GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.1

Based on 973 opinions finded in 2 websites

site_photo4

Nº 1826 in 4016 in Birmingham

Nº 120 of 282 British in Birmingham

CUSTOMERS TALK ABOUT DISHES WITH..cookedroaststeakbeautifulcoffeevegetablespizzamustpuddingricecheesefishpaychickenmeat

comment_iconOpinions

What a lovely little restaurant in a fantastic location. The Sunday lunch was one of the best I have had in a long time, we loved it. And the service was outstanding. I would definitely go back for more!

site_logo

Louise T . 2025-05-27

MORE AT TripAdvisor

Lovely setting and staff were very nice. However the menu was very limited and then a lot of items were unavailable. The steak was awful and chewy. The steak pie tasted as though it had cheap ground beef in. Very expensive for food that is awful, felt sorry for the waitress who was lovely and getting the grief for poor food. Overall a great location spoilt by rubbish over priced food. Won’t be returning which is a shame as the lake behind is beautiful.

site_logo

louise . 2025-05-25

MORE AT TripAdvisor

What an absolute find, this place is the real deal when it comes to a chilled atmosphere and great pizzas. We ordered the Margarita and Chicken Tikka to share which I can 1000% recommended.

site_logo

Phil Barrett . 2025-05-21

MORE AT Google

Such a lovely place. Setting is amazing with the beautiful view of the lake

site_logo

Karen Ladds . 2025-05-18

MORE AT Google

Cauliflower soup was quite salty but had ok flavour. Fish was fine, chips were undercooked and stodgy. Had some chips off of my friend and those were fine, however. Considering the slightly more premium price, definitely could have been better and more consistent.

site_logo

Oliver Barnett . 2025-05-17

MORE AT Google

We had an amazing meal! I am coeliac and the waiter was so brilliant- if he wasn’t sure about a query he willingly asked the kitchen, really put me at ease, and the food was so delicious! I would eat here again in a heartbeat, the beautiful surroundings were an added benefit!

site_logo

Jo J . 2025-05-16

MORE AT TripAdvisor

I really want to love The Bracebridge. I have been many times before and since it has become The Bracebridge. However, since it has reopened it's never as good as I hope. For example tonight, I turned up with my family to have dinner outside in the sun. The website said I couldn't reserve a table but when I turned up, many of the tables were reserved. We found one unreserved - so no harm done...but still. There are no menus. You have to scan a QR code. However, there is also no signal. I searched for wi-fi, I find the "Bracebridge Guest" wifi. Great! I is password protected and it doesn't say anywhere what the password is. Not great. There are NO STAFF to help. I eventually find one member of staff after searching the area who said that they know they are having issues with the internet and that I had to go to the booth to see the menu and order. I took a picture of the menu and went back to my family to order. I then had to go back to the kiosk to place my order and struggle back with 4 drinks in very cheap plastic cups. £80 to feed and water 2 adults and 2 kids some chicken seems steep. I sit back down and there is a band doing sound checks. The girl bursts into full blown song but stops halfway through. Still part of the sound check it seems. After ordering, I was given an alert device that goes off when the food is ready. No staff will bring your food. The buzzer goes off and off I head to the kiosk again. The man hands me the food in plastic baskets on plastic trays. I ask if there is some ketchup for the chips, but the man at the chicken kiosk says that I have to pay for ketchup at the other kiosk. I am shocked and say "you have to pay for ketchup??". This clearly wasn't the first time someone has been shocked at an £80 fried chicken meal needing to pay even more for ketchup and he holds his hands up and says "this is not our policy, you need to go to the other kiosk". I sit down with our meal. The girl belts out another half song and then leaves and goes back to the car park. The DJ then put a dance track on SOOOO loud that everyone in the area jumps. He doesn't turn the sound down. There are no staff to tell him to turn the sound down. He just blasts it out like we have bought tickets to sit on the main speaker at Glastonbury. On the plus side, the chicken was very nice. Like I say, I really want to love this place but they always seem to pull defeat from the jaws of victory. Please, please, please do better...emply some staff and don't charge for ketchup!

site_logo

. 2025-05-16

MORE AT TripAdvisor

Great setting, love the terrace area! Good food, friendly & accommodating staff. Have been many times & would definitely recommend!

site_logo

Ferri H . 2025-05-15

MORE AT TripAdvisor

A little disappointed with this. Food wasn't great and service a bit hit and miss for the price. The place is nice with great views over the water. There's sheltered outdoor seating and a pizza takeaway place. Close to some lovely walks around Sutton Park.

site_logo

Dominic ward . 2025-05-10

MORE AT Google

Delicious freshly cooked breakfast with delicious coffee & tea

site_logo

Clive Williams . 2025-05-04

MORE AT Google

Didn't find many good options on menu, we had table of 7 and four of of wanted steak which they sold out of and ended up having fish which tasted bland. One of friends ended up not eating anything at all.

site_logo

Lorna Vt . 2025-04-26

MORE AT Google

It’s a bit of an experience getting there avoiding pot holes and narrow lanes but once there it’s worthwhile The views are nice overlooking the lake. The interior is great and relaxing , as is the atmosphere. The staff are welcoming and polite. Decent food and drinks menu and the food itself is very tasty and well presented. You could say a little on the expensive side but overall it is worth it

site_logo

John Ward . 2025-04-25

MORE AT Google

Great location, staff, service and food

site_logo

Kelsey Quirke . 2025-04-21

MORE AT Google

We visited as a group of 12 and were all looking forward to a Sunday roast. While the food itself was excellent, everyone at the table thoroughly enjoyed their meal, the overall service left quite a bit to be desired. We waited over an hour and a half for food, and during the three hours we were there, we were only asked once if we’d like additional drinks. No condiments were offered with the meal, and two of the desserts we ordered were forgotten, with no one checking in to see if we had received them. At no point were we asked how the meal was, which was surprising for a large party. While they did cater well for a coeliac guest and ensured food was prepared separately, there was some confusion from staff around what was gluten-free. That said, they were happy to check with the kitchen when asked. Given the 12.5% service charge, we expected more attentive service. The food was great and I would still recommend it based on quality, but hope the service side improves to match the standard of the kitchen.

site_logo

Elliott C . 2025-04-20

MORE AT Google

Came here on the 5/4/25 for dinner. Really disappointed with the menu and lack of mains really. Basic 'pub style choices' . Starters were quite nice but disappointed with presentation and portions with both the starters and the mains. Was expecting more to be honest. Came in 2023 and was far better food. Service charge set at 12.5% which is more than most local restaurants. Don't think we will be returning sadly. Also I'd paid a deposit on a cancellation when I wasn't well in March which I had no problem paying but this wasn't taken off the bill initially. Surely there must be a system to record this on the next booking?

site_logo

Sarah Butler . 2025-04-13

MORE AT Google

We found it a little difficult to park as it was a sunny day & very busy however from the moment we arrived at the restaurant the staff were wonderful. The restaurant is really lovely & we looked out onto the water. The food was absolutely delicious & beautifully presented. We particularly enjoyed the Sunday roast the portion size & accompanying vegetables were excellent … thank you

site_logo

Sylvia Richardson . 2025-04-07

MORE AT Google

We have wanted to visit here for years but knew it was pricey. We decided to book the afternoon tea on Saturday for a special late Mother’s Day celebration. The restaurant itself has lovely decor and views of the lake. However upon entering we were immediately hit with how noisy it was in there. There appeared to be a big party of women (possibly hen do) who drowned the place out talking over each other. We just wanted a nice afternoon tea with our mom but almost had to shout to hear each other. We had to get the waitress (who also acknowledged it was noisy) to repeat herself as we just couldn’t hear what she was explaining about the tea. The food towers were disappointing considering the £40 per head price, also what was ridiculous was having a pot of tea each where each pot had about 2cm of water in them, meaning you got barely one cup of tea each. We joked with the table next to us about the lack of tea and they agreed to just ask for a top up. When we asked for more we were told we would be charged for it (another £12) I can’t fault the waitresses working there they were all lovely and polite and working very hard. There are better and cheaper afternoon teas available around Sutton Coldfield however

site_logo

Claire Rainbow . 2025-04-07

MORE AT Google

Food was outstanding and so was the service, very efficient. Timing was perfect Seems to run like a well oiled machine. Looking forward to returning

site_logo

Robert Brown . 2025-04-06

MORE AT Google

This was the first time that we have visited the Bracebridge. The staff were wonderful and attentive. The food was skillfully made and tasty. It is lovely to be able to see across the pool. It was far too noisy in the restaurant, however. We had afternoon tea and there wasn’t enough tea to last the duration of the meal so we had to pay for another round. It was that or pay an extra £10 each for a glass of sparkling wine. There wasn’t enough cream and jam for the scones. We also didn’t expect to have to pay a large service charge so that was a sting at the end of the meal.

site_logo

Louise Rainbow . 2025-04-06

MORE AT Google

We had a short walk through the park and, by chance, discovered this little gem. The pizza was delicious—thin, stone-baked, and full of flavor. The iced cappuccinos were refreshing and just what we needed. The atmosphere, surrounded by nature, along with the friendly and smiling staff, definitely made us want to come back. We'll gladly recommend this place to our friends!

site_logo

Cristina Toma . 2025-04-06

MORE AT Google

Style Over Substance — Repeatedly Disappointing I’ve now visited The Bracebridge twice, and both times have been marked by poor service, disorganisation, and a clear lack of care for the customer experience. The location is undeniably attractive, but that’s where the positives end. Both visits involved issues with bookings — one cancelled without proper notice, and the other poorly handled on arrival. The food was inconsistent and underwhelming, but what really sealed the experience was the attitude from management. While the floor staff did their best and were generally pleasant, the manager was condescending, dismissive, and seemed more interested in defending mistakes than resolving them. The final insult came when we were told a particular dish wasn’t available due to “chef’s prep time,” only to see it served to another table 30 minutes later. If you’re going to lie, at least make it convincing. The Bracebridge trades on its setting and appearance, but it lacks the basics of hospitality: honesty, consistency, and respect for its guests. I won’t be returning — and I’d advise others to think twice.

site_logo

Benjamin Godwin . 2025-04-04

MORE AT Google

The afternoon tea was lovely and service good but the restaurant itself was abit disappointing. Didn’t really have the ambience I expected & we were on a tiny table by the bar that meant there were people standing there quite close to our table some of the time making it feel crowded. It was also quite casual dress which I didn’t know would be the case so my mom & myself felt abit overdressed compared to other guests as again I assumed the restaurant would be abit more formal compared to the outside areas. So due to this not as good as other afternoon tea experiences that I’ve had, which was a shame as the food & service was good. So will know for future it is more for after a walk in the park as opposed to a special occasion.

site_logo

Michelle Jones . 2025-03-31

MORE AT Google

We went for Brunch with friends and it was a great experience from the start. Lovely and tasty food served by friendly and attentive staff in a beautiful location.

site_logo

Sally P . 2025-03-30

MORE AT TripAdvisor

Very disappointing brunch. The ‘big’ breakfast was less than a ‘normal’ portion with only 1 item of everything listed on the description. The bacon rasher was overcooked (burnt on the edges and very dry). There was almost 2 tablespoons of beans. Very over priced for what it was. The location is lovely and service was okay but the food was completely a let down. Was not impressed by the non optional 12.5% service charge. Won’t be returning and would not recommend. This place could be so much better.

site_logo

Kate P . 2025-03-30

MORE AT Google

I have never been here before - and I brought my friend for a birthday brunch 26/3/25 and it was honestly beautiful. The full English was super tasty, the staff were so friendly and genuinely happy and the view was beautiful! Once we'd eaten our breakfast we sat outside and were greeted by Robins! It was just overall a lovely experience & will definitely be coming back!

site_logo

Beth T . 2025-03-27

MORE AT TripAdvisor

I have never been here before - and I brought my friend for a birthday brunch 26/3/25 and it was honestly beautiful. The full English was super tasty, the staff were so friendly and genuinely happy and the view was beautiful! Once we'd eaten our breakfast we sat outside and were greeted by Robins! It was just overall a lovely experience & will definitely be coming back!

site_logo

Beth Thompson . 2025-03-27

MORE AT Google

Beautiful venue, staff couldn’t do more - they were attentive - outstanding customer service. The food was delicious. Planning our next trip !

site_logo

Di C . 2025-03-16

MORE AT TripAdvisor

First visit to the restaurant for dinner. Great location in very quiet / peaceful surroundings. Nice view of the lake (will be better in the summer when light in the evenings) The food was excellent / high quality combined with attentive service staff.

site_logo

Compass53369524228 . 2025-03-15

MORE AT TripAdvisor

First visit to the restaurant for dinner. Great location in very quiet / peaceful surroundings. Nice view of the lake (will be better in the summer when light in the evenings) The food was excellent / high quality combined with attentive service staff.

site_logo

MS 63 . 2025-03-15

MORE AT Google

I visited this establishment for a Sunday lunch with my family (4 off us) the restaurant is beautiful, lovely ambience and setting, food was amazing and the staff were very friendly, would I return definitely

site_logo

Harj A . 2025-03-10

MORE AT TripAdvisor

I went to the Bracebridge this morning for the very first time for breakfast. The food was amazing, the service was exceptional (I believe the waitress was called Abbey), the location is so serene! Wonderful place and will be certainly going back soon!

site_logo

Jatinder Athwal . 2025-03-06

MORE AT Google

Best breakfast and an amazing overall experience! The staff were so kind and helpful - definitely the best service I’ve had in a long time. We tried the full English, pancakes, and breakfast muffin, and all were a solid 10/10. Plus the location speaks for itself. Gorgeous. Will be back soon!

site_logo

Georgia . 2025-03-01

MORE AT Google

We had an amazing time. Staff were polite and friendly and welcoming. Our waitress was so lovely to talk to. They took our coats, pulled out my chair, asked regularly but not overboard if there was anything else we needed. We had an amazing view the food was absolutely delicious. The room itself was slightly chilly but not cold by any means. We will definitely be returning, money well spent.

site_logo

Natalie Barker . 2025-02-18

MORE AT Google

Sunday family style roast of the menu what a rip off!!! £28 for a dry piece of chicken breast half a carrot, 2pieces of skinny dry broccoli stem , 2/3 pieces of potato, tiny portion of cauliflower cheese and a massive Yorkshire pudding , some runny leek bacon gloop and gravy ! Shocking! Especially after asking the waitress how big the portion was I was told comes with half a chicken!! You are paying for the location! Nothing else My friends lunch was mushroom gnocchi which was also a rip off for £28 !!! Fish and chips probably the best value abd portion size for £22 This was their new menu Try again guys!! Oh yes the dessert was lush chocolate mouse !

site_logo

Rekha1 . 2025-02-12

MORE AT Google

Best hidden gem for food, atmosphere and a lovely day out. Staff are always friendly and accommodating.

site_logo

Devi Kaur . 2025-02-12

MORE AT Google

Lovely food, great service and reasonably priced too 🙂

site_logo

Gary Jessop . 2025-02-10

MORE AT Google

Food and service is exceptional if a little expensive

site_logo

Rob Webb . 2025-02-09

MORE AT Google

Food was nice. However they forgot one of the drinks ordered. Polite and apologised for the error. Ordered a muffin there was no cheese and they forgot the hash brown and relish. They then bought the hash brown without the relish. Would have thought for the service errors they wouldn't have hmcharged for the missed drink. The food was nice but wouldn't go back considering the errors /service when considering the price of food

site_logo

Nick Stokes . 2025-02-06

MORE AT Google

Went last night for meal, only people in there, very cold inside, waitress wearing her coat. Starters nice, main meals poor and lacklustre. We had 3 of our 5 courses but still had to pay for our coffees. £18 for glass of wine!! Very expensive for what it was, certainly not worth over £250 for 2!! Disappointing as a Christmas voucher from our son. Won’t be recommending or going back. Also very difficult to find in the dark as two entrances and one was locked and the other has no sign. Lovely decor, but hate being cold!!

site_logo

Andrew Joannides . 2025-01-31

MORE AT Google

A truly lovely dining experience yesterday evening - traffic in the city centre risked us missing our 7pm table but the staff were very accommodating. As may be expected for a midweek at the end of January, the restaurant was very quiet but at no point did we feel rushed to complete our meal. Food was delightful, with particular praise going to the beef shortrib, which was deliciously tender. Despite the excellent food, though, our most memorable experience of the night was the top tier service offered by our server, Abbie, who brought copious charm and humour alongside the usual attentiveness. All in all, a delight!

site_logo

Nathan Redland . 2025-01-30

MORE AT Google

Beautiful location, exquisite food and professional, friendly staff.

site_logo

Em Whitney . 2025-01-27

MORE AT Google

Although we were the only guests in the restaurant on this cold, dark, end of January Wednesday night, we had a lovely evening. The restaurant is beautifully decorated and you can tell that the small details have been carefully curated. Each dish is presented with flair and the tableware is eclectic and stylish to delight the senses. The food was outstanding and delivered unexpected yet comforting tastes. Nice wine list and cool playlist (Love The O’Jays). Thanks for a memorable experience. We enjoyed the adventure of walking back to our cars through the trees in the pitch black under a starlit sky with our phone torches, but others may not!

site_logo

Helen S . 2025-01-23

MORE AT TripAdvisor

Although we were the only guests in the restaurant on this cold, dark, end of January Wednesday, we had a lovely evening. The restaurant is beautifully decorated and you can tell that the small details have been carefully curated. Each dish is presented with flair and the tableware is eclectic and stylish to delight the senses. The food was outstanding and delivered unexpected yet comforting tastes. Nice wine list and cool playlist (Love The O’Jays). Thanks for a memorable experience. We enjoyed the adventure of walking back to our cars through the trees in the pitch black under a starlit sky with our phone torches, but others may not!

site_logo

Helen Saa . 2025-01-23

MORE AT Google

On arriving we were welcomed into the restaurant and taken to our table immediately. Service was quick and we were asked what drinks we wanted and everything was good. The atmosphere in the restaurant was perfect not too quiet and not too loud. We ordered the meals which were of good standard although a bit expensive, but I don't mind paying if the service and food are OK. I had one small issue which was not worth knocking a star off but for feedback only, was my wife did not want the sprouts and asked for the hispi ceaser instead. At first the waitress said no problem but then returned saying they could not do this and we could only have the ceaser as a side order. I understood there would be a price difference, however my expectation would have been that yes we could swap this but you would have to pay a small increase to substitute, not that it was "not possible". These small things can make a huge difference to enable returning customers. This was only a small issue and I really like the fact that this restaurant is so close in such a beautiful surrounding and I hope it can grow and become a regular for us going forward, but please please keep pushing the customer service with a tiny bit of flexibility and people will always want to return.

site_logo

Stuart B . 2025-01-22

MORE AT TripAdvisor

Great service from staff on site but manager on the phone was so rude which is very surprising given how quiet the restaurant is and seemingly struggling for customers. Very cold....had to eat meal with coat on. Such a shame that booking system, use of vouchers not straight forward and that the manager has zero customer service but the food was tasty. However certainly would not go back and wouldn't recommend to others. So many nice places not too far away with better atmosphere, warm environment and means not giving our money to a terrible manager

site_logo

Kate F . 2025-01-19

MORE AT TripAdvisor

Be aware Vouchers must be presented at the time of booking the table. We were unaware (mentions it at the very bottom of the booking confirmation email) and young waiter had to call a manager (who wasn't onsite) who very rudely and abruptly told us. Due to the delays in speaking with the manager we then missed our taxi. Food was good, service from young staff was excellent however it was so so quiet. Only 3-5 other couples.

site_logo

James F . 2025-01-19

MORE AT TripAdvisor

Restaurant was lovely food was amazing and great service from Mark and Abby Would highly recommend ! Will be back in the summer and daylight to see the terrace view Had a great evening Mark and Abby was super friendly and helpful

site_logo

K S . 2025-01-17

MORE AT Google

Booked on Friday evening to go for Sunday lunch got to the point of leaving card details and page crashed and had to start again the booking, on second attempt of booking I forgot to change the Saturday to the Sunday for lunch at 2.30 which was a simple human error due to site crashing. After booking I immediately realised this so I tried to call them direct minutes after making the booking which I couldn’t get anyone to answer phone, after trying several times I left voice message for them to get back to me explaining situation. The day after I still had no one return my calls so I then left yet another voice note and proceeded to contact them via a what’s app message through the number they left on their voicemail. I got an automated response saying they aim to get to you in 2 hours. Hours passed and again no contact from my voicemails or what’s app so again I tried to call and nothing then the evening comes and they took £80 off my card for a no show on the Saturday which I had tried to explain the situation but was completely impossible to get hold of anyone. Sunday comes I turn up for the slot I originally wanted and thought I will explain to someone and they will correct the situation explaining I’ve tried several attempts to contact them through phone calls and what’s app in which the manager responded that he needed to call someone to see what could be done. He then came back to us and said great news will take the £80 off the bill he had taken my details to show I had contacted them over and over. I was happy with this for then him to come back and say actually you can’t have the £80 can have £40 off now going back on what was originally said and said you can have £40 back now so I’m Still at a loss of £40 I said this is bad customer service I was unable to get hold of anyone for days they took £80 off my account you fixed situation now going back on word and I’m now still out of pocket. The place was almost empty at peak time on a Sunday and I’m really not surprised with how they treat people and how you can’t even get a response from them or any communication. It was horrendous experience, extremely poor customer service and I will never go there again. Such a shame as great location and view with a lot of potential but they don’t care about customer service at all.

site_logo

Holly M . 2025-01-12

MORE AT TripAdvisor

Food was really good but sadly let down by service. For one, we needed to change the time of our booking but for the week leading up to it, we couldn’t get through via phone, email, or WhatsApp. My husband had to physically drive to the restaurant on the morning of my birthday to speak to a member of the team to sort the booking. Despite central correspondence suggesting the team are available from 10am, they weren’t, so he had to wait outside until 11 to speak to someone. This obviously delayed all of our plans for the day. When we did arrive, the restaurant was quiet, yet the service was diabolically slow. They were friendly, well give them that, just very slow! We mentioned a few times that we needed to leave quite promptly, but it took ages for them to sort finishing up our table with the birthday cake and bill. The toilets were also unclean, and clearly hadn’t been checked. Really disappointing visit, sadly.

site_logo

Letitia Young . 2025-01-11

MORE AT Google

The whole thing was lovely! Very good service! All of the team were excellent and the food was perfectly portioned, beautifully presented and served with a smile! Thanks to the team!

site_logo

Jake B . 2025-01-11

MORE AT Google

Dined in the outdoor terrace area, great food, atmosphere and views

site_logo

Pav Sidhu . 2025-01-07

MORE AT Google

Me and my husband went here last night to find out we 2 of the 4 covers they had that evening. Service was good and food was nice (supposedly), although some options weren’t available on the menu, however after leaving the restaurant and returning home after half hour I had sicked all the food out. This is making me think how fresh the food is and how long something has been sitting in their fridge for. Most certainly won’t be returning.

site_logo

Rina Parmar . 2025-01-04

MORE AT Google

Went yesterday for dinner with my girlfriend had 3 courses all lovely. The beef rib was particularly great 100% going back again amazing views too and cool wild ponies wandering around

site_logo

John King . 2025-01-04

MORE AT Google

New Years Eve meal plus after party and all I can say is that it has been absolutely amazing and if you haven’t been yet you need to

site_logo

Deborah Rimmer . 2024-12-31

MORE AT Google

We booked the terrace for food and it wasn't the best experience. The staff didn't give us menus and there was limited food available, so I had to order something as there wasn't many options. The terrace was so cold even though they advised it was a heated terrace, there were only around 5 heaters along 5 tables and then there wasn't much else. I didn't realise it wasn't table service and would have to go order and then collect so I think this should be shared more. I think this could be a nice place to go in the summer for a coffee.

site_logo

Fiona N . 2024-12-28

MORE AT Google

Waited for 20 minutes and then had to ditch our coffee as there was no chance of service. What business in its right mind has only one person serving on a busy Sunday? Crazy.

site_logo

Tony Tomkins . 2024-12-22

MORE AT Google

Fantastic meal using the first table offer. Service from mark the new manager was great and food was outstanding. Will most definitely return. Would definitely recommend the prawn starter and the beef rib

site_logo

Joanne Adams . 2024-12-16

MORE AT Google

The food was delicious - I had the beef ribs, they were cooked perfectly and the portion was huge. Lovely ambiance for a nice meal. Thank you, will visit again!

site_logo

radiachoudhury95 . 2024-12-14

MORE AT Google

I think the booking system needs changing its wrong to take money when no meal people's circumstances can change. Food wasn't great compared to 3 years ago portions small & came with nothing unless you added side dishes & very expensive for what little you get especially the drinks But service was good but sadly would use there again & I've eaten in many places.

site_logo

Kevin Cheetham . 2024-12-11

MORE AT Google

Very nice. The food is very tasty

site_logo

Catherine Lacroix . 2024-12-09

MORE AT Google

Went for a late lunch on the recommendation of bababouttown on insta. What a find!! It is a great restaurant, stylish, but cosy. The team are warm, friendly and knowledgeable. The views across the water are peaceful and beautiful. But it’s the food you go for, a menu of simple dishes done really really well. We had the fish and chips with gorgeous light batter; ham duck egg and chips and chocolate mousse and rice pudding. Both had nuts and berries and honeycomb and cream and we could have ate them over and over. It is our new favourite place and we are making it a regular. Do yourself a favour and book a table quick

site_logo

Carla Pawsey . 2024-11-27

MORE AT Google

Wow. What a beautiful place. Must visit for all!💯

site_logo

Ronnies Pizza . 2024-11-26

MORE AT Google

A very honest but disappointing review. My partner and I came for a meal here today as it was my mother in laws birthday, we thought it was a great idea as we always come for a coffee and a walk however have never ate here before. On arrival we were seated promptly and the waitress was friendly and took our drink order and food orders. My partner and I had the chicken Sunday dinner and my mother in law had fish and chips. The starter came and that was lovely, it looked the part and tasted even better! Then the mains came out, again appearance of the food looked lovely we were really looking forward to it only to find the chicken was very undercooked in fact it was raw! It was freezing, slimy, an odd looking colour and running with blood. As I didn’t want to make a scene I called the lady who may have been the manager I’m not sure only for her to tell me it was not raw this was repeated 4 times and she was very stand-offish, in the end she said we could have a new plate of food however we where very put off! We had to wait another 15 minutes which meant my mother in law having to eat her food on her own, this was never acknowledged! Once all was finished we was given the bill by a different waitress to see they had still added a 12.5% service charge! My partner kindly asked for this to be taken off again not wanting to make a scene. The bill was over £140.00. I understand cooking may not always go to plan however we are utterly gob smacked and this should be a trading standards matter! People could become majorly poorly, this needs to be sorted asap. We won’t be returning.

site_logo

Danielle Foster . 2024-11-24

MORE AT Google

Dear Owner/Manager, We visited the restaurant on 24th November 2024, a birthday meal for my mother. We have always wanted to come here and views and settings look amazing. We were seated and make our orders which all went well, starters were lovely then our mains come and the chicken was raw and undercooked I didn’t want to make a big issues so I addressed it quietly to the manager I believe as everyone else was quiet young. First thing she said was that’s not raw or undercooked and she didn’t even look at it, I asked her to feel it and try it and tell me if that’s not raw. I cook chicken everyday and I knew from when it was served. She said she will cook it more but As it’s chicken it was under Veg and Yorkshire puddings so cross contamination so could get very ill it’s not likes steak where you can do that. It put us off our meal and made us change from chicken to beef which was our preferred option so didn’t enjoy it and leaving my mother having her meal on her self as we had to wait 15-20 mins for the food to come out. I understand these issues happen as a business owner but the customer service wasn’t great. No refund or amount taken out - they actually adding 12.5% service charge and she got another waiter to give me the bill and she knew it’s not on! Once it was paid she come over and asked if we are ok - it was already paid for and I wanted to go home plus their was large booking so I don’t want to set a bad tone or vibe for new customers so I left it. But just disappointed as we don’t go out often and it could have easily been sorted by good customer or complete change of food choice or maybe a free drink while we are waiting I mean personally I think that meal should be free! It’s a great setting and vibe but Sunday roast wasn’t good her mood wasn’t right either. I would like to come back again and give it second chance but how it was handled with at a place like that I won’t be back unless I get a refund. Just to add I understand it’s not the manager fault of the cooking of meat but she made it her fault how she dealt with the matter. Warm regards

site_logo

sam . 2024-11-24

MORE AT Google

The aesthetic externally and internally are both beautiful! Unfortunately, the drive to The Bracebridge marred the experience. Not only are there extremely narrow roads to get to the venue, in addition to limited parking but the potholes are terrible! The individual who served our table tried his very best - thank you! However, unfortunately the tone had already been set with the confusion and handling of our deposit prior to our arrival, due to it being a group booking. The Sunday "roast" was also unfortunately the worst myself and those who I had dined with have ever experienced. Something traditional and simple, had been attempted to be re-created and it simply did and does not work unfortunately. To add insult to injury the food was cold, making it difficult to consume. When asked if this could be rectified, we were advised that they COULD have been put under some "lamps". However, due to the size of our group it would not be possible on this occasion. Whilst we were offered free hot drinks for the inconvenience and poor experience, it wasn't enough unfortunately. Though, the efforts were appreciated.

site_logo

Camishh BF . 2024-11-05

MORE AT Google

Our group ordered the Sunday roast beef which turned out to be shredded beef that was reconstituted into a cylinder but,resembled dog food when you cut into it. It's the kind of thing they do to chicken nuggets or kebabs so you certainly wouldn't expect it here and certainly not for a Sunday roast. The overall food service was poor with inexperienced waitresses initially setting the wrong plates which had to be hastily changed for dinner plates. Then everything served on an array of boards, at the one side of the table, making the table crowded and a lot of work to get the food across to the other guests. The food was just about warm and you only got 1 half of a sliced carrott with the other vegetables. All of this was after we had rescheduled the booking because there was inclement weather conditions that would have made it difficult to drive through the woods on the pot-holed road to the restaurant. They had demanded that we pay an additional deposit to reschedule and agreed in writing that both deposits for each diner would be deducted from the bill but they just refunded the deposit to the original paymeny method instead, causing further guest inconvenience. Our main waiter was pleasant and apologised for the cold food and offered us complimentary hot drinks. I would not dine here again. The approach is rather poncey and, with new restaurants opening all the time including Brown's in another part of Sutton Park, you would think the general managers would focus on getting the basics of service and the food right.

site_logo

Michelle Randall . 2024-10-28

MORE AT Google

In spite of the difficulties our group had suffered trying to transfer funds from a previous booking that was rescheduled due to the weather last month and resulted in a second deposit being taken, that was resolved by a refund yesterday #gofigure, our server tried as much as he could to assist in the issue and provided a palatable service for us throughout our stay. However, the food was disgusting as it was served in a country-style manner where we had to request utensils for serving ourselves the vegetables and other accompaniments. It was suppose to be roast beef but was basically, reconstituted pulled beef, rolled and portion, which lacked any layered flavouring - served cool not even warm.. Very salty, dry and with reminiscence of expensive cat food...all of us left at least 50% of the protein portion 'beef' on the plate (after we were provided with the correct dining plates rather than side plates). Salty creamy leek, questionable cauliflower cheese and very crunchy Yorkshire puddings. We were offered hot drinks for this travesty of a Sunday Roast in a picturesque setting. I am sure Browns will do a better job when they open their doors. Before the manager of this establishment implies that this was a review for a freebie, a gaslighting tool et al.. only poorly executed food service and bad customer management blames the customers.

site_logo

Jasmin Shepherd . 2024-10-28

MORE AT Google

Food very nice although a bit over-priced. Service good. Environment and atmosphere very relaxing.

site_logo

Dirk62 . 2024-10-21

MORE AT Google

Lovely cosy place with great deserts

site_logo

gil Kanengisser . 2024-10-18

MORE AT Google

Picturesque, sited right next to the pool. Lots of birdlife to watch and wild ponies occasionally

site_logo

simmoavfc . 2024-10-17

MORE AT Google

Visited the Bracebridge yesterday with high hopes and really looking forward to a quality meal. We booked for 4pm and service immediately took a drinks order which was good. We were advised there are only 3 beef dinners left and one lamb so to order quickly. For a party of 6 this wasn't ideal. My 10year old agreed to find something on the children's menu, to then be advised what he wanted isn't available off both the starter option and main. No vegetarian option for a Sunday lunch however I was advised they could do celeriac as a replacement. When this arrived it looked interested but I soon discovered it was entirely undercooked, very little flavour/seasoning and just felt like a low effort way of feeding a vegetarian. The beef dinners arrived and it was more of a chunk of beef that transpired to be pulled beef that seemed to have been set. Beyond dry and looked like it was pre prepared as soon as service opened. I commented on how awful mine was and it was taken off the bill. The rest of the table didn't want to make a fuss. Furious we still even paid to be honest. Won't return or recommend. Pity as the environment is absolutely gorgeous and outside looked beautiful lit up. Perhaps if they do a bar menu I would rather sit outside and try that

site_logo

Sarah Cronin . 2024-10-14

MORE AT Google

Desperately disappointing Went there on a First table offer to assess it for a future family gathering Good job we did Restaurant was really cold 13degrees Celsius inside. Inordinately long wait for food Monfish tail and Duck as mains below average and barely warm Monkfish had a strange taste that I did not recognise but was told afterwards was Sriracha butter. Duck was rubbery Waited in the cold again for desserts. Tiramisu was passable Blackberry frangipane was essentially a burnt pastry case filled with blackberries and Al sorbet quinnell on top. Service was ok Rez did his best to make excuses for the poor food and didn’t really know his menu. Poor show altogether Will not be returning Will be advising friends not to go Would not recommend

site_logo

IJ . 2024-10-10

MORE AT Google

Excellent meal in beautiful surroundings. The staff were friendly and helpful. The restaurant has been beautifully designed and the beef was absolutely superb. Can’t wait to visit again.

site_logo

Helen Coughlin . 2024-10-08

MORE AT Google

Upon arrival wasn’t greeted had to seat ourselves. Customer service was appalling on this visit had to ask for plates and cutlery when food eventually arrived. The new menu wasn’t impressed with the options changed a lot of the best sellers also wasn’t told some of the items were sold out on the menu until we were placing our order. WiFi not existent, really hard to use your phone on the terrance. It wasn’t very busy so I don’t understand why customer service was lacking on this visit. Sadly I wouldn’t return or recommend.

site_logo

Jodi Brown . 2024-10-05

MORE AT Google

went for lunch menu had changed without us being informed the new menu i was told was a share menu but when we ordered 2 x mains to share there was not enough for one let alone share. we got the bill and was astonished no wonder there is no prices on the menu. £28 for a single kabab, £18 for a baked potato, outrageous we rebooked after a family issue some 2 months before and they would not refund the £40 deposit

site_logo

Ron Carter . 2024-10-02

MORE AT Google

The place itself is really nice, love the seating by the water however the food is basic. Needs a better menu definitely

site_logo

Shana N . 2024-10-01

MORE AT Google

Think trading standards need to look here. £28 for a lamb kebab. I stick with perhaps 8 pieces of meat (nothing else unless you paid extra). 1 medium baked potato with cheese sauce and salad on top £16. Service charge stated 10% on the Internet. Had gone up to 12% when we got there.

site_logo

Jacquie Leach . 2024-10-01

MORE AT Google

After a lovely stroll in the park on Saturday afternoon we met some friends for a drink at the Bracebridge, the staff were lovely one particular young lady by the name Emily was absolutely fantastic and a credit to the team her understanding and knowledge of the wine I wanted was amazing she knew exactly what I wanted and let me try a couple of different wines to make sure I was 100% happy. Thank you Emily.

site_logo

Angela Preece . 2024-09-29

MORE AT Google

Wonderful view of the Lake and friendly waiter. It was a lovely lunch thank you, amazing food. Nice décor inside. Hope to return.

site_logo

Rosie E . 2024-09-27

MORE AT TripAdvisor

Had a fabulous meal at the Bracebridge Restaurant , Service was excellent and it’s a beautiful spot in Sutton Park. It was our first visit under New ownership. Would we go back sadly no, nothing to do with the Restaurant Food, Service or ambiance. But the road through to Sutton Park and the Venue is absolutely disgusting!! Huge Pot Holes every few feet, it was like taking part in the Dakar Rally !! And trying to leave late at night with no lights is not an easy task. This business won’t survive if the council don’t sort out the disgraceful road. Which would be a real shame . David Hadley-Smith visited on 2024-09-14

site_logo

David H . 2024-09-25

MORE AT TripAdvisor

Upon arriving we were asked if we wanted drinks or food, with this being a little low key celebration for our engagement we just wanted a couple of drinks with some friends. It was cold outside, 12 degrees at max, understandably we wanted to sit inside. However, The Bracebridge had other ideas. We were told inside is only for food and outside is for drinks. Confused, I said, can’t we just sit indoors? There wasn’t anyone inside, it was so quiet, totally dead on a Tuesday night, but no… at The Bracebridge you are forced to sit outside in the cold if you are just having drinks!! This is really poor behaviour for customers, especially on a night where it’s this dead. We were one of very few people there, with us… about 10 total. So, we sit outside, with the heatlamp on full blast, burning one side of your face, glaring at you like you’re some sort of reptile. Talking of animals, there are rats running around outside, we spotted at least two! Then there’s the bugs, we all had been bitten and had to deal with batting off the moths!! It’s fine… it’s outside, we’re in the elements after all. Then, there’s how the drinks are managed. Could we just start a tab and then order? Nope, every drinks order was instant payment at the table. I just know, if we sat inside, this wouldn’t be the case. Dear The Bracebridge team: How on earth are you expecting customers to come back if you shove them outside in the cold when you’re restaurant has no one in it. It’s absolutely ridiculous that you’d do this. Also, the manager was quite rude and just had a the bluntest look on his face the entire time. I’m unsure of your model here… when it’s -3 outside are you going to still ask people to sit outside for just drinks? What’s the plan here? Only food in winter? Perhaps you should put this on your website to warn people… “you’ll have to wear a coat if you just want drinks, oh and bring sun cream for one side of your face.” I won’t be coming back, and I’ll be sharing this experience with others. Finally, fix the road, it’s like a 4x4 off road experience day getting to the pub.

site_logo

James C . 2024-09-25

MORE AT Google

Fantastic food, exceptional service... this was the first time at the Bracebridge, and I have a high standard being a foodie, and the Bracebridge delivered on all five courses. Set in a beautiful location with stunning scenes AND a great covered external outdoor seating overlooking the lake! Also, the food outside is more traditional pub food with a different menu, they even have an outdoor clay oven pizza for amazing-looking pizzas. I will go back to try everything on the menu, and Bracebridge have a customer for life as long as they maintain this standard of food! Revisit20%

site_logo

Ranj . 2024-09-23

MORE AT TripAdvisor

Fantastic food, exceptional service... this was the first time at the Bracebridge, and I have a high standard being a foodie, and the Bracebridge delivered on all five courses. Set in a beautiful location with stunning scenes AND a great covered external outdoor seating overlooking the lake! Also, the food outside is more traditional pub food with a different menu, they even have an outdoor clay oven pizza for amazing-looking pizzas. I will go back to try everything on the menu, and Bracebridge have a customer for life as long as they maintain this standard of food! Revisit20%

site_logo

Ranjit Panesar . 2024-09-23

MORE AT Google

Had an amazing night. The spot is beautiful, right on the water which made it much better. Food was great and the service was on point. Will be back again!

site_logo

Rasheed P . 2024-09-21

MORE AT TripAdvisor

Thank you for an excellent and very enjoyable evening for my husbands 69th Birthday. The food and service was of the highest quality, and we have recommended The Bracebridge to our family and friends. Look forward to returning in the near future. Best regards Millicent & Paul Miller.

site_logo

PaulandMillie . 2024-09-21

MORE AT TripAdvisor

Has recently had new owners, so we decided to go for dinner. Food was superb, Service excellent and lovely atmosphere. Gorgeous views of the lake through the windows. It is not cheap but you get what you pay for !! Would we go back, sadly No nothing to do with the restaurant, but to reach it you have to drive through Sutton Park, and the potholes to the venue are an absolute disgrace!! It was like being on the Dakar Rally . And leaving late at night in the dark was an even worse experience, if the council don’t sort this out I can’t see that Venue surviving. Which would be a real shame. 14/Sept/2024

site_logo

David Hadley-Smith . 2024-09-16

MORE AT Google

Ate there today. Absolutely fantastic food. Cannot recommend highly enough. We will return.

site_logo

Matthew . 2024-09-13

MORE AT Google

Beautiful aesthetic views of the open reservoir. A relaxing, rejuvenating environment to take the family, including the family dogs. The views of the lake are breathtaking, and if you are lucky enough to come on a day with live music, that is extra special. Highly recommend a visit. Coffee, cocktails, mocktails, soft drinks, the choice is yours. Defo visit again when in Brum.

site_logo

Jay Pee . 2024-08-16

MORE AT Google

Not what it used to be. Queue system to order food with one waitress taking orders so you’ll be waiting a while. Food is bang average too. Still has a lovely view of the lake so decent for a pint but that’s about it

site_logo

AJ 23 . 2024-08-11

MORE AT Google

My mums favourite place for eats and loving the Place

site_logo

julia pardoe . 2024-08-09

MORE AT Google

Beautiful setting and place but unless you can afford it and don't need to take out a 2nd mortgage you'll love it.

site_logo

steve miller . 2024-08-09

MORE AT Google

Fantastic meal here. You certainly get what you pay for! Friendly helpful staff. Looking forward to our next visit

site_logo

Lee Peckover . 2024-08-01

MORE AT Google

Absolutely incredible food and what a location, make sure to pre book your taxis as there is no phone signal

site_logo

Sam Tweddle . 2024-07-31

MORE AT Google

We visited for the first time since new owners took it on. Must say the food was superb, staff very friendly and efficient. Drinks also good. tbh a little pricey but you pay extra for the location, views, service and ambience

site_logo

VillanTommy69 . 2024-07-21

MORE AT TripAdvisor

First time visiting today. We arrived early and had a lovely walk with our dog(they admit 4 legged friends to the terrace) through the woods and around the lake before having dinner on the terrace. Burger and a fish finger sandwich were delightful. Really lovely place. We will be back to sample the restaurant soon.

site_logo

Rachel W . 2024-07-20

MORE AT TripAdvisor

I am leaving this review on behalf of my parents who visited today. My brother purchased them a voucher on buy a gift for the 5 course taster menu. On behalf of my parents (who are in their 70’s), I followed the instructions on the voucher to make a reservation and this in turn took me to an online booking platform ‘Tock’, which is not easy to navigate. We wanted to query the £20 cancellation fee as the voucher had been paid for upfront, but when I called the head office number nobody was available to speak to on a Monday and Tuesday, therefore were told to contact restaurant directly by email. A reply was sent with contradicting information (the cancellation fee would be refunded on arrival, elsewhere it stated it would be taken off the final bill). I followed the instructions provided on the email and my parents received email confirmation. When they got to the restaurant they were told as the reservation did not show the voucher details ‘5 course taster meal’ they would not be able to dine and the £20 cancellation fee was refunded. My parents asked to speak to a manager but this was not possible and they were given the head office number ‘to rearrange’. The lady who dealt with them said it was not possible for her to rebook them. My parents left the restaurant and made a call to head office, who applied the voucher there and then and said they could now go back in and dine. If they had driven home, they would have missed out on their lunch. The whole situation put a dampener on the experience. Whilst they could not fault the food, and felt sorry for the girl who had to turn them away initially due to what can only be described as a shocking booking system, they would not return due to their experience. The lack of manager engagement is also a cause for concern.

site_logo

Kirsty . 2024-07-18

MORE AT TripAdvisor

Had a fantastic meal at the bracebridge, you can go to a naff chain pub and pay £20 for main courses, So not expensive at all considering the quality and the setting, Which is quite unique. 10 out of 10

site_logo

Birmingham Airport Transfers Direct . 2024-07-18

MORE AT TripAdvisor

We dined at the Terrace and it was a lovely experience. The food was really nice and at a fair price and the setting was perfect.

site_logo

Lou 202 . 2024-07-17

MORE AT TripAdvisor

Family celebration, people from Leeds, London, Nottingham and locals. Everyone enjoyed the experience, from the welcome at the beginning to the delicious food. We’ll be back soon

site_logo

Kay Leslie . 2024-06-30

MORE AT Google

Had lunch by the lake after a long walk in the park and it was lovely, great scene, good food, friendly service, had to change baby and the facilites were clean.

site_logo

Flawless Since88 . 2024-06-29

MORE AT Google

Similary restaurants in West Midlands

restaurant_img
4.1

1687 Opinions

location-icon1 St.Mary's Row
British
outdoor_seating_144511takeaway_144511delivery_144511

Lovely atmosphere, great service

restaurant_img
4.1

264 Opinions

location-iconSt. Georges House 3 Church Road, Birmingham B15 3SH England
British
outdoor_seating_253972takeaway_253972delivery_253972

Solo quería enviar un correo electrónico para decir lo mucho que todos disfrutaron de nuestra experiencia de té de la tarde el sábado pasado (5 de abril de 2025). El personal, incluido el gerente Kesaven, era increíble e hizo la experiencia muy especial, la comida era perfecta y nada sentía demasiados problemas. Gracias a todos ustedes por hacer mi baby shower hermosamente sin esfuerzo y perfecto.

restaurant_img
4.1

1387 Opinions

location-icon140 Church Road
British
outdoor_seating_88129takeaway_88129delivery_88129

Can't complain good old fashioned boozer and it's good value

restaurant_img
4.1

201 Opinions

location-icon66 Walsall Road
British
outdoor_seating_84945takeaway_84945delivery_84945

Used to love this take away, had some fantastic meals sadly my last experience was just that.. the last time I would purchase food from there. At 6.45 pm on a Tuesday found it empty, strange as it’s usally very busy. The food was terrible, it was cold and the chips were so hard! The batter was soggy and greasy and it tasted unpleasant. I was so disappointed as I’d had a busy day and I was really hungry but the whole lot went in the bin...

restaurant_img
4.1

2753 Opinions

location-iconLower Temple St.
British
outdoor_seating_106648takeaway_106648delivery_106648

Better and slightly cheaper than the other Nicholsons around corner, Bacchus Bar. (£5.90 2 halfs)