE AT TripAdvisor

Went here last Friday night with the family and the pub was absolutely heaving. Which is always a good sign. The manager took us to our seats and explained the ordering process and also that there was a band on later tonight. Which was good...

site_logo

henrysaville12 . 2018-05-03

MORE AT TripAdvisor

We went to the Hollymere last night, with our Daughter and three grand children. The meals were very good, the service was very good, and we didn't have very long to wait, We went in before 7pm so it was cheaper. The kids went home at nine o'clock, and we stayed for the karaoke which was very enjoyable. A nice warm friendly atmosphere, we really had a wonderful evening out.

site_logo

William7636 . 2018-05-02

MORE AT TripAdvisor

This has to be the worst run pub ever only 1 staff in car 1 staff on floor

site_logo

david b . 2018-04-01

MORE AT TripAdvisor

Really enjoyed our meals. Had mixed grill and all the meat was cooked very well.

site_logo

Keith B . 2018-03-25

MORE AT TripAdvisor

Visited with our two granddaughters aged 7 and 2. The service was excellent and the four plates empty. Ordered the make your own sundae for the girls and again bowls empty. Value for money and pleasant environment. Would recommend.

site_logo

sharpleyman . 2018-01-07

MORE AT TripAdvisor

Very busy they were fast and it was so tasty i used my blue light card for discount staff very very helpful cant wait to return !

site_logo

Leanned22 . 2018-01-01

MORE AT TripAdvisor

This pub is definately worth a visit. I got the recommendation from some work colleagues and did not regret the visit. Plenty of seating, friendly staff and speedy service, what more could you want. Go for the chef's daily special - you won't be disappointed....

site_logo

Grumpy O . 2017-11-17

MORE AT TripAdvisor

I really love the feel of the place. it is a relaxed informal pub that serves great food. I had the mixed grill with egg and my wife had stilton and mushroom chicken that were both excellent. Would highly recommend a visit to this place...

site_logo

benthomas2017 . 2017-10-20

MORE AT TripAdvisor

we came yesterday to the pub and got served by a v friendly member of staff who was nice, polite, jovial and made us feel welcome. we ordered the surf and turf and mixed grill with egg thesteaks on both were cooked just the way...

site_logo

seanhharris . 2017-10-17

MORE AT TripAdvisor

Similary restaurants in North East

restaurant_img
3.5

747 Opinions

location-icon35 Noble Street
British
outdoor_seating_149195takeaway_149195delivery_149195

The app stated the food had been delivered which it had not. I called the restaurant whose mailbox was full. Waited and 10 minutes later the driver turns up with the food with no explanation as to why the food was marked as being delivered 15 minutes previously. The food was cold. Very disappointing. Will not order from here again.

restaurant_img
3.6

83 Opinions

location-icon11 Crozier St
British
outdoor_seating_149098takeaway_149098delivery_149098

Ordered around 14:45 on just eat delivery said between 15:40-1600. Then get a notification from app saying delivered and nothing here. Called up but no answer as it is now closed. Not the best service.

restaurant_img
3.3

11550 Opinions

location-iconNorth Moor Lane
British
outdoor_seating_233281takeaway_233281delivery_233281

Really rude staff, called about a problem with the delivery through the McDonald’s app as they gave my mam the wrong order, was told there was nothing they could do and had the phone put down on us mid conversation. Very very rude.

restaurant_img
3.8

2098 Opinions

location-icon30-32 Fawcett Street
British
outdoor_seating_149011takeaway_149011delivery_149011

Bacon sandwich was very enjoyable

restaurant_img
3.8

824 Opinions

location-icon82 Sea Road
British
outdoor_seating_149005takeaway_149005delivery_149005

Very good taste and very worth prices