GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 1.642 opinions finded in 3 websites

site_photo4

Nº 247 in 495 in Maidstone

Nº 63 of 116 Other cuisines in Maidstone

CUSTOMERS TALK ABOUT DISHES WITH..roastpuddingoldbeautifullambcookedpiemeatladycheesesteakchickenfishmustsalad

comment_iconOpinions

Food simply outstanding. Real British pub choice. Mouthwatering Sunday roast!!! Friendly people and just the environment you’d expect to find in a cozy pub.

site_logo

dadego . 2025-04-22

MORE AT TripAdvisor

This pub is a little gem .The food is absolutely delicious and plentiful. The staff are really friendly and it is a lovely cosy clean little pub . We have been several times and have never been dissapointed. Highly recommended 👌

site_logo

Julie P . 2025-04-20

MORE AT TripAdvisor

7 of us went here for a birthday celebration. We all ordered different meals. Food was lovely, well cooked and good portion sizes. They allowed us to bring a birthday cake and presented it at the appropriate time. Everyone joined in to sing happy birthday. We would all happily come again and would recommend it to friends.

site_logo

Bradley Laraman . 2025-04-20

MORE AT TripAdvisor

This is a beautiful little pub in a lovely little village, even better is that they allow dogs in. We were shown to a table and decided to have just a pot of tea, the staff were amazing. We were waiting for our husbands to come as they were enjoying Segway at the castle, once they arrived we ordered our food and I have to say it was delicious. We did not have to wait too long for the food to come out and we all enjoyed what we had ordered, I could not say a bad thing about the food or the service. We have been to this pub before and can’t wait to go again, thank you for making our visit memorable

site_logo

woodfordmrskellyann . 2025-04-10

MORE AT TripAdvisor

Went with my Family to the George Inn on Sunday 6th of April to celebrate my Birthday. We were extremely happy with the service and the food. Right from my first contact with the staff when booking they were polite and friendly. The atmosphere was lovely and very welcoming. Thank you everyone at The George for making my special day such a lovely warm experience. Gail Norman and family.

site_logo

Gail Norman . 2025-04-08

MORE AT Google

A group of us go there about twice a month. Staff are always very friendly and I can highly recommend the food. Especially the specials menu. I had smoked haddock which was fantastic.

site_logo

raymond doherty . 2025-04-02

MORE AT Google

It is a nice pub to meet our friends there. The menu is good & the portions are excellent, we can't wait to go back again.

site_logo

Maggie Payne . 2025-03-28

MORE AT Google

We have just left the George Inn after a particularly hostile situation with the Pub. The amount that was ment to be charged to my friend’s account was £74.62. The waitress charged £474.62. After payment we brought this to the attention of the waiting staff whom said they couldn’t refund the amount back the same day as “the manager was abroad”. Although mistakes happen the waitress didn’t come back to apologise and left it to another colleague to deal with whom became very aggressive towards me and confrontational when I pointed out what was occurring. The waiting staff claimed that it would take time for the money to show from their electronic point of sale system and their bank. They asked my friend to leave the pub and the manager would be back on Tuesday to resolve it. When the manager did get on the phone she initially told us that it would take 5 days to get back into the account. We refused to leave venue until the matter was addressed, during that time a waitress proceeded to try and argue with me about the matter and accused me of being rude, she insisted that it wasn’t fraud although the person responsible was no longer in our sights and mysteriously vanished. I wasn’t being rude at all, as a person from the digital forensics and financial services sector I know how these systems work to a high standard. She was hostile. There was no attempt at a good will gesture and the customer service regarding this matter was absolutely shocking abysmal and extremely poor that the manager has gone abroad with not one single member of waiting staff being trained how to refund if a matter like this occurs when she’s away. Finally after a stand off the boss did transfer the money into a bank account but it took multiple people to resolve the matter. This incident brought a lot of distress towards us. As an autistic person being treated like this in a public setting wasn’t pleasant. I would like the pub to consider the following: 1. Train your staff to resolve refunds in a competent and polite manner. 2. Train your staff to be aware of neurodiverse individuals. 3. Do not provide poor excuses when it comes to resolving payment issues 4. train your staff to correctly handle electronic payments and verify the amounts are correct before conducting transactions. We won’t be returning back to the George Inn and it’s a real shame as the food was lovely but the customer service hasn’t matched the high standards of the food on offer.

site_logo

Oliver Bryant . 2025-03-16

MORE AT Google

Stopped off for Sunday lunch today and it was absolutely fantastic. Lovely staff, delicious food, great cosy atmosphere. Couldn't fault anything. Booking via phone is definitely recommended as it is busy, and with the amazing food and friendly service it's not hard to see why. 😍 Good choice of kids menus and the portion sizes were great for our 6 and 9 year olds. Adult portions massive too - I had Lamb shank roast with all the trimmings and was nearly defeated... nearly 😉 Would definitely return, the pub garden looks lovely for a sunny afternoon so will have to try that out. 🌞 🍺

site_logo

Charlie Rome . 2025-03-09

MORE AT Google

Situated in a pretty village. We were here for a celebration with 12 in the group. Service was prompt, food portions were huge, price of food was reasonable but the wine was pricey. Overall an enjoyable meal and if we lived nearer, I would visit again.

site_logo

David Debenham . 2025-03-06

MORE AT Google

A great little traditional pub and restaurant. Fantastic food and staff. Would highly recommend 👌

site_logo

Simon Marshall . 2025-03-05

MORE AT Google

Friendly staff, nice atmosphere!

site_logo

Zoltán Illés . 2025-03-02

MORE AT Google

Stopped here for lunch and really liked the interior with lots of wooden beams etc. which made it a pleasant environment. The food was great and the bar staff were very friendly so we would definitely go back.

site_logo

Gordon Penny . 2025-02-24

MORE AT Google

My parents have told me what a fantastic pub this is for food, so I had high expectations. Let me say, I wasn't disappointed in the slightest. 10/10. I was lucky enough to have just had nearly 2 weeks at Sandals in Jamaica where the food was top notch. This meal followed on wonderfully. Staff were friendly, accommodating, food arrived in good time, didn't feel rushed at all to eat it and very good portion sized (I actually had to leave some (which was disappointing) Never mentioned toilets in any my reviews before, but feel I needed to mention how spotless (& odourless, you know what I mean) the men's room was and how nice it was to have a powerful hand drier instead of the usual out of puff ones in a lot of other pubs. Need to add, what excellent value it was too. There were four of us, two had 3 courses each, other two were too full for dessert, 2 large cokes, a bottle of wine, 2 Irish coffees and a wonderfully concocted cappuccino (their coffee machine had just failed) and came in at £42 a head. Impressed!! Thank you, Mum and Dad for booking and coming with us.

site_logo

Robert Parker . 2025-02-06

MORE AT Google

A nice cosy, traditional pub... It was Avery busy and nice to see a pub full of friends and families all enjoying a drink, Sunday Roast or other food! All of the staff were very friendly, and We will return for sure!! Very big portions, and nice food at a reasonable cost. I would recommend if in the area.

site_logo

L J Clark . 2025-02-02

MORE AT Google

It’s been a while since we’ve been to the George. The beer (Bishop’s Finger) was lovely. The meals (Fajitas, Lamb Shank and Steak) were very generous. Old School ‘Oak on the Green’ vibes where the food is great and very plentiful. Service was really good too. Thoroughly enjoyable, really pleased with the experience.

site_logo

Jules. . 2025-02-01

MORE AT TripAdvisor

Took 2 3-year-olds and 5 adults. The staff were great, polite, and attentive to us and the kids. The food was perfect! Nice to find a good pub again! Can't wait to have an excuse to go again

site_logo

Gareth Burnett . 2025-01-31

MORE AT Google

We visit most months of the year. The owners and their staff are always extremely pleasant and courteous. Food always excellent food lunchtime afternoon or evening

site_logo

Keith Cook . 2025-01-29

MORE AT Google

Called on the off chance mid afternoon Saturday, nabbed the last available table for 2, It has good beer, fabulous food, friendly staff and reasonable prices and lots of parking space. . Perfect for me and I'm going back again for that lasagne it was very very tasty.

site_logo

Chas Jordan . 2025-01-25

MORE AT Google

Very friendly and welcoming pub own car park Food excellent portions and staff with sense of humour made a nice lunchtime meal

site_logo

Paul Sharp . 2025-01-23

MORE AT Google

I had such a lovely experience here at The George, from my initial phone call enquiry to book the table, right up to the wave good bye at the end of the evening. I’ve never been here before, but will definitely return, Lisa and all other staff members were so warm and friendly. Our food and drinks were great- but the service was exceptional thank you so much 😊

site_logo

Georgie . 2025-01-19

MORE AT Google

Friendly staff. Cosy. Log fire.

site_logo

L C . 2025-01-11

MORE AT Google

This is a great pub with some great meals but today my choice was not a good one. I love a good chilli con carni; this was a long way from good, it looked grey, was bland and served with way too much rice and over salty nachos. Would recommend the pub, just avoid the chilli. My advice to the chef; change the recipe or take it off the menu.

site_logo

Mark the Bash . 2025-01-05

MORE AT TripAdvisor

Great as usual always a please with good friends

site_logo

Richard Nugent . 2025-01-04

MORE AT Google

Had a brilliant meal, owners and staff are so welcoming and helpful. One of the best experiences I had for a while for a pub meal.

site_logo

Michael Solkhon . 2025-01-01

MORE AT Google

Really welcoming place, staff very friendly and accommodating. Food very nice.....recommended the sausage and mash!

site_logo

Joanne Miles . 2024-12-16

MORE AT Google

Popped in for a christmas dinner with the boys. Despite it being busy, service was quick, food was great.

site_logo

Roland Rosario . 2024-12-15

MORE AT Google

We had our work Christmas Meal at this delightful village pub. Such a cosy ambience with a really warm welcome by the friendly staff. The food was delicious and such good value too. We all had a really lovely evening and will definitely be going back again soon.

site_logo

Jo-anne B . 2024-12-09

MORE AT TripAdvisor

We came in for lunch following a visit to Leeds Castle. The George is the perfect example of what a modernbcountry pub should be, homely and cosy, offering good food and drink for its patrons. Add to this the freindly staff and quality of the food and you have the best example of this type of venue. VERY highly recommended to anyone visiting this area.

site_logo

Sam W . 2024-12-03

MORE AT TripAdvisor

A very warm welcome from the lovely staff. The pub was warm and cosy and obviously very popular. We were found a table although we will definitely book next time. The food was excellent, generous portions of home cooked food. My fish pie was delicious. Decent wine and lager too. We can’t wait to return for a Sunday lunch

site_logo

Caroline . 2024-11-29

MORE AT TripAdvisor

Quintessentially English pub, a dying breed, alas. Warm and friendly welcome, creating a lovely ambience. Rustic charm, and lovely decor. Staff professional and friendly, exemplary service. Varied menu, quality, freshly prepared and cooked fare. Pub menu and restaurant style. Excellent selection of wines. Definitely recommend, and will return.

site_logo

Oceanwanderer61 . 2024-11-24

MORE AT TripAdvisor

We had an excellent visit with friends who suggested the George. The staff were all lovely. The food tasted really good and the portions were big. Reasonably priced nice home made pub food. Highly recommend and will be back.

site_logo

Fiona A . 2024-11-23

MORE AT TripAdvisor

Fantastic pub grub, great quality at a reasonable price. Service was superb

site_logo

withAsigh . 2024-11-20

MORE AT Google

Lovely trad pub. Will use again if we are in the area. Friendly regulars.

site_logo

Bill Hyatt . 2024-11-12

MORE AT Google

My family of 15 including 2 young children always say let’s meet at The George. Throughout the past 13 years, we as a family understand why The George is because we are always welcomed and everyone just welcomes you. The food looks appealing, the menu gives so many options and if you need further persuasion to come and enjoy… it is always full, the way staff always are attentive, warm and a smile, respect and will always put you first as a customer . Debbie and Jason are amazing hosts and make it special for you.

site_logo

Jill Redman . 2024-11-03

MORE AT Google

Visited this pub twice in the last month, once for dinner and once for lunch. The staff on both occasions were very good. The menu very much concentrated on good portions of protein and very large portions of carbs. My dinner included a huge portion of chips covering well over half the plate, it was served with a small portion of peas and what was no more than a salad garnish, a few salad leaves and about a teaspoonful of very finely chopped pepper although the menu stated it would be served with salad. For lunch I opted for a sandwich which stated on the menu was served with salad and chips. Again the salad was very much the same as for my evening meal definitely no more than a garnish. There are no salads on the menu apart from as an additional side. I understand that some people are quite happy with mainly carbs and protein but it would be good to see more salad and vegetable options for those who prefer lighter food. Unfortunately the car park is quite small, on both occasions it was full and we found it difficult to park as the pub is on a narrow quite busy road.

site_logo

J C . 2024-10-23

MORE AT Google

We’ve been there for lunch and it was a wonderful experience. Delicious food for an absolutely reasonable price combined with a warm and friendly service. The whole family fell in love with this place. We will come back!

site_logo

Jan M . 2024-10-19

MORE AT TripAdvisor

A special family lunch in the barn today for 26 people. Brilliant time, good food, friendly staff who worked so hard. A big Thankyou to Debbie, Jason and the staff.

site_logo

Val W . 2024-10-19

MORE AT TripAdvisor

Good food had lamb shanks 10 out of 10.

site_logo

Roger Bird . 2024-10-16

MORE AT Google

This has to be one of the best pubs in Kent. The standard of food is always top quality. There is a great range of beers and the staff are the friendliest.

site_logo

john robertson . 2024-10-09

MORE AT Google

Clean. Efficient helpful and attentive staff. Food excellent. Freshly made and tasty. Great ambience. No loud background music (hooray!) Will definitely return.

site_logo

Barbara Barker . 2024-10-08

MORE AT Google

Called in today (Sept 23rd) & we both had an Excellent Curry from the Specials Board! Absolutely gorgeous, one of the best Curries I've had! Great Service, Great Food & no fuss! Definitely recommend a Visit!

site_logo

Martin D . 2024-09-23

MORE AT TripAdvisor

Always find a friendly welcome at the George! Good service, atmosphere, beer, food and parking. Perfect!

site_logo

H apples . 2024-09-21

MORE AT Google

Booked a meal here with family after a long and fulfilling day at Leeds Castle. It did not disappoint. The staff were friendly and attentive. We had two children with us and they looked after them really well. The food was also amazing with good portion sizes and presented really well. We will definitely return next year when we come back to visit again.

site_logo

Cath C . 2024-08-31

MORE AT TripAdvisor

Went for dinner with my grandson. I chose pie which had pastry like cardboard. Chose jam sponge for dessert but couldn’t cut through the bottom as it was so hard. Over cooked in a microwave I presume. Had to wait over half an hour for our main course. At no point did anyone ask how our meal was. Not very friendly staff

site_logo

Janet S . 2024-08-30

MORE AT TripAdvisor

Drive past most days and a long time since we have called in. The most positive reception from the moment we stepped through the door. Sat in a very quiet sunny garden, will call again. Cheers

site_logo

Julian Barnes . 2024-08-30

MORE AT Google

Excellent local pub with good honest hearty tasty food. Lovely atmosphere and really attentive friendly staff. You will not leave hungry as portions are very generous and at a great price. An English pub in the best of tradition. Do book to save disappointment.

site_logo

liz betts . 2024-08-20

MORE AT Google

Visited Leeds Castle & found this place. I hope the locals know how lucky they are. Home made menu. Huge portions. The clientel are friendly, as are the staff. Can't honestly do this place enough justice in my review.

site_logo

James Scarff . 2024-08-17

MORE AT Google

Really good food. The steak and cheese pie was delicious. Full of steak. To say the chips weren’t home cooked they were still good. My husband said the burger was one of the nicest he has had. The pub was full, and we waited 40 mins for the food, but it was worth the wait.

site_logo

Troyandy9 . 2024-08-09

MORE AT TripAdvisor

A proper country pub with great ales, very friendly staff and super accommodating allowing us to order late without any fuss whatsoever. All meals that we ordered, baby ribs, cod and chips and the burger were presented wonderfully and were really delicious. Great place to stop for a few good pints a friendly atmosphere and great staff. Well done to the George 👌👏👏👏

site_logo

Dominic L . 2024-08-09

MORE AT TripAdvisor

Had a wonderful Sunday lunch here had a good evening meal here many years ago still a good pub

site_logo

Martin Wellsted . 2024-08-09

MORE AT Google

Fabulous food. The steak and cheese pie was fab, my husband never orders a burger but he was pleased he did. Service was slow. 40 mins for food, but the pub was full. We will be back.

site_logo

Troy Linford-Gray (Troyandy9) . 2024-08-08

MORE AT Google

We have never visited this pub/restaurant before, 6 adults eating and drinking. Food freshly cooked, large portions, each meal is stunning quality and delicious. Not over priced either. Nothing is too much trouble. So helpful especially for our gluten free lady. We will definitely be back, booking recommended. Plenty of spaces in Car park. Lovely outside area with plenty of seats.

site_logo

Georgina Langley . 2024-08-06

MORE AT Google

Lovely village pub, food fantastic and staff very friendly.

site_logo

karen greagsby . 2024-08-06

MORE AT Google

Great little authentic pub in a picturesque Kentish village with good hearty grub friendly staff and a beautiful beer garden. Top notch!

site_logo

Michael Allen . 2024-08-05

MORE AT Google

Large rural pub with good traditional food offering. Usual selection of beers, ciders and spirits along with soft drinks, tea and coffee

site_logo

Stefan Kasprzyk . 2024-08-04

MORE AT Google

Friendly staff with a wicked sense of humour. Amazing food and good portion sizes.

site_logo

Leanne Askew . 2024-08-02

MORE AT Google

We recently held a family reunion here for 40+ people the day was fantastic. The staff food and service made the day perfect. Great Pub, we will definitely be back here on our next trip. Thank you Jason, Debbie and staff for a great day.

site_logo

Bryan Pullen . 2024-07-18

MORE AT Google

Lovely village Pub, great service, fantastic Sunday Lunch, thank you.

site_logo

Nicola Thomas . 2024-07-02

MORE AT Google

We've been here several times now and the food and service is always exceptional. They also have clearly marked 'gluten free' options (my experience at most other restaurants is a very poor understanding of dietary intolerances and a very limited menu), One of my favourite desserts is sponge, and not only did they have a gluten-free syrup sponge but they also had a lactose-free custard - heaven!

site_logo

Lesley Ann S . 2024-06-25

MORE AT TripAdvisor

Lovely food and very pleasant and helpful staff. Only 5 mins by car from Leeds Castle and a great place to stop and have something to eat.

site_logo

Stephen Mason . 2024-06-24

MORE AT Google

We were looking for a last minute pub for Father’s Day dinner, and the George did everything to accommodate us. The food was excellent, one of the best sized portions of food we’ve ever eaten! Please visit if in the area

site_logo

Gavin Daniel . 2024-06-23

MORE AT TripAdvisor

We had a great time celebrating an important birthday.

site_logo

Grant Gooding . 2024-06-23

MORE AT Google

This was my first time of coming to The George at the weekend, having only ever been mid-week previously. There were only two of us and I had raved about the food to her. Unfortunately my experience at the weekend was not as good. We just had main courses and had to wait over an hour for them, with noone coming to our table during that long wait. When the lady came to put our meals on the table, they were just plonked down with no explanation as to the delay. We both felt that if there had been some explanation or recognition that we had been waiting so long, it would had softened the blow. The waitress (who was not the lady who delivered the food) later told us there was a different chef so things had been a bit delay, after I said about our disappointment with the delay. By this point we decided to skip dessert and leave as it had got late, which is something I never do! My friend certainly won't be back and I was embarrassed to have spoken so highly about it. I will return, but only during the week.

site_logo

Helen K . 2024-06-23

MORE AT TripAdvisor

Perfect pub for lunch. Felt at home as soon as we walked in the door. Staff so friendly and food was amazing especially my Thai Green Curry and homemade Steak & Stilton pie. Wish it was our local. Definitely worth a trip. We were only passing today, but will definitely be back.

site_logo

Karen Rumley . 2024-06-15

MORE AT Google

Lovely village Inn with amazing food - looking forward to our next visit! 14 06 24 Another visit today and still amazing food. Good menu, excellent service, and finest ales. Look forward to the next visit. Thoroughly recommended 👌.

site_logo

John F . 2024-06-14

MORE AT Google

lovely night with work mates as usual attentive service and great food

site_logo

Lindsay Dunn . 2024-05-30

MORE AT Google

Delicious food, friendly staff, and cozy atmosphere! Highly recommend! (Get the biscoff sundae for dessert, you won’t regret it)

site_logo

Jordyn Scheitler . 2024-05-24

MORE AT Google

Great food & service - we’ll be back!

site_logo

Jasmine Scheitler . 2024-05-24

MORE AT Google

We had the best evening last night. We visited with our friends from The States with a party of 17. Food was fabulous (won't need to eat for a week), service was great and Debbie and Jsaon were the loveliest of hosts. Thank you so much for making us all so welcome.

site_logo

Mandy Palmer . 2024-05-24

MORE AT Google

What a lovely pub with good food and friendly staff

site_logo

Jo Taylor . 2024-05-21

MORE AT Google

Loved this place, food was amazing and possibly one of the best pub lunches we have had! Will definitely be back.

site_logo

Steve Lloyd . 2024-05-15

MORE AT Google

I've not eaten there yet ... but for everything else great pub

site_logo

Bone Peacock . 2024-05-13

MORE AT Google

Busy little pub. Good food and service.

site_logo

Richard Bidwell . 2024-05-06

MORE AT Google

Just stopped for a coffee. Lovely locals and a great vibe in the pub. Excellent outdoor area.

site_logo

David . 2024-05-06

MORE AT Google

Just passing by and popped in. Wonderful warm welcome and excellent service, with good food. So friendly and nothing too much trouble. Thank you.

site_logo

Karen Longley . 2024-05-05

MORE AT Google

Lovely meal, food was superb excellent friendly service and our dog was made very welcome

site_logo

Carole Buxton . 2024-04-27

MORE AT Google

Absolutely gorgeous and met the resident dog called George xx

site_logo

pamela bell . 2024-04-26

MORE AT Google

Massive dish wish we had known a smaller was available. Would go again!

site_logo

Tony “Duke” Setter . 2024-03-24

MORE AT Google

Really lovely pub where we had dinner whilst staying at Leeds castle. 1.2 miles away from the castle. Av meal about £16 with a varied menu and lots of specials. Team their were great and they were flexible ie if you wanted salad and not chips they had no problems with that

site_logo

Julia Steer . 2024-03-13

MORE AT Google

Really disappointed. We’ve eaten here before and the food was lovely. We took friends here at the weekend and the food had really gone downhill. Lamb shank was cold in the middle and had to be sent back. Veggie lasagne was only lukewarm. The fish pie wasn’t great either. So disappointing as we had told our friends what lovely food they done. Sadly won’t be returning.

site_logo

May2June1946 . 2024-03-04

MORE AT TripAdvisor

One of my favourite restaurants/ pubs to visit. I used to come with my family, now I take my finance. The foods amazing, owners are so lovely and it’s literally like sitting in your own dining room but with table service! 100% recommend.

site_logo

Charlotte Adams . 2024-02-25

MORE AT Google

Went for a coffee after visiting Leeds Castle's Go Ape, and ended up getting a few sides (Chips, Onion Rings, Sweet Potato Fries and Nachos) which were perfectly cooked. The staff were attentive and nothing seemed too much trouble, despite only having a small bill. We will definitely return for a Sunday roast soon!

site_logo

Adrian Clarke . 2024-02-18

MORE AT Google

Fantastic food & friendly service

site_logo

Jason Chapman . 2024-02-15

MORE AT Google

Great food our food was lovely and hot which was a change from some places.its a very popular pub Staff very helpful and knowledgeable about the menu. The only drawback is the parking, we ended up in the church carpark, bit of a walk but well worth it. Lovely to see they are busy lunchtime in the week.

site_logo

Derek Wickwar . 2024-02-15

MORE AT Google

A very friendly and warm atmosphere selling a good range of food in the restaurant. 4 of us dined for lunch having a mix of Steak and Vegetable Fajitas. The food was hot and wholesome with good sized portions which would settle most healthy appetites. The staff were on point, friendly and swift. A very good range of desserts were also available but for most of us was a 'step too far' having been filled by the mains. I reccommend a visit and felt it was definitley value for money.

site_logo

John Fields . 2024-02-13

MORE AT Google

The George has a pleasant atmosphere. The food is well prepared and tastes delicious.

site_logo

Pieta Sinclair . 2024-02-06

MORE AT Google

Very nice pub with good food and friendly people.

site_logo

David O'Brien . 2024-02-04

MORE AT Google

We had a gorgeous dinner in this pretty country pub. Good size portions, tasty food and excellent awareness of GF dietary requirements.

site_logo

Angela M . 2024-01-29

MORE AT TripAdvisor

Great traditional pub in a beautiful location close to Leeds Castle. The team were friendly and helpful and made my husband's birthday lunch really lovely. Will definitely be back!

site_logo

902petrab . 2024-01-27

MORE AT TripAdvisor

Brilliant family lunch at the George today. The team were friendly and helpful and made my husband's birthday lunch a lovely occasion. Great location close to Leeds Castle and a beautiful pub too.

site_logo

Petra Bones-Welch . 2024-01-27

MORE AT Google

Lovely food and wonderful service! The steak and ale pie was very tasty and without fatty meat.

site_logo

John Morris . 2024-01-27

MORE AT Google

Excellent Sunday roast. Friendly staff and very efficient service. I had a Lamb shank, which was full of meat and great size portions. Sunday roast served all day and highly recommended.

site_logo

Gazza Hench . 2024-01-22

MORE AT Google

Another lovely meal. Can’t fault it!

site_logo

Dave Lamb . 2024-01-17

MORE AT Google

very poor Small Sirloin Steak just one large mushroom with a slice of uncooked tomato on top and just 11 chips oh if you want some sauce its £4.70 on top what crap very poor No Cheff would dish that up. must be a pot washer who thinks he can cook

site_logo

Kevin D . 2024-01-08

MORE AT TripAdvisor

Lovely boxing day meal, excellent service, friendly staff.

site_logo

Barry Huntley . 2024-01-05

MORE AT Google

Was recommended but wish we hadn’t bothered. Staff were unfriendly and definitely felt like a locals pub and outsiders weren’t welcome. Had to wait ages for menus and to be served , then food took a while to come. Would not recommend and definitely wouldn’t return

site_logo

FarAway713225 . 2024-01-03

MORE AT TripAdvisor

Very good food and pleasant staff

site_logo

Roy Evans . 2023-12-29

MORE AT Google

Well we weren't disappointed. Now the nearby road works are finished, its a bonus. Lovely food again. Great service with a smile . Our return guaranteed

site_logo

Firemandriver . 2023-12-27

MORE AT TripAdvisor

Fantastic welcoming, staff very accommodating and attentive. Food was excellent, even though it was very busy, there was nothing that was to much trouble, and you was not rushed. Well done 👏 A very happy Christmas to all the staff.

site_logo

cherylc652 . 2023-12-24

MORE AT TripAdvisor

Similary restaurants in South East

restaurant_img
4.0

109 Opinions

location-iconThe Street
Other cuisines
outdoor_seating_187348takeaway_187348delivery_187348

Didn't eat, just a pint with old friends I had not seen for decades. The place now has inside toilets but it's otherwise very much as I remember it. A proper old village pub with a warm welcome. Must try the restaurant some time. The walls are decorated with old clocks and memorabilia, which are for sale.

restaurant_img
4.0

732 Opinions

location-icon23 Fremlin Walk
Other cuisines
outdoor_seating_151836takeaway_151836delivery_151836

Moved from the convenient position next to The Mall. So I went elsewhere.

restaurant_img
4.0

947 Opinions

location-icon5 - 11 London Road
Other cuisines
outdoor_seating_152051takeaway_152051delivery_152051

Large, clean room and very welcoming

restaurant_img
4.0

2448 Opinions

location-iconBrenchley House Week Street Brenchley House, Maidstone ME14 1RF England
Other cuisines
outdoor_seating_274104takeaway_274104delivery_274104

Fairly average spoons. Interesting building

restaurant_img
4.1

1287 Opinions

location-iconWindmill Hill
Other cuisines
outdoor_seating_183388takeaway_183388delivery_183388

Fantastic Dog friendly Pub serving great food. The Staff are great working as a team, nothing is too much trouble. Will eat here again.