GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 536 opinions finded in 1 websites

site_photo3

Nº 79 in 331 in East Staffordshire

Nº 14 of 79 British in East Staffordshire

CUSTOMERS TALK ABOUT DISHES WITH..lambcookedsteakpiemeatladychickenprawnvegetablesliverturkeysaladfishroastpuddingold
Score
OpinionsNoteTripAdvisor5364.5

comment_iconOpinions

My husband and myself decided to have a drive out and have lunch at this venue. We had a lovely welcome. Two young ladies with lovely smiles. We opted for the fixed price lunch menu. My husband had the local butcher's sausage on mash and lovely fresh veg. He also had lovely leek and potato soup for a starter with warm bread. To start I had prawn cocktail which was really nice again with warm bread and butter. My main was the mini fish pie and veg. Well it's wasn't very mini. It was beautiful. We had a side of home made onion rings. Just lovely. The whole thing from start to finish was thoroughly enjoyed by us. Definitely worth the trip out from Stonnall. Thank you ladies for your lovely service and chef for beautiful food. We will be back. We can't recommend the Forester's highly enough.

site_logo

Emsie65 . 2024-11-12

MORE AT TripAdvisor

This is such a lovely place and the food is excellent. I have now been four times and the food has been good every time. Service is great and they are really friendly - definitely worth a visit.

site_logo

bluepoppyfield . 2024-10-25

MORE AT TripAdvisor

My friend and I came here for lunch and in general things were very good. The pinot grigio was lovely and my friend loved his burger. I had the Dover sole, and it was inexplicably salty, to the point I almost didn't want to eat it. I was hungry, so I ate about half of it before I brought the issue up. I was told that the only seasoning used on it was white pepper, and felt a little like they didn't believe me? I generally like quite salty food, but this was ridiculous. I mentioned it again before we got the bill, but no money was taken off and I didn't feel like pushing the issue. It was a shame, because other than that the fish was cooked perfectly and everything was to a good standard. Would not go again.

site_logo

Yasmina . 2024-10-12

MORE AT TripAdvisor

My wife and I stopped here for an impromptu lunch. The lunch menu is just that, so if you think you're going to walk away feeling like a turkey stuffed for Christmas, think again. However what we had was just right for us. This is a little gem well worth the visit. The wine menu isn't massive but appears to have something for everyone and the menu itself has a decent level of choice. Nice to see an independent establishment still flourishing as was evident by the lunchtime trade. Full marks to Emma and Pete.

site_logo

Ken B . 2024-10-08

MORE AT TripAdvisor

Staying locally in our caravan and asked site owner for a recommendation for Sunday lunch . Without hesitation she said ‘Foresters Arms’ just a mile from the site - she said many of their clients had been there. We were not disappointed. The Sunday Lunch menu was a one/two/three course option, with plenty of choice. We opted for main course and would see if we fancied dessert. We didn’t have dessert because we were full! Two of us had the ‘ four meats’ option, one the lamb and the fourth fish and chips. The homemade mushy peas were particularly praised. The roast dinners were excellent, copious and well presented, with vegetables on the side and a jug of gravy per person. Excellent all round -food, service and value!

site_logo

anniflower . 2024-09-19

MORE AT TripAdvisor

Found this place by accident having reached our intended destination and discovered the kitchen shut despite advertising all day menus. We were heading back to our hotel when I spotted The Foresters and thought it looked worth a try. Absolutely do not regret it. Had a superb meal, service was friendly and attentive, fish pie was delicious, and I thought it was all good value for money. Already planning a return trip.

site_logo

Jacqui L . 2024-09-07

MORE AT TripAdvisor

A slightly late review having just spotted some surpring variation in other reports. I'd no prior knowledge of this restaurant as we were simply passing by on a Sunday lunchtime after visiting some open gardens in the area. Rather optimistically I asked if they could slot us in (as it was certainly busy) and was pleasantly surprised when the manager said they could. We had a typical three-course meal which (with the exception of my wife's soup) was very good indeed. Service was spot on and I was happy to leave an unsolicited tip, so I'd happily revisit if in the area.

site_logo

Chris and Jean . 2024-09-02

MORE AT TripAdvisor

Arrived for our meal at 6 45 We were shown to our table and shortly after they took our order for drinks about 15 minutes later they arrived. they then came and took our food order we had 3 Prawn cocktails for starters and one soup it took 30 minutes before the starters came out. after we had eaten them which they were very nice indeed. The problem was we then had to wait a further 30 minutes for the main course. 2 of us had pies and greens with mash the cabbage was not all-Dante but raw and cold I have had better pies at a chip shop 1 of our party had the Salmon It may have been enough for a child but certainly not for an adult. It was the first time we had been and it is certainly the last.

site_logo

Alan W . 2024-08-03

MORE AT TripAdvisor

Booked a table at the Foresters for Saturday night, easy process. Staff polite showed us to our table and gave us a menu. Lots of choice for all. I had the dirty cheese burger not something I would normally have but glad I did. Couldn’t stop eating it. Great to know local ingredients used close the the pub. Other food tried chilli chicken, succulent and tasty with egg fried rice and an aisan coleslaw. Desert was bread and butter pudding. Great value and a superb atmosphere. So much so went back the next day for Sunday lunch. Didn’t disappoint either good selection of one, two or three courses, offering quite a selection to all tastes including some non typical Sunday lunches. Beef was tender and local, large Yorkshire pudding, roasted veg, mash (to die for) roasties 4 different veg and the best gravy I have tasted. Staff are friendly and kind, totally met our needs. The landlords Pete ( the Prat 🤭) and Emma super attentive with a warmly greeting. Would totally recommended this eatery by far out of others close by. I wish you the best in your endeavour. We’ll be back 😀

site_logo

nothappy772 . 2024-07-28

MORE AT TripAdvisor

Table for six at 7pm on a Saturday night, you would expect to be sharing with the masses, strangely the six people in the restaurant left just after we arrived? Service was not rushed, staff were all accommodating and food was quality pub standard, unfortunately as we were the only people left in the dining room after 8pm it felt a little pressurised as though we keeping the place open with no one in the bar, given the number of staff working I wonder if they had a high number of no shows? Friends have visited for Sunday lunch and recommend the food and service.

site_logo

j0hnhill . 2024-07-21

MORE AT TripAdvisor

We had a Friday night meal and we were very impressed. There was a fish & chip special on - chips were just like from the chip shop.. delicious! Fish pie was full of fish :) Service was friendly. We thought the drinks prices were on the higher end.

site_logo

Zoe L . 2024-07-13

MORE AT TripAdvisor

I ordered the Salmon with Wild Rice with Broccoli Spears. The portion was very small, and the rice was White and nothing special (certainly not Wild Rice). When I queried why this was the case the Manager had to check the menu for clarification! She then asked the chef who informed her that he didn't have any. She seemed surprised when I said I wanted what I had ordered, by responding "it isn't like I have given you potatoes or chips", missing the point completely. She said "I think you are being a bit..." I retorted by saying that she had missed the point, but she still said that I should understand her position and she didn't know they had no Wild Rice and anyway its the same as White Rice. Fact..no it isn't and they should tell us before ordering and the Management should be familiar with the kitchen. Not my fault, but theirs. On paying the bill, the Manager was still adamant that they were not at fault, white rice is same as wild rice. Fact, Wild Rice Is a form of grass, healthier and packed with protein which is why I chose this from the menu. It is part of my regular diet, so I am not stupid, and I will not be spoken down to and shouted at from the bar on exit. We have been there many times, and recommended the place, but this time was embarrassing, seems like they have had plenty of practice at dealing with their complaints, rudeness came easy.

site_logo

Top Fan . 2024-07-05

MORE AT TripAdvisor

Family has been before, a while ago. I’m here from Australia visiting and wanted a traditional pub lunch. It did not disappoint. The service was excellent from beginning to end. A good choice of local beer and “home cooked” food. I had the pork and apple pie with greens and mash, mum had the Dover sole with hollandaise on the side. Dessert was biscotti cheese cake with was scoffed down. Would definitely go again.

site_logo

Michele A . 2024-06-23

MORE AT TripAdvisor

First time there. Wait 70mins for meal, (took photo of menu and then meal) despite being empty, group was getting hungry so ordered starters hoping for something quick & edible but waited ages for that and was poor quality ding ding overpriced food. Waitress nice, manager extremely rude and arragont. We rated the Food 2/10 . Meals did not match menu ingredients at all and was told recipe was changed but menu not updated? Owner physically aggressive and accused gentle sweet lady of lying and trying get free food, said there were cameras everywhere videoing . Disturbing experience. No refund or compensation offered obviously. Very expensive for rubbish food. £17 for dogs dinner. Ramsey nightmare material. Avoid at all costs!

site_logo

jedi o . 2024-06-12

MORE AT TripAdvisor

An excellent restaurant with a menu that should appeal to all ages. Ingredients are all local - with meat from Paul Shum - and beautifuly cooked. Staff are friendly and very helpful. The only, very slight, observation is that they should have an IPA on draught but I understand that one will be supplied soon.

site_logo

LichTraveller . 2024-04-12

MORE AT TripAdvisor

My sister and I spotted this pub whilst driving around local area. ( I live abroad and was visiting family) Never been here before. Very busy lunchtime service. We hadn't realised it was 2.30 but they still accommodated us for lunch. We opted for the 2 course lunch. Super tasty starters, delicious main course. Very friendly and welcoming staff. Big shout out to Riley (only 3 days into his job) Well done to him. Always busying himself clearing tables etc , and attentive to his customers. Very nice young man. In fact the other staff members were equally as friendly and professional. Food was delicious. Service great. Would recommend.

site_logo

S8847EKkayt . 2024-04-11

MORE AT TripAdvisor

Sunday lunch beautiful, treacle spongelovely. Aspalls cider aa delight. Staff very attentive. Well worth a visit and reasonably priced

site_logo

Ctfreeman . 2024-04-07

MORE AT TripAdvisor

I had steak asked for it well done came out cooked on the outside but rare in the middle sent it back for it to come back still the same so I refused to eat it but had to request money to be taken off the bill they would only deduct £3.00 shocking it was, so I replied I won't be coming back , also u have to order extra chips because there wasn't enough for a child let alone adults, absolutely disappointed with foresters Yoxall

site_logo

Peggy G . 2024-03-16

MORE AT TripAdvisor

Exceedingly welcoming and attentive staff. Excellent food, very helpful with dietary requirements, a separate menu for gluten free diets. A great atmosphere, we had a lovely time and we would certainlyrecommend.

site_logo

Penny G . 2024-03-14

MORE AT TripAdvisor

Today we visited for Mother’s Day lunch! The food was fantastic, so fresh, so tasty and we all loved all 3 courses!! The service was excellent, really warm and accommodating! Such a lovely place to go as a family, great atmosphere and cannot wait to visit again!

site_logo

RJshearer . 2024-03-10

MORE AT TripAdvisor

I visited with my extended family for Mother's Day lunch. There were ten of us. Our table wasn't ready when we arrived so we had to wait 15 minutes by the bar. This was ok though as we know that pubs can get very busy on Mother's Day. Once seated we were given a single sheet menu with the Mothers Day choices on it. This closely resembled the Sunday lunch menu, which was the only one I could find online. The food was very good, a nice choice of roasts. It was served quickly and there was plenty of it. The serving staff were a little glum. The experience was spoiled when we received the bill. One of the few differences between the Sunday Lunch and the Mother's Day menus was that the latter didn't have an option to have less than the courses. Admittedly I had seen '3 courses £29.95' in small print at the bottom but had assumed, having seen the other menu that 2 courses would be an option at a reduced cost. A few of our party declined dessert, one for medical reasons, and received no warning that they'd still have to pay for it. Also there was a 10% service charge for parties over 6, added to it. I realise you pay more on Mother's Day and accept that. But the con here is that if an individual was to visit and have 2 courses any other Sunday, the cost would be £21 (£24 for 3). On Mother's Day, with family, the exact same 2 dishes were £32.95. I think this is a crafty, moneymaking con and will not be visiting again.

site_logo

Lynnette C . 2024-03-10

MORE AT TripAdvisor

My recent visit left me with mixed feelings. The food quality was great, and couldnt be faulted however, certain aspects of our dining encounter left much to be desired. Firstly, our group included two individuals with disabilities who couldn't partake in the dessert portion of the set menu. Despite this, we were charged for the full set menu without any accommodation for their inability to enjoy dessert. This practice felt discriminatory and lacked sensitivity towards customers with special needs. Furthermore, we encountered an attempt to overcharge for a kids meal at £14.98, which was an unpleasant surprise when the menu we ordered from said £8. When queried with the waitress she tried to tell me that I'd been given the weekday menu and it's more expensive at weekends. It's disappointing to see such practices aimed at exploiting customers, especially families with children - particularly when the meal was chicken nuggets and chips for a 2 year old. We stood for 20 minutes in a busy area for our table to be ready, and had to remind staff on a few occasions that we were waiting for supplementary items we had ordered. To add insult to injury, a service charge was automatically added to our bill without prior notification or exceptional service to justify it. While the food itself was enjoyable, the issues with discriminatory pricing and overcharging for certain items detracted significantly from our overall satisfaction. I hope the management addresses these concerns promptly to ensure a more inclusive and transparent dining experience for all patrons in the future.

site_logo

Laura C . 2024-03-10

MORE AT TripAdvisor

Overall very good. The only thing that let it down was the chips. Didn’t seem like triple cooked and had a bit of a chip shop taste too them. Will return but ask for fries as opposed to chips.

site_logo

markpW4152WV . 2024-03-09

MORE AT TripAdvisor

Excellent food and warm friendly atmosphere. Teriyaki salmon highly recommended! Also faggots, mash and mushy peas. We all enjoyed an excellent family meal out. Thank you!

site_logo

Jane P . 2024-02-24

MORE AT TripAdvisor

A superb birthday meal. Very much appreciated by locals as a number of tables were occupied despite it being a wild Tuesday night outside! And well positioned for passing traffic. Very friendly staff who juggled our orders so that we could have different vegetables from those listed on the menu. I had Pork Belly Roulade - excellent and not much fat on it. All meat supplied by a local butcher - Paul Shum - whom Dave Myers (Hairy Biker) frequents. Fairly priced and will definitely return soon.

site_logo

LichTraveller . 2024-02-21

MORE AT TripAdvisor

Absolutely amazung food. Very friendly and warm atmosphere. Eaten here on 2 occasions, and booked to go again. Very friendly helpful staff who cant do enough for you. Would highly recommend.

site_logo

V3174MCleese . 2024-02-12

MORE AT TripAdvisor

Friendly and efficient staff, nice surroundings and excellent food, all at very reasonable prices. Enjoyable lunch today.

site_logo

Biggles6953 . 2024-01-12

MORE AT TripAdvisor

Great service, nice pub and fantastic food! We have been here a few times and have always come away happy! Previous trips we have had Sunday roasts but came mid week - mixed seafood starter was excellent and then had the roast, trio of burgers and ribs and all excellent. Chocolate fondant gets a special mention but all puds good. Great beer and wine (Rioja) so all to love - thanks to the excellent staff and this is how a pub should be!

site_logo

Mike M . 2023-12-07

MORE AT TripAdvisor

We have visited the Foresters Arms many times now and will do so in the future too. The food here is excellent, with an extensive menu and the meals are reasonably priced also. I must give a special mention to front of house Emma, the star of the show, definitely an asset to the Foresters

site_logo

BoardingPass692055 . 2023-10-07

MORE AT TripAdvisor

We are a family of nine who just turned up and were greeted by friendly staff who managed to accommodate us, The menu was fairly extensive and the food very good.

site_logo

william j . 2023-10-02

MORE AT TripAdvisor

When you walk into any establishment and are welcomed.like this, you feel good. When the food delivers on the welcome, you feel better, and when the staff show real interest in your enjoyment, then everything is excellent. This place delivers on all three counts.

site_logo

Welltravelled0765 . 2023-09-17

MORE AT TripAdvisor

Lovely food and very welcoming staff. We visited on the way home and we were accommodated with no problem. Good attentive service

site_logo

Resort520183 . 2023-09-17

MORE AT TripAdvisor

I was actually looking for a pub that had the match on. This pub was too posh for that but they kindly gave me a Wi-Fi password. We had Sunday lunch whilst we were there. It was very good and I’d definitely recommend it. Only minor issues- not enough veg - I thought we were getting one each, but it was to share. And not enough gravy. We did ask for extra but £1.50 for a tiny jug didn’t seem good value.

site_logo

AntonB415 . 2023-08-27

MORE AT TripAdvisor

Lovely old pub/restaurant, extensive menu and the food was really good, we were a large family of 9 people including children but the managed to accommodate us. Really lovely staff very friendly and helpful. We will definitely call in again if in the area.

site_logo

william j . 2023-07-21

MORE AT TripAdvisor

Great restaurant. Food superb Emma is a real star. We stay locally in our caravan quite often. Always a warm welcome. Thank you. See you again very soon.

site_logo

local10123 . 2023-07-14

MORE AT TripAdvisor

Greeting n service very good food a disappointment overpriced only ones restaurant asked for a little extra gravy for the pies n mash extra charge on bill £1-50 disgusting will not be returning

site_logo

Hilary L . 2023-07-08

MORE AT TripAdvisor

Had a meal with my husband at The Foresters Arms last night. They had a steak night on the menu we both decided to have. Various steaks available along with a bottle of house wine. The cut of steak was unbelievable and was cooked to perfection. Excellent value for money. Excellent service nothing to much trouble. Definitely pay this establishment a visit.

site_logo

109janb . 2023-07-06

MORE AT TripAdvisor

I’ve been a few times now, always at lunchtime. The service is excellent, really friendly staff and the food is so good. A lovely place with a good atmosphere.

site_logo

clarecee2017 . 2023-06-24

MORE AT TripAdvisor

Visited for Sunday lunch today, haven’t been for a long time but will certainly visit again. Very pleasant and helpful staff, food was superb, couldn’t fault it.

site_logo

chrisjohn81 . 2023-05-21

MORE AT TripAdvisor

Good Food , very slow and ask a lot for simple things, ran by alot of youngsters but having said that all friendly and polite and the food was very good based on the fish n chips we had

site_logo

Mark J . 2023-03-25

MORE AT TripAdvisor

Food was mediocre staff standing about talking had to wait 15 mins to get served it was recommended to us but won't be going again

site_logo

pmC8333SX . 2023-02-25

MORE AT TripAdvisor

Love, love, love it here I don't understand the negative comments? We have had nothing but great food and friendly service 😊 The food is always worth the wait 😋 Will continue to use and recommend this place 👍🏼

site_logo

Envataar . 2023-02-25

MORE AT TripAdvisor

We droppped in for some sandwiches at Saturday lunchtime. The young staff were really friendly and helpful; the beer ( Timothy Taylors ) was good, and the food (when it came) was much better than average. The only disappointment was that we had to wait...

site_logo

Geoffhailz . 2023-02-13

MORE AT TripAdvisor

Having been to the Foresters twice quite recently i just had to write a review Service from the waiting on staff was faultless, polite, pleasant very very helpful, the food absolutely spot on. I would have left a decent tip but unfortunately did not have...

site_logo

John d . 2023-01-22

MORE AT TripAdvisor

We travelled 1.5 hrs to meet my daughter and her husband who had also travelled 1.5 hrs for Christmas present handover and lunch. We had not been here before but we will certainly visit again. The service was excellent and food was good ….if a...

site_logo

carolmJ116WU . 2022-12-18

MORE AT TripAdvisor

We ate here whilst staying at Brankley Farm Cottages nearby. The young staff were really lovely and helpful. We both had the steak which was cooked to our requests. All the sides well cooked with proper onion rings. My friend said her desert, home made...

site_logo

Marycache1 . 2022-11-24

MORE AT TripAdvisor

Nice run of mill food, friendly staff, well kept pub, thought id try it while staying a few nights at the Hilton will definitly return to try it again sometime

site_logo

U4847TWlaurah . 2022-11-21

MORE AT TripAdvisor

Our Wagyu burger and scampi & chips were excellent. Scampi is so often overcooked and portions small but these were a generous portion and lovely and juicy. The chips are proper chips - peeled and cut on site and - my goodness! - they actually...

site_logo

540bethanw . 2022-09-27

MORE AT TripAdvisor

Outstanding service from all staff, very friendly and polite a team that makes the business run like a dream! Fantastic all round! The food was absolutely impeccable great portion sizes too! Without a shadow of a doubt a return visit is definitely on the cards!

site_logo

kellygD6275AP . 2022-09-01

MORE AT TripAdvisor

Enjoyed a family meal, the decor was very inviting and the staff were very friendly and we was well looked after. We all had starters, garlic bread, salmon shanty, pate and garlic prawns. The garlic king prawns were in a delicious hot sauce but the...

site_logo

taffydelboy . 2022-08-17

MORE AT TripAdvisor

We called at The Forester Arms on our way to a holiday on Derbyshire, hoping for a snack and drink. The pub looked so inviting, lovely hanging baskets outside etc. We had never been before and although it was a Sunday and they were serving...

site_logo

MrsSuperFussy . 2022-08-10

MORE AT TripAdvisor

Food mediocre but expensive. Not a great choice of main meals and not flexible. Would not recommend.

site_logo

lloydsh . 2022-05-17

MORE AT TripAdvisor

Fantastic food fresh hot and great value beautiful beer garden and the staff couldn’t have done more we will return soon

site_logo

A8481JSjoshw . 2022-05-15

MORE AT TripAdvisor

We have just had an excellent meal. It was steak night so we both chose sirloin steak which was very tasty and from the local butcher. We finished off with a very good home made bread and butter pudding. We had a very enjoyable evening....

site_logo

mikethebike3 . 2022-04-07

MORE AT TripAdvisor

Visited mid-day Saturday 19 March with wife and daughter. I ordered the fish 'en croute' - a disaster! The 'croute appeared to be a Yorkshire pudding (with very soggy base) - fish very dry with stale smell - topping very dry - over cooked new...

site_logo

chinacrock . 2022-03-24

MORE AT TripAdvisor

We gave the pub prior warning that one of party was vegan. They were offered one option - a Thai curry. The meat eaters food was good, but a little cold. The vegan curry was minimal and contained very little substance. There was no offering...

site_logo

Y6764QBkateb . 2022-02-20

MORE AT TripAdvisor

They got the order wrong 3 times, but we accepted 2 of the incorrect items. They took 15 minutes longer (not the 5 minutes they promised) to bring out the replacement for the one we rejected. By which time the rest of us had all...

site_logo

860darrenh . 2022-02-13

MORE AT TripAdvisor

Just finished a lovely meal at this fabulous , family pub. The food is all home cooked and locally sourced by the amazing owner who takes great personal pride in the business and is just so friendly ! As a local business owner who has...

site_logo

sarahbG417FG . 2022-02-13

MORE AT TripAdvisor

Third visit to The Forresters & we were not disappointed. Great food, helpful staff & lovely atmosphere. The food is so tasty & the portions are a good size. We will be returning again soon.

site_logo

Maxine S . 2022-02-13

MORE AT TripAdvisor

We always seem to pass this way on a Monday, when it is closed. This time a Thursday and we experienced what we've been missing. Both meals excellent and reasonably priced. Good choice of fish and veggie meals. Lovely ambience; plenty of space; friendly service.

site_logo

davidpearce2014 . 2022-02-04

MORE AT TripAdvisor

We visited here as 2 couples this evening after a lovely evening at Hoar Cross Hall. We popped in for a night cap on the way home. Was all very nice until the owner decided to walk to our table and loudly announce in front...

site_logo

traceyraw . 2022-01-29

MORE AT TripAdvisor

My mum & I visited for Christmas Lunch yesterday. I was delighted to see it was busy (fears of cancellations owing to positive Xmas day LFTs seemingly unfounded). The welcome was warm, the service friendly but not rushed, the food was super (I had beef,...

site_logo

Loula185 . 2021-12-26

MORE AT TripAdvisor

My partner and I visited for Sunday lunch today and was greeted by a lot of young staff which, I must admit, concerned me as I have been in the hospitality industry for many, many (too long!!) years myself but I was pleasantly surprised. All...

site_logo

marvellousmarie2016 . 2021-12-05

MORE AT TripAdvisor

Saw this pub & decided to give it ago for Sunday lunch, first impressions were good ,regarding service & ambiance. We were found a table & were given one menu the set menu for Sunday Lunch . Although we are not vegetarians we sometimes choose...

site_logo

MichelleD623 . 2021-11-24

MORE AT TripAdvisor

Good carpark, just one disabled spot. Just two of us so an early spot was taken on a Sunday. Décor looked fresh and fittings new. Chose a starter and traditional Sunday roast. Madam chose the Lamb, I chose the Pork....mistake it was very dry and...

site_logo

John l . 2021-11-08

MORE AT TripAdvisor

I love this place. We have only recently moved to the area but this place has become our firm favourite (and our 2 year old daughter’s). The staff are friendly, welcoming, funny and warm. The food abs drink always arrive promptly and is lovely. My...

site_logo

boo2740 . 2021-10-28

MORE AT TripAdvisor

Been for lunch food was lovely and pub itself was very well decorated starter for 2 then main which we couldn't finish due to portion sizes would definitely go back

site_logo

Claire B . 2021-10-21

MORE AT TripAdvisor

Our meal did not live up to expectations, The starters were good and with generous portions so all boded well at first. However the main course was not of good quality: the nut roast was exceptionally dry and everyone's salad consisted substantially of lettuce with...

site_logo

graeme r . 2021-10-14

MORE AT TripAdvisor

Booked for Saturday night, not been for at least 18 months, i was not disappointed, food was lovely, cooked to perfection, even my egg was done in the proper way. Portions were big, did leave a little to make room for the pudding. Well looked...

site_logo

Z2696QYjenniferf . 2021-10-04

MORE AT TripAdvisor

A wonderful warm welcome from Pete the owner and his lovely team. There was a really nice atmosphere and everything was immaculately clean. Every team member was polite and helpful. You couldn’t have asked for better service. The food was very tasty. The locally sourced...

site_logo

Lichfield115 . 2021-10-02

MORE AT TripAdvisor

Meal last night with the family. Lovely staff however the food very bland, small portions and very overpriced for what was served.

site_logo

Leon R . 2021-09-25

MORE AT TripAdvisor

Food was excellent. One of the best cooked steaks I can remember eating. The staff were brilliant and polite. The owner even bought us our first drink ad it was our wedding anniversary. Fantastic touch and will definitely be going back again.

site_logo

709alanv . 2021-09-22

MORE AT TripAdvisor

Unfortunate experience for a Sunday lunch. Paid a deposit of £45 for 5th September for 7 adults 2 children. Ordered drinks on arrival, daughter had tea but no milk arrived no sugar no spoon had to ask by the time it came tea was cold....

site_logo

costatourist . 2021-09-21

MORE AT TripAdvisor

The Forresters Arms has obviously been refurbished recently. Everything was clean and the staff were very helpful. The cloakroom was spotless which was nice to see. With regard to food, I chose a "sharing fish platter" which when served looked like a main course and...

site_logo

BoundlessEnergy . 2021-09-09

MORE AT TripAdvisor

Visited last Sunday for Sunday Lunch having previously visited on Saturdays and had takeaway, I simply cannot recommend TFA enough, Pete and his team are just so friendly and efficient, the food is out of this world and the value for money is exceptional. We...

site_logo

Ian R . 2021-08-12

MORE AT TripAdvisor

Dropped in today on the way back from dovedale. Great people great food, nice drink. Thanks. Daz, Emma and little dog Bramble!

site_logo

975darreno . 2021-08-12

MORE AT TripAdvisor

Slight mishap with the food going to the table next to us but soon rectified. Manager and staff very nice, helpful and made the night with lots of banter. Would highly recommend food excellent. Thank you for my candle on my pud ( birthday treat)...

site_logo

532cathh . 2021-08-12

MORE AT TripAdvisor

Well what can I say!!! This place is amazing!!! Great food, great staff and great drinks. 24 of us made a last minute booking as another restaurant cancelled our booking due to covid and Leanne could not have done more for us.. just absolutely amazing….if...

site_logo

983alanar . 2021-08-07

MORE AT TripAdvisor

Omg, seriously don’t know where to start except to say…you WILL NOT leave dissatisfied My hubby and myself visited 21/07/2021, we were greeted beautifully and with sincerity, the staff obviously enjoy their job, nothing was too much trouble and as for the food??? It was...

site_logo

D6582XDjennyc . 2021-07-28

MORE AT TripAdvisor

Do not visit on Sunday evening. The foresters was recommended to us so we gave it a go for my husband's birthday. We booked well in advance but we got there at 6.30pm as booked but the food had clearly been standing for hours &...

site_logo

margaretfX9877TI . 2021-07-26

MORE AT TripAdvisor

Visited the Foresters Arms in 17th July with friends for an evening meal. As always, the staff were amazing. So very polite and welcoming. Food was gorgeous. Home made chicken and ham pie with the best pastry I’ve tasted for a long time. Chips are...

site_logo

nneal64 . 2021-07-19

MORE AT TripAdvisor

Visited the Foresters today and would highly recommend. Party of 5 looked after from start to finish, food and staff excellent. All done with a smile a credit to Pete and his team.

site_logo

andrewjD5092UB . 2021-06-27

MORE AT TripAdvisor

Excellent service and a great meal, would highly recommend. Had two adult meals and two children’s meals, the portions were generous.

site_logo

A973ZDpaulj . 2021-06-05

MORE AT TripAdvisor

Pete and the team as Friendly and welcoming as ever. Service throughout attentive , courteous, ensuring all needs were met , before even realised. Outstanding. The food as always was cooked to perfection with each course a delight . We shall be returning at every...

site_logo

kittpeter . 2021-05-30

MORE AT TripAdvisor

Amazing food and amazing staff all a credit to Pete. Keep up the good work . We stay locally in our caravan. Always a warm welcome from Pete and staff. Sunday lunch is wonderful.

site_logo

local10123 . 2021-05-26

MORE AT TripAdvisor

Visited today . Missed this lovely pub, Pete and his team. Sunday lunch was excellent, beautifully cooked and presented. My husband loved the Burton Bridge ale. Sadly I could not sample the fantastic gin range due to driving but hope to soon. Thank you, will...

site_logo

JANE R . 2021-05-23

MORE AT TripAdvisor

Lovely pub in Woodmill with lovely people. Leanne is a star. Just wanted to say thank you for helping us

site_logo

Jono G . 2021-05-22

MORE AT TripAdvisor

We used this place before lockdown and have came back after and it does not disappoint fantastic night on Thursday we had the steak offer and it was lovely and a bottle of wine aswell, food was outstanding and quick and the waiting on staff...

site_logo

A8481JSjoshw . 2021-05-21

MORE AT TripAdvisor

The highlight of today’s Government permitted health walk was dropping by to get two piping hot teas from the Foresters safe outdoor snack kiosk. Plenty of car parking and easy to find on A515. Served with a friendly mask and some banter ensued. Will back...

site_logo

PJG6789 . 2021-02-13

MORE AT TripAdvisor

Ordered on line , Fish and Chips with an additional Kebab Meat, delivered within the Hour absolutely fantastic !! The Batter on the Haddock was wonderful. Thank you !!

site_logo

Bruce L . 2020-12-18

MORE AT TripAdvisor

Had Sunday lunch and was not disappointed. Food was delicious and the almond bread & butter pudding just amazing 😋😋 Staff attentive as usual lovely friendly atmosphere. Would definitely highly recommend this place and if you do have to wait which we didn't it's well...

site_logo

Envataar . 2020-10-28

MORE AT TripAdvisor

Having been here before, this was a disappointment. We had to wait 90 YES 90 minutes for our food. Having asked several times when our food would come out we were told it's on the way. No it wasn't, as everyone who came in after...

site_logo

Mary E . 2020-10-18

MORE AT TripAdvisor

Absolutely amazing, lovely food, cannot fault it. Will definitely be going again.nothing too much trouble for the staff

site_logo

Lottie11165 . 2020-10-18

MORE AT TripAdvisor

Steak night! With a ribeye steak cooked to absolute perfection....couldn’t ask for more...amazingly friendly staff who genuinely could not have done any more to make us feel comfortable and ensure that we were enjoying ourselves. To quote my 5 year old...”that food wasn’t lovely...it was...

site_logo

445tallyb . 2020-10-15

MORE AT TripAdvisor

3rd time in a few weeks visiting here and this time for the Thursday steak special deal. Encountered a log wait for our order , 40 mins , this may not seem a long time to some but due to Corona the restaurant running at...

site_logo

Geoff M . 2020-10-11

MORE AT TripAdvisor

Just had cod and chips twice and a ham and pineapple pizza from here as a take away. The pizza was gorgeous according to my daughter and the fish and chips were truly amazing. I can only truly compare them to George's at Belper and...

site_logo

andrewjD5092UB . 2020-10-10

MORE AT TripAdvisor

We saw this lovely looking place on the way to visiting my mother in hospital in Tamworth and thought we’d try it out for lunch on our way home to Leek in the Staffordshire Moorlands. What an excellent choice that turned out to be! We...

site_logo

Bomber1863 . 2020-10-10

MORE AT TripAdvisor

Just had another fantastic takeaway from The Forresters, Yoxall. Haddock and Chips cooked in beef dripping, the smell, the taste, just like when I was a lad. Superb.

site_logo

AGarcarz . 2020-10-09

MORE AT TripAdvisor

Visited the Forresters for a Sunday lunch. Beautiful food , lovely staff. ,three course menu which was very reasonable at £18.00 Although you could choose 1 or two courses at a reduced price. We will definately be returning.

site_logo

Phillyralfy2 . 2020-09-30

MORE AT TripAdvisor

We had a late Sunday lunch , very generous courses . Plus reasonably priced drinks.Plenty of meat & veg. with the mains. We managed a fabulous choice of desserts! Staff were very pleasant & helpful . Recommend this restaurant for all ages.

site_logo

59jg . 2020-09-29

MORE AT TripAdvisor

Similary restaurants in West Midlands

restaurant_img
4.5

436 Opinions

location-icon38 Market Place, St14 8HN , United Kingdom
British
outdoor_seating_185695takeaway_185695delivery_185695

We are visiting my wife's parents who have always lived in Uttoxeter. We come in from Canada 1 to 3 times a year for the last 20 years or so. Got tempted to visit this place for the first time by the sign/menu in the window with Breakfast served till 4pm. The food was spectacular. We have wasted good money and time on so many other places in the area that have more tourist appeal. Defiantly the beast English Breakfast hit that my wife and I have ever had in all our visits to England!

restaurant_img
4.5

56 Opinions

location-icon2 High Street
British
outdoor_seating_168571takeaway_168571delivery_168571

Love this place. Great selection of ales. Friendly atmosphere. Unpretentious local hub of the community. I love perusing the menu on the board and discussing options with other punters. All part of the fun. Never strangers for long

restaurant_img
4.5

103 Opinions

location-iconHigh Street
British
outdoor_seating_212110takeaway_212110delivery_212110

These were the best fish n chips I have ever tasted, and yes I have been to Rick Steins

restaurant_img
4.5

3 Opinions

location-icon8 Lancaster Park Newborough Road
British
outdoor_seating_235901takeaway_235901delivery_235901

Having worked at Hoar cross hall for the last three months and visiting the Lancaster cafe every day cannot recommend this hidden gem any more than the 5 stars it has. Tina Janet and Trouble! Have looked after us no end and will help with anything on the menu. The specials are always cracking too. Enjoy. Many thanks Ian and the gang

restaurant_img
4.5

40 Opinions

location-icon2-3 Old Saddlers Yard
British
outdoor_seating_185682takeaway_185682delivery_185682

The staff are so nice and the food is even better. I wish I could go everyday and with their prices I will probably be able too! In addition, the portion sizes are brilliant and it is suitable for everybody from young kids, to more elderly people. There is also an option to choose your own breakfast so if you are a picky eater, you can have whatever you want! Overall, I would highly recommend Saddlers, whether you want to go for breakfast or just a coffee (which were also brilliant by the way). The only negative things is that it is out the way of Uttoxeter's main town! It should be in the center because it is one of the best places in the whole town! Anyway, I would highly recommend this place and if you are going to go, make sure to bring someone else so they can also experience this delight!