GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 588 opinions finded in 1 websites

site_photo3

Nº 342 in 531 in Teignbridge

Nº 74 of 111 Other cuisines in Teignbridge

CUSTOMERS TALK ABOUT DISHES WITH..mustvegetablespuddingroastcookedladymeatfishsteakssteakpiecreamchickenoldcheesepork
Score
OpinionsNoteTripAdvisor5884.0

comment_iconOpinions

Sunday lunch here was one of the best we have had in some time! Staff very friendly and efficient and best of all was dog friendly for our pooch! Food, plentiful. tasty and hot

site_logo

Nannyhilly . 2024-09-15

MORE AT TripAdvisor

Myself and my family stayed at the Finlake resort for the week. We weren’t keen on the small portions/highly priced food, so decided to try the Claycutters. It was a beautiful sunny evening and the food was amazing. The staff were attentive and friendly upon arrival, and when ordering food. The manager constantly ensured all visitors were attended too and had food/drinks etc and the atmosphere was lovely. A truly lovely evening had by all.

site_logo

michelle . 2024-08-28

MORE AT TripAdvisor

We were on our family holiday to Devon when we visited The Claycutters Arms. From the moment we walked in the service was amazing, very attentive and accommodating. We started outside as our children wanted to play in the play park they have (which they rated highly) but as the weather started getting chillier we asked if we could go inside when our meals were ready, which there were no quarms about with the staff that were serving us. Our food came out and was amazing 👏 good portion sizing and great taste. My husband has dietary requirements and they accommodated that well and even checked when the meal came out that it was all OK for him. Great value for money aswell. We loved it so much that our children begged us to return before we finished our holiday. Which we did and yet again the food and service was spot on! Very consistent with their food quality and staff friendliness. I would 100% recommend go anyone in that area. Thank you 😊

site_logo

Francesca O . 2024-08-18

MORE AT TripAdvisor

A lovely pub serving superb food, we went for a Sunday roast and were not dissapointed. Dog friendly, service was speedy and drinks selection was great, caters for large groups also which is nice. We will return and compliments to the chef!

site_logo

welly21 . 2024-08-13

MORE AT TripAdvisor

Staying at Finlake lodges and booked here just because it seemed to be the closest place. We had a call a few hours before the booking to ask if we could arrive 15 minutes later due to a big party booking and they didn’t want us to have to wait for food. This impressed us before we even got there as they could have just let us turn up and have a long wait. As it happened the food came very quickly, the staff were excellent, friendly and attentive. We were served by Luke, Jaz and India who were all fantastic. The restaurant is clearly very well run. The food was also really lovely, good portion sizes and value for money. Highly recommend.

site_logo

Carly R . 2024-08-08

MORE AT TripAdvisor

We stumbled across this place, and we are so glad we did. We ordered on the app at the table in the spacious beer garden. Drinks soon came, followed by easily the best pub grub we have had in some time. Clean plates from all four.

site_logo

Ian M . 2024-06-29

MORE AT TripAdvisor

We are from bristol staying at finlake with our 2 dogs. I looked up places to eat & found the clayclutters arms so glad i did Just got back from having a fantastic lunch here ,I had hunter's chicken my husband had scampi I have to say it was the best we have had 😊 luke gave us a very warm welcoming Paul was very welcoming too. There was very good communication between them both (they obviously know how to run a well run pub) would definitely recommend this pub to anyone. Thankyou luck & Paul Sue & Don (Sadie & Ebonie) from Bristol x

site_logo

Suzanne l . 2024-06-27

MORE AT TripAdvisor

Lovely country pub! Food was amazing and staff were very friendly and helpful. Located in a very pretty part of Devon, would be enjoyable inside and outside.

site_logo

ashleigh s . 2024-06-26

MORE AT TripAdvisor

A wonderfully welcoming pub, with good customer service at the heart of what they do. The food was delicious (we had a burger, a Yorkshire pudding wrap & a kids meal, plus dessert) and the pub had a great vibe to it. Paul (the manager), the young lad waiting our table & all the team were really polite & attentive whilst retaining a classic village pub feel. Highly recommended

site_logo

Sarah C . 2024-06-23

MORE AT TripAdvisor

Had an absolutely delightful meal here at the weekend. The menu selections were impeccable and I struggled to know what to try first… will definitely be returning to try more. I went for the sweet and sour chicken balls which was an excellent choice. My partner had the chicken and beef burger which he said was also incredible. The service from Luke and his team was friendly and attentive which made our night out with friends super relaxing and nothing was too much trouble considering we also had a newborn baby with us. Will definitely be back to try more at this cosy pub

site_logo

ackp23 . 2024-06-23

MORE AT TripAdvisor

We had an evening meal here last week and thoroughly enjoyed it. Staff were all very efficient and polite, food was lovely and hot. We can recommend the cod and prawn fishcakes. Best to book in advance

site_logo

MolCheltenham . 2024-04-15

MORE AT TripAdvisor

Always a good Sunday lunch bet, tasty and hot. This time really poor, belly pork been in oven too long, tough and and stringy, barely warm and no taste to anything whatsoever, carrots hard, cauliflower cheese an unpleasant colour that put you off even eating it, toasties barely roasted, Yorkie seemed like it was made of hard paper, gravy was brown but tasted of water, sorry guys, not sure what went wrong 😔

site_logo

22hel1 . 2024-04-15

MORE AT TripAdvisor

Went to have dinner last evening 11/04/2024 , drinks arrived promptly as did our meal. My partner chose the Coq au vin, the broccoli was undercooked, the mashed potato was bland and in with the chicken was gristle. The broccoli and the gristle were discarded and he ate the rest of the food. My choice was pie of the day, beef and onion. To start, my plate was cold and would like to know what beef was used because the texture was unusual. We had finished our meal and the waitress took our plates away and asked if we wanted to see the dessert menu ,we said no and she immediately said, rather abruptly, do you want your bill. We felt we were pressured to leave.

site_logo

GCM M . 2024-04-12

MORE AT TripAdvisor

We visited yesterday for a family 40th birthday, a group of 10. In the booking we had requested a highchair, there was no highchair when seated so we asked the guy who seated us for a highchair for the baby, he never came back and neither did a highchair. The girl came to take a drinks order and we again asked she came back and said there was none left. Can he sit on a booster, not really he’s 1, so she came back with a highchair with the straps missing, so we had to make do, the baby kept slipping down but hey ho he had a highchair. We ordered and had a long wait for food, we didn’t complain as it was busy, food eventually came and was good. We then ordered deserts, all the deserts came bar 1, we mentioned this after about 5 minutes when they came to see if everything was ok. The final desert came out and pretty much straight away the bill. Once the bill was paid within a minute we was told we needed to leave as there were people waiting for our table, bearing in mind the missing desert had only just arrived and the long wait we had for food in first place. Up to this point we had enjoyed our evening but it seemed a bit like we have your money now f**k off approach. Very disappointed and will not return or recommend, like we would have done. We never leave without leaving a tip but on this occasion after that, we did! It ruined what was a nice evening. Now we are aware of the timings for seats but surely you factor in the delays for food and the delay because of missing deserts.

site_logo

GEMMA H . 2024-03-31

MORE AT TripAdvisor

A very disappointing experience at this establishment on Sunday 3rd March 2024. My husband and I came in on Tuesday 27th February 2024 in the afternoon for a drink and to have a look around and to enquire about booking for Sunday lunch on Sunday 3rd March 2024 for our 7th Wedding Anniversary. We were very impressed by the attentive service we had on Tuesday evening, just for drinks (we stayed for 2!) and liked the lay out of the dining area/restaurant so we decided to book a table for Sunday 3rd March 2024 to celebrate our 7th Wedding Anniversary. We were given a choice of 3 different tables to choose from and we chose the small one in the corner by the fireplace. We both spent the next few days looking forward to Sunday... When we arrived at approximately 2.50pm for our 3pm booking and gave our name I said we'd booked the table in the corner and was told "that one's not available anymore, we've had to make some changes and move you". "You will be sitting over there". The table that was pointed out was the one by the toilet and neither of us wanted to sit by the toilet so politely asked if we could sit somewhere else. This was the first disappointment given that we had been able to "choose" our table on the Tuesday. We were led to our table and a drinks order taken. We also placed our food order. The drinks arrived promptly and the food arrived very soon after, within less than 5 minutes. Upon starting mine I noticed that some of it was 'hot' but not piping hot like I would normally expect and some of it was just warm. At no point did anyone come to check if everything was alright so I had to get someone's attention and explain that my dinner wasn't hot enough. I was asked if I would like it re-heated. I asked what this meant and if it would go into the microwave because this would ruin it and was told by the waitress that she would go and check. Another waiting staff member returned, who said they would 'blast it in the oven'. I had actually expected a fresh one to be produced but nonetheless felt this preferable to microwaving. My dinner was taken away and returned promptly within about 1 minute but yet again it was warm in parts and hottish in others. No one came back to check if it was o.k My husband eats very quickly and doesn't mind not having his food piping hot like me but unfortunately I'm not that way. I like hot food to be piping hot because I take quite a long time to eat mine. I ate some of it and my husband finished off the rest. We had a look at the dessert menu but I was so disappointed by the whole experience that I chose not to have anything. This is not like me as I always have a pudding after my main course given the opportunity. I went to the counter to pay and feel that I was greeted rather bluntly. I said I wanted to pay the bill and was presented with my receipt. I asked if I was going to be asked "Was everything alright?". and was told "Yes I am going to ask you but I'm just giving you your bill to check that everything is correct on it". I was then asked me if everything had been alright and I relayed the above. I was asked what time we had booked in to eat and I said 3pm. I was told that 3pm is staff change over time which may have affected the service we received. I don't really feel that this is an acceptable explanation or justification because surely the customer service at 3pm should be exactly the same at 12pm, 2pm, 4pm, etc. The lady that I was dealing with said that she could take off the drinks. Upon reflection and having had time to think about it and sleep on it I don't feel that this was a fair resolution for the disappointment experienced. I have tried to bring this to their attention to see if they wanted to make contact with me but a week on have had no response so I have left this review which is something that I have never done before. .

site_logo

Maggie B . 2024-03-10

MORE AT TripAdvisor

So disappointed with the vegetarian nut roast which mainly consisted of risotto rice with no discernible nuts in evidence! The meat roast was appreciated especially by the dog. Waiting staff were lovely but won’t be going back!

site_logo

Soundsofjoy . 2024-03-03

MORE AT TripAdvisor

We had a lovely evening meal with our 10 year old grandson, and we were welcomed and shown straight to our table( even though we were very early). They had a lady who was training but took our drinks and food order efficient. The pub was quite busy, but food arrived swiftly and piping hot. There were a lot of choices on the menu and also a very good specials board. Portions were large. We had a very chilled and enjoyable evening. Special thanks to Georgia and Katie for looking after us, plus the landlord and Olive, the pub dog. Good luck, Georgia, for your new child

site_logo

billcarolpearson . 2024-02-14

MORE AT TripAdvisor

Just enjoyed excellent, reasonably priced, Sunday roast. The staff were friendly, helpful and professional. I am a vegetarian and have a serious mushroom allergy. I phoned the day before to alert them to this. I was amazed to find that, because the vegetarian options both contained mushrooms, they had sourced a pea protein based roast ‘chicken’ especially for me. What service! The manager even came to our table with the packaging, so that I could check the ingredients for myself. Fully reassured, I was able to relax and enjoy my meal..There was a good variety of fresh vegetables and they were not overcooked. I would definitely go again and highly recommend this restaurant, especially for those with special dietary requirements.

site_logo

Pam183 . 2024-02-11

MORE AT TripAdvisor

Had a fabulous meal on Saturday night, great menu, fantastic staff and all in a very welcoming pub. Great menu with lots of choice and a great atmosphere. We were staying up the road at Finlake and had seen this place advertised and really glad we visited - will certainly be back.

site_logo

Leggy2013 . 2024-01-29

MORE AT TripAdvisor

We hadn’t booked but luckily they fitted us in for a late Sunday lunch. They are open until 7pm we found out so will remember this as so many other pubs stop at 2/3pm. Good choice of food as apart from roast they do other meals, scampi etc. We all had the roast which was delicious. The roast comes in 3 sizes and was very reasonable…I had the small which was plenty and came with a huge Yorkshire pudding! The service was excellent and we didn’t wait long for the food to arrive. Would definitely recommend and we will be returning!

site_logo

Knittypink . 2024-01-28

MORE AT TripAdvisor

Staff were excellent, food was excellent, been before and will definitely come again , Pet friendly and the meals were reasonably priced

site_logo

Destination595514 . 2024-01-21

MORE AT TripAdvisor

What a little gem this place is. We were recommended the Claycutters by a friend as we were staying nearby at Finlake, We booked for 5.30pm and the table was ready they even put up a happy birthday banner as it was my 50th. The food, the beer and the service was flawless from start to finish. So much so we booked for the Sunday lunch the following day. Again the whole experience was great. The Sunday roast was lovely. I had beef my wife had chicken and my son had chicken nuggets. Next time we’re down that way we will 100% go back again.!! Thanks to all the staff

site_logo

Jaseb73 . 2023-12-04

MORE AT TripAdvisor

Excellent service , prices are good and food 9/10. Would recommend. And Very friendly staff. Generous portions. Altogether great place

site_logo

Nicky W . 2023-11-29

MORE AT TripAdvisor

Celebrated a huge birthday with 17 others. Jane and the crew at the Claycutters were magnificent from our initial enquiry through to the big day and really made our experience superb. The extensive menu provided choice for everyone all freshly cooked to order. We had a brilliant time. Thank you ‘The Clays’. See you on Tuesday for a smaller bash.

site_logo

Underacre . 2023-11-18

MORE AT TripAdvisor

Lovely family friendly restaurant, very warm and welcoming, very quick service with outstanding food. All 5 of my boys loved the starters and pizza

site_logo

Kevin R . 2023-10-25

MORE AT TripAdvisor

From the initial phone call through arriving, ordering food, drinks to saying good night ALL staff were really friendly and attentive. The pub is nicely directed and the menu is varied AND does include a more than usual choice of Gluten-free meals. All meals were lovely and really a fair price. The beer was well looked after and there was even a gluten-free beer. I would definitely recommend the Claycutter and we will be back whenever we are in the area. Thanks for a great evening to all of the team.

site_logo

AMW1970 . 2023-10-17

MORE AT TripAdvisor

What a fabulous place the Claycutters is! We visited today for our son’s 10th birthday. From the moment we walked in we were made to feel so welcome. The staff couldn’t do enough for us, they really went the extra mile to make a special evening for him - even putting up birthday banners. The food was absolutely delicious. The homemade pie was out of this world. I can’t recommend this place highly enough. Go and enjoy - you won’t regret it. Thank you to all at Claycutters for a wonderful evening,

site_logo

Sarah M . 2023-10-03

MORE AT TripAdvisor

We had a great meal, lots choice and the staff were very attentive. Thoroughly recommend. A myst for a stop off during a west to the west country.

site_logo

Minty1818 . 2023-10-01

MORE AT TripAdvisor

Highly rate the food,and friendly staff,went for the steak night amazing nothing was to much trouble for the staff so helpful

site_logo

pauloY9222OM . 2023-09-20

MORE AT TripAdvisor

Food was delicious, I had a lovely tagliatelle at a very reasonable price and the service was top notch (attentive and super friendly). The sweets looked great but sadly I was too full to try one. Very happy to recommend.

site_logo

craigcolq1 . 2023-09-13

MORE AT TripAdvisor

What a lovely place to eat. Food was good, the staff friendly and efficient. It is a very slick operation, with all staff using up to date technology to record your order. The atmosphere overall is relaxed and happy. If you've not been there before,...

site_logo

Philip L . 2023-09-06

MORE AT TripAdvisor

I've just had the large Roast Pork Belly from their Sunday lunchtime menu. Beautiful. Meat was tender, crackling was superb. And the addition of curly kale as one of the four veg on my plate, excellent! We'll be back later for live music and a...

site_logo

Love Audio P . 2023-09-03

MORE AT TripAdvisor

We visited as a family of 4 without a booking, it was quiet and we were seated promptly. The team were friendly and welcoming. Our food was served in good time and was hot and very nice. Only downside the oil used in the pizza...

site_logo

GEgemma . 2023-09-01

MORE AT TripAdvisor

Booked in advance as on holiday. Getting drinks and ordering food was efficient. The food was very average. Wasn’t asked if any sauces were required. My mother had a burger and the roll was very dry and inedible. Told the waiter and he didn’t care....

site_logo

724hannahm . 2023-09-01

MORE AT TripAdvisor

Food was mediocre, pricey for what is was, but welcoming. We hadn't booked, told we could have a table within 5 minutes, so we waited. Half an hour later a waiter arrived to take our order, outside. Too late really to go anywhere else, would...

site_logo

JenBRC . 2023-09-01

MORE AT TripAdvisor

Staying at Finlake holiday park and visited without booking. Full inside but tables outside so we opted to stay and just grab jackets from car as was starting to get a bit chilly and so glad we did! Staff were friendly and efficient in taking...

site_logo

E5833RKkarent . 2023-08-30

MORE AT TripAdvisor

Was a late booking as family were visiting at Bank Holiday. Thought we might struggle to find somewhere for 6 adults and a dog that also catered for gluten free, so booked when they could accommodate us without much research. We were absolutely delighted. The...

site_logo

X3336IJrogerc . 2023-08-28

MORE AT TripAdvisor

A fabulous Sunday lunch at this lovely Devon pub. The food was good quality and all the staff were warm and welcoming. Paul, the Manager is also a fabulous host. Highly recommended.

site_logo

972neilp . 2023-08-27

MORE AT TripAdvisor

NB. I would say that the rating for this place is unfair as it seems it’s because people struggle to use the booking system for customers eating outside, and not actually for the service and food (which is what TA is for). I think it’s...

site_logo

annabel0917 . 2023-08-09

MORE AT TripAdvisor

The food was delicious and the service was excellent my wife and I had a really great time and would recommend them to anyone

site_logo

Nomad13592491007 . 2023-08-08

MORE AT TripAdvisor

We visited for Sunday lunch as a family with my parents and my children. Food was lovely with great vegetarian options and delicious desserts. Very fast and efficient and friendly service.

site_logo

Claired30 . 2023-08-05

MORE AT TripAdvisor

Fantastic food! Turned up on our Motorbikes for a beer and something to eat. Great outdoor space, friendly service, and excellent food. Real pub grub! Highly recommend this place for service and food 👍🏻👍🏻

site_logo

ashley b . 2023-07-22

MORE AT TripAdvisor

After Visiting Stover Park Claycutters Arms is in an ideal spot for lunch. Superb Clay salad (to me a ploughman’s) with so much - cheese, ham, pork pie, tasty garnish and my husband had the Sea Bass fish cakes. Lovely cosy atmosphere, friendly staff and...

site_logo

J7392ZKtonyh . 2023-07-19

MORE AT TripAdvisor

During a two week stay locally we visited the Claycutters twice , once for Sunday lunch and then for an evening meal. On both occasions the food was excellent. What was most enjoyable though on our visits was the superb service by a team of...

site_logo

849lizc . 2023-07-12

MORE AT TripAdvisor

Met friends of 50 years there Great venue but the gentleman sat down next to us two very loud women and shrieking continues baby's Ruined our lunch. Surely with a quiet pub with common sense he should have sat them elsewhere The food was excellent...

site_logo

Excursion67416911382 . 2023-07-12

MORE AT TripAdvisor

Arrived and seated promptly, took our drink order very quickly but we waited 20mins and it still hadn't been brought to the table, we mentioned as the table next to us that came 10mins after had been served drinks. We were told their was a...

site_logo

Janet I . 2023-07-09

MORE AT TripAdvisor

We visited for a family meal (10 of us) while staying locally and generally enjoyed our meal. There was plenty of choice and although the service was a little slow, bearing in mind the number of us at what seemed to be a fairly busy...

site_logo

CharlieCB . 2023-07-08

MORE AT TripAdvisor

We decided to visit this pub to sit out in the garden on a nice sunny day. We hadn’t been to this pub for a while but when we got there we thought we had gone to Wetherspoons by mistake. If you sit outside you...

site_logo

bruce81Dawlish . 2023-07-02

MORE AT TripAdvisor

Waitress gave us wrong steaks despite us indicating the wifes was medium well, Walked off no cutlery, no advice on where to collect cutelry, sauces S&V napkins etc no conversation at all and blue cheese sauce naff worst I've had. Steaks were nice though.

site_logo

Bonniespa . 2023-07-02

MORE AT TripAdvisor

First visit for 4 years!! What a difference!! Brilliant food!Brilliant service!! No comparison to my previous visit when the landlord was a complete waste of space! I can highly recommend the Claycutters . We will be back

site_logo

752kevl . 2023-06-14

MORE AT TripAdvisor

Busy pub, looked good inside. We went to the bar and we were asked to go out side and sit at a table. We could order through the app, and if we had a problem there were lots of staff outside who could help. We...

site_logo

miketT2156FR . 2023-06-08

MORE AT TripAdvisor

This is our favourite location for a good, old-fashioned Sunday lunch. There is a good range of fine ales, wines and spirits to complement the generous portions of food that includes vegetarian options. A children's menu completes the line-up. During the remainder of the week...

site_logo

Peter W . 2023-06-06

MORE AT TripAdvisor

Poor Sunday lunch. Very small portions not value for money. Bad slow service. Meat tough.no crackling. Hard overcooked stuffing. Tiniest pig in blanket all fat. Non crispy roast potatoes. Thin flavourless gravy All in all overpriced and dreadful food. Slow customer service. Young chap didn't...

site_logo

Curiosity491050 . 2023-06-04

MORE AT TripAdvisor

Food was good and the staff were very friendly would recommend for sure. Decent menu. very hygienic. Overall very nice pub/restaurant

site_logo

Corey W . 2023-05-25

MORE AT TripAdvisor

Lovely country pub, lovely atmosphere, lovely staff, great selection of drinks and a fantastic menu to suit all; including children! We stayed for a week at the Finlake Resort and during that time we came to The Claycutters Arms twice for dinner as it was...

site_logo

amallaway92 . 2023-05-24

MORE AT TripAdvisor

Stopped in our motorhome overnight. Phoned ahead and had a lovely meal with an excellent house white. Friendly staff and a great manager who obviously has a good team around him. Beer garden with plenty of tables. Play area for children. A really good all...

site_logo

SMD1962 . 2023-05-18

MORE AT TripAdvisor

Went here for couples dining as it was a spot equidistant between us. Neither of us had visited before, but the website and sample menu looked good. The actual village and pub itself are really picturesque. The owners have clearly thought about layout, and it...

site_logo

michaeleV9545QC . 2023-05-12

MORE AT TripAdvisor

Dreadful food cold seasoning completely forgotten resembling dog meat. Drinks had linecleaner in complained as were told to leave

site_logo

Jon G . 2023-05-08

MORE AT TripAdvisor

We were a family of 3 adults and 3 children and had a lovely evening meal last week. We had been there several times whilst staying at Finlake and this was our best visit so far. We phoned and booked in advance, which was just...

site_logo

MolCheltenham . 2023-05-03

MORE AT TripAdvisor

Spent the night in our van last night. Great customer service and great food and drinks. The area was just what we needed for a great night sleep

site_logo

Rochelle P . 2023-04-25

MORE AT TripAdvisor

We have had a wonderful evening here, fab food and an excellent table service from Jasmin & Jake .You were both great and very attentive.thank you both so much and we look forward to seeing you all again soon .

site_logo

Dreamthisisthelife . 2023-04-22

MORE AT TripAdvisor

We booked the restaurant for a family get together for our daughters birthday . Ryan was extremely helpful and patient when I had to keep changing numbers , our family of 29 all enjoyed their visit to the Claycutters Arms and the friendly atmosphere ....

site_logo

Geraldine B . 2023-04-14

MORE AT TripAdvisor

We parked our motorhome here overnight in preparation for a Dartmoor walk, excellent menu, all of the staff were so friendly and helpful, food was amazing & service first class, Whitebait starter was the best ever, I even had dessert which is not the norm,...

site_logo

LinExmouth . 2023-04-09

MORE AT TripAdvisor

Lovely food and really attentive friendly staff. Food service was fast and the staff were knowledgeable and gave us advice on things to do and places to visit in the local area.

site_logo

Laura T . 2023-04-01

MORE AT TripAdvisor

So we have never been to the clay cutters before it was recommended to us by our friend. We had dinner on a Sunday evening ,we had the roast amazing. The two staff that looked after us were 💯 nothing was to much trouble. The...

site_logo

John W . 2023-03-29

MORE AT TripAdvisor

As usual the pub is great. Tha management have done wonders to this pub in the short time they have owned it . Although the stools have diassapeared from the bar this is completely understandable to make way for the much needed additional dining tables...

site_logo

JoshHyson . 2023-03-26

MORE AT TripAdvisor

It always makes me nervous to what's to come when waiting staff ask you if you'd like the bill after you finish your starters. This was the main reason for the 2* review, it was disorganized, badly managed and majority of the waiting staff looked...

site_logo

TheAdventureQueen . 2023-03-03

MORE AT TripAdvisor

Fantastic food and service. Love the fact it had a variety of non-alcoholic drinks - loving the Sheppys Cider. Wonderful suggestion by Devon Holidays Finlake.

site_logo

piklingj . 2023-02-21

MORE AT TripAdvisor

The whole place is really charming - and has a wonderful vibe, however so a local eatery, its very very expensive. The good cannot be faulted, and was cooked to perfection - however, like most fine dining - the portion sizes were small. The staff...

site_logo

clarkd152 . 2023-02-16

MORE AT TripAdvisor

Thank you Devon Holidays for recommending this place - we were here a few nights during our stay at Finlake. Great food, wonderful staff - it can't be beaten on price and quality. Thank you Claycutters and Devon Holidays. We will be back.

site_logo

michaeldO4327CW . 2023-01-24

MORE AT TripAdvisor

Such a friendly pub. Felt very welcomed. Food was delicious and good value. Lovely staff. Definitely will be going again

site_logo

janew903 . 2023-01-19

MORE AT TripAdvisor

Exceptional Sunday lunch - highly recommended. Booked in advance. Lovely atmosphere and warm friendly welcome. Service was excellent. Four roasts which were both plentiful and delicious. Nice touch having your own gravy boat. Staff were very attentive. Perfect for our weekend at Finlake. Was not...

site_logo

151martint . 2023-01-15

MORE AT TripAdvisor

Our walking group booked a lunch at the Claycutters on Friday. The booking was for 18 people and I was expecting to have to preorder our meals. I was assured the number was not a problem and so we confirmed the booking. The service at...

site_logo

299MikeW . 2023-01-13

MORE AT TripAdvisor

Had a lovely meal with friends, all food ordered was served hot and tasty, service was good with friendly welcoming staff would not hesitate to recommend.

site_logo

Angie444 . 2022-11-10

MORE AT TripAdvisor

Visited on a Tuesday lunchtime, surprised to find it nearly full. Considering it is quite out of the way, it is a credit to their reputation that it was so busy mid-week. The service was friendly but the food did take quite a while to...

site_logo

John G . 2022-10-18

MORE AT TripAdvisor

We popped in tonight after seeing it advertised at Finlake Holiday Park. What a lovely warm welcoming pub with lovely staff and great food. Can't complain about any of it! Plus we took the dog. Definitely worth a visit.

site_logo

annemariebU7508RN . 2022-10-12

MORE AT TripAdvisor

Wow! That pretty much sums up our visit to the Claycutters Arms this evening. From start to finish a completely fantastic experience. Welcomed and seated. All questions answered and catered for a child with severe allergies in the most accommodating and accepting and sensitive way....

site_logo

wkdh30 . 2022-10-11

MORE AT TripAdvisor

Called in for a pint yesterday, had live singers on, Booked a table for dinner. Although they where busy, staff where attentive, food was excellent, will definitely be going back before we go home.

site_logo

davecN7059HV . 2022-10-03

MORE AT TripAdvisor

We had a party of 8 for a evening meal. The pub is fairly large so there was plenty of space. The service was slow and it took about 10-15mins for someone to ask if we wanted drinks. The drinks arrived fairly promptly once the...

site_logo

Teen_Spirit_66 . 2022-09-23

MORE AT TripAdvisor

We ate at the Cridford as it was advertised within the holiday resort we stayed in. The food was lovely with a wonderful variety. We will defiantly be back when we return to Finlake

site_logo

OscarGriffith71 . 2022-09-14

MORE AT TripAdvisor

Stopped for lunch on journey to Cornwall. Lovely atmosphere in a busy pub. Prompt table service from taking the drink and food order to delivery. Two young people taking and delivering orders who cared about what they were doing. Kitchen was also efficient and two...

site_logo

Patrick S . 2022-09-09

MORE AT TripAdvisor

This is an awesome pub. You can even stay the night in a campervan if you only spend a tenner in pub. We went for Sunday roast and it was very prompt , served by very friendly staff and the food was absolutely first class,...

site_logo

David B . 2022-09-04

MORE AT TripAdvisor

Really enjoyed a meal at this place! The steak was cooked to perfection for my liking and probably the best one i've had out. When we arrived there was a lovely atmosphere of people enjoying themselves and was great live music playing and a garden/park...

site_logo

Marie1923456678910 . 2022-08-21

MORE AT TripAdvisor

I so wanted to write a bad review as I love the responses from Ivan b, public Relations Manager, but I can’t! We ate twice at The Claycutters and both times the food was lovely, staff helpful and we were very promptly served! However, one...

site_logo

Joanna F . 2022-08-15

MORE AT TripAdvisor

Our visit was for the Sunday lunch. To be sure of a table we booked in advance using the pub's user-friendly website. Prior to entering the pub it was great fun to view the nearby farm animals - free range chickens, goats (petable!) And rare...

site_logo

Peter W . 2022-08-15

MORE AT TripAdvisor

We saw the signs for the claycutters around in Finlake and thought we would give it a go. Having eaten at the resorts The Retreat restaurant, we hoped it would match this or be better. Unfortunately it wasnt. It took a long time for someone...

site_logo

Z305JJkirstenh . 2022-08-08

MORE AT TripAdvisor

Lovely thatched pub in village setting. Parking to rear. Welcoming staff and good food. Recommend the steak and burgers. Would return.

site_logo

Hols1281 . 2022-07-24

MORE AT TripAdvisor

This lovely bustling village pub has tasty affordable food. Plenty of areas to sit and nothing is too much bother. Great for families

site_logo

catherynw . 2022-07-22

MORE AT TripAdvisor

I should first of all say that we were greeted by a very friendly person who showed us to our table. The general atmosphere was good. Service was a little haphazard with at least 3 different people serving us, asking us if we'd like to...

site_logo

lauramD5914HV . 2022-07-19

MORE AT TripAdvisor

Great village pub, staff friendly, service good and above all food outstanding. Can highly recommend the clucking bull burger, the chilli mayonnaise sauce was excellent, will definitely visit again when on holiday again.

site_logo

375BillH . 2022-07-15

MORE AT TripAdvisor

Large outside space with plenty of tables. Professional staff - well trained. Family and dog friendly.

site_logo

suefM5375WK . 2022-06-30

MORE AT TripAdvisor

Always make a point to eat at the claycutters when visiting Finlake. Great food and atmosphere friendly and informative staff would recommend. Anthony Graham

site_logo

Cheftony53 . 2022-06-17

MORE AT TripAdvisor

Only sat in the busy garden and was very impressed with the young tech savvy staffs manners and service. The food (curry) was excellent value and of good quality.

site_logo

1stimpressioncounts . 2022-06-16

MORE AT TripAdvisor

Staying in the nearby holiday park, we visited for Sunday lunch. Despite warnings about staffing outside- we found the service to be excellent. Drinks were great, roasts were good quality and arrived quickly. Everyone had a nice time and we would return if we were...

site_logo

nevermissabeat . 2022-06-15

MORE AT TripAdvisor

A boring average lunch. I ordered jacket potato with prawns. Tiny little prawns, with a cheap tasting sauce. Potato was on the dry side. Some of it was hot, some of it was warm! When the waiter took the plates, I mentioned the temperature of...

site_logo

TWEEDY5 . 2022-06-07

MORE AT TripAdvisor

Late booking for party of 8. Very welcoming, fantastic service and great food. Park for the children was a bonus. We were visiting on holiday but would absolutely recommend and return.

site_logo

amybM6554AX . 2022-06-03

MORE AT TripAdvisor

Why we only ate lunch, not much to write home about. BLT extremely dry, no butter in the mass produced roll and mayo? Baked potato dry and clearly a catering jar of marie rose sauce. Beer though was very good. Bit average...not on our recommended...

site_logo

lowrider1962 . 2022-05-27

MORE AT TripAdvisor

Three of us stopped in for a weekday lunch and were lucky to get a table as the restaurant was very busy. Had the crab cakes which actual contained loads of crab and were filled with a lovely melted cheese too - unusual and very...

site_logo

A1Globetrotter . 2022-04-24

MORE AT TripAdvisor

Can highly recommend this place for a humble pub dinner. Goats and chickens are in a pen outside (which we loved!) and we walked in to live music performed by a wonderfully talented performer with a gorgeous voice and found ourselves singing along too! The...

site_logo

beccy-burgin . 2022-04-09

MORE AT TripAdvisor

Can highly recommend this place. The ribs were to die for. Food absolutely superb and great selection of ales too. Will we go Italy be back. Great service from the staff

site_logo

rwk2708 . 2022-03-22

MORE AT TripAdvisor

Similary restaurants in South West

restaurant_img
4.0

25 Opinions

location-icon1-3 Market Hall
Other cuisines
outdoor_seating_99824takeaway_99824delivery_99824

Pass by the chain coffee shops and pop in here. Based in the market. Serves great local coffee and all the cakes and lunches are homemade. Family run business. Great friendly staff.

restaurant_img
4.0

24 Opinions

location-iconMain St
Other cuisines
outdoor_seating_165946takeaway_165946delivery_165946

An absolute brilliant pub with a warm welcome to locals and visitors alike. An excellent range of drinks and a well kept cellar to boot. The food is nicely presented and perfectly cooked by well known Chef Jai. Well worth a visit.

restaurant_img
4.0

139 Opinions

location-icon5 East Street
Other cuisines
outdoor_seating_215948takeaway_215948delivery_215948

The place wasn’t as clean as one would hope to find it, and the food on both visits was utterly awful: tasteless, overpriced, very clearly microwaved, haphazard, thoughtless etc etc. A bacon bap or sausage roll from Spar is significantly more tasty, filling and worthwhile.

restaurant_img
4.0

908 Opinions

location-iconTotnes Road
Other cuisines
outdoor_seating_73731takeaway_73731delivery_73731

Stopped on route between appointments with husband Barry. Friendly and quick service. Delicious ciabattas. Will be back to try desserts.

restaurant_img
4.0

7 Opinions

location-iconSeaton House Main Rd
Other cuisines
outdoor_seating_216536takeaway_216536delivery_216536

Previously impressed with this take away & decided to return whilst in the area. Had sent them a message about opening hours and the food which was not responded to. We were disappointed by the homity pie which was tasteless & the Thai pie was ok. The star of the show was the steak and Stilton pie. So the morale of the story is some things are excellent others are mediocre.