GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 242 opinions finded in 2 websites

site_photo4

Nº 345 in 1203 in Northumberland

Nº 89 of 237 Other cuisines in Northumberland

CUSTOMERS TALK ABOUT DISHES WITH..hamvegetablescakeoldmeatcoffeebaconcookedpiesandwichladysteakcheesesaladeggquicheroast

comment_iconOpinions

Fantastic Roast dinner today, large portions. All lovely fresh vegetables and served nice and hot. Desserts looked lovely and was tempted with the lemon roulade. Staff were very attentive and friendly. Looking forward to going back next Sunday.

site_logo

Angela Mcelvanney . 2024-10-13

MORE AT Google

We received such a friendly, warm greeting on a miserable wet day. The food did not disappoint either. We both had poached eggs and ham with brown toast. Also, my husband received a top up to his coffee without requesting it. Such excellent, attentive service. Thank you.

site_logo

Tricia C . 2024-10-08

MORE AT TripAdvisor

We went in for an ad hoc Sunday roast. Excellent lamb shank and roast beef. Loads of extras. Very good price and excellent service. Can’t fault it. We will be going back!

site_logo

TrippyRicky . 2024-10-06

MORE AT TripAdvisor

Lovely cafe. First time visiting and ordered a special hot pork roll with chips (£7.45) and a beef burger with chips (£9.95) both fresh and tasty. Chips are crispy on the outside and fluffy in the middle. Nice friendly service and quirky interior.

site_logo

Bethan Rose . 2024-10-05

MORE AT Google

Absolutely terrible all time around avoid at all costs

site_logo

Joe Hill . 2024-09-28

MORE AT Google

Had a great breakfast there yesterday. The full English was spot on and good value. My partner had a delicious porridge served with fresh berries and honey 😋 Lovely friendly staff too. We'll definitely be back

site_logo

Neil Blackett . 2024-09-01

MORE AT Google

Staff are amazing so friendly. Food is out of this world. Highly recommend the quiche.

site_logo

Eli Bee . 2024-08-27

MORE AT Google

A delicious Sunday lunch! A wide variety of fresh vegetables and tender lamb. The portions were very generous and we couldn't fault the meal. A lovely atmosphere, too.

site_logo

Sandancer . 2024-07-14

MORE AT TripAdvisor

Beautiful food as always. Never had a bad meal from here. I always pop in when in Hexham, staff are always friendly. Well done 👏

site_logo

Martin C . 2024-07-08

MORE AT TripAdvisor

If you want breakfast, please go before 10.30 (unless you are known in this reviewers perception). Got in at 10.40 (my bad and didn't see breakfast time before saw menu). Couple ordered before me by about 2 mins. Received full breakfast (looked and smelt good). I ordered a breakfast sandwich and told not doing them. (Waitress looked nervous to ask again if could do). When couple left, comments were 'good to see you. Not seen you for a bit' so appear to be locals?! Coffee was nice, though and they are dog friendly. Very nice country decoration. I understand kitchen is small, so it has a time limit, but maybe it should be consistent with all?!

site_logo

Debbie . 2024-07-08

MORE AT Google

Popped in on our way back from a drive in the countryside. Fancied a roast lunch and boy did they deliver! Copious amounts of roast beef, homemade Yorkshire pudding and too many vegetables to mention. Also they have a huge selection of deserts. Defo will be back!

site_logo

Richtoon . 2024-06-23

MORE AT TripAdvisor

First visit and won't be our last! Good fresh food made to order. Great staff, friendly and polite. The cafe itself is what I'd call 'traditional ' but in the best possible way. Very clean and smart - looked recently decorated, I recommend this place!

site_logo

Janice R . 2024-06-21

MORE AT TripAdvisor

We had the hot beef sandwich and chips off the specials board and it was amazing. Succulent beef and the best chips I've had since my mum cooked them in 1978. The hubby and I were well impressed. The service was quick and very friendly. Can't recommend highly enough.

site_logo

Connector35244207915 . 2024-06-19

MORE AT TripAdvisor

The Farmhouse Breakfast was the best cooked breakfast I've eaten in a cafe in ages and excellent value.

site_logo

Gloria Gayer . 2024-06-17

MORE AT Google

Food is lovely, cakes are amazing and the prices are reasonable. Definitely recommend

site_logo

Richie “Richie” Smith . 2024-06-16

MORE AT Google

The cheesecake here is better than any cheesecake I’ve had. Delicious and presented beautifully. Dog friendly so no one needs to miss out. Great staff, very friendly.

site_logo

PHB . 2024-06-15

MORE AT Google

Lovely hot beef sandwich and chips 🍟 always enjoy visiting Shire Gate cafe when we come to Hexham

site_logo

Brenda Young . 2024-05-30

MORE AT Google

Really nice cafe friendly staff clean surroundings and tasty scones really nice

site_logo

will H . 2024-05-28

MORE AT Google

Great place for a relaxing snack or meal. Excellent food. Great, friendly service. Food amazing. Highly recommend a visit.

site_logo

Lesley Kelly . 2024-05-24

MORE AT Google

Allot better than I was expecting. Service is top notch and the value for money is great.

site_logo

Alex Hopkins . 2024-05-12

MORE AT Google

Glorious farm house breakfast. All the trimmings. Nice friendly atmosphere and great value for money. Will shall be back.

site_logo

Rich Gibson (SaintGibson) . 2024-05-04

MORE AT Google

We had a ploughmans and a prawn salad Both were wonderful, fresh, tasty and a plateful ..served with a warm roll Wish we had space for the puddings and cakes on offer

site_logo

Elaine Allan . 2024-05-02

MORE AT Google

Food was average good service alright for a quick bite but unfortunately I wouldn't go back

site_logo

Angie Howse . 2024-04-30

MORE AT Google

Lovely food and friendly service with cakes to die for

site_logo

Stephen Mead . 2024-04-24

MORE AT Google

We have lived in Hexham for one year and have sampled just about all the cafes, pubs, restaurants. This little cafe is an absolute jem we went on a Sunday and had the most amazing Sunday roast. The veg was lovely and not overcooked in fact there were 6 vegetables on the plate. The meal was served hot, the beef and the lamb was delicious. Because this cafe only serves Sunday roast on Sunday they can really put a lot of time and effort into making it exceptional. Tina the lady that served us was lovely although the restaurant was very busy she was very efficient and very attentive. The deserts were lovely too. Would highly recommend this café especially on a Sunday.

site_logo

Marie Paull . 2024-04-15

MORE AT Google

Had Sunday dinner and because of the service and quality of food we returned this morning for a full English breakfast. Both times we were made to feel welcome and although there was only one cook/chef she still served up quality food in very reasonable time, even with my personal requirements (fussy eater). I would like to thank the chef and give her our compliments and also mention the great service from the lady waitress who served us both days. I fully recommend this place, great service great food and very reasonably priced. We will definitely be back in the future 👍

site_logo

Jack English . 2024-04-01

MORE AT Google

Stopped in Hexham by chance to find something to eat on Mother’s Day. Stumbled across this great cafe. Even though they were busy and we obviously didn’t have reservations, they squeezed us in and served a wonderful Sunday Dinner. Service was great, the staff were lovely, and the food was fantastic!

site_logo

Traigh G . 2024-03-10

MORE AT Google

Absolutely outstanding food.My husband had the steak pie and I have never seen so much steak, it melted in the mouth. I had the ham broth delicious. Dog freindly to

site_logo

Diane Prater . 2024-03-02

MORE AT Google

lovely little restaurant - booking is advised as it was almost full. my husband had the pork dinner- huge beautifully cooked chop, buttery mash, broccoli piping hot gravy whilst i had a tuna salad, selection of fresh crunchy leaves, eggs tomatoes and coleslaw with delicious tuna. lovely friendly staff. we will be back again!

site_logo

ann a . 2024-02-29

MORE AT TripAdvisor

Popped in mainly as I seen dog friendly sign on the window 👏 There was a small corner on hard floor suitable for my pup. We were made to feel very welcome and Jasper too, dog treats and water for him supplied. We ate sandwich, fries , scones and homemade cheesecake ( fantastic ) all of the food was delicious and homemade. All of the ladies serving are very helpful,friendly and polite. Nothing was a bother for them. 🥰👏 Visited toilets which are upstairs but extremely clean and tidy as was the rest of the seating area. Was advised they do a cracking Sunday lunch and look forward to trying that soon. Highly recommend this lovely place, you won’t be disappointed ! 👏👏

site_logo

JKDoll . 2024-02-18

MORE AT TripAdvisor

As a retired head chef ,50 plus years in the trade this is by far the best Sunday dinner I have had out and I’m very difficult to please.keep up the good work !

site_logo

Steve M . 2024-02-11

MORE AT TripAdvisor

Ordered ham broth looking forward toeating this dish on being served with broth we were told not to add salt as it was already salty and o boy it certainly was infact it was watery i edible and were was the ham! We have bee regular customers at this cafe but we will mot be back

site_logo

Drewrys123 . 2024-02-10

MORE AT TripAdvisor

Found by chance as walking around town - we both plumped for homemade quiche. Excellent value - plenty of quiche and ample salad and chips, Pity we didnt have room for cake as they looked awesome.

site_logo

dave c . 2024-01-13

MORE AT TripAdvisor

Popped in for lunch with my wife. I had the lasagna and my wife the prawn sandwich . Both were absolutely delicious. The staff were very friendly and the prices were very reasonable. We will definitely visit again next time we are in Hexam. Oh nearly forgot what a selection of cakes and goodies only problem was I was too full to try.

site_logo

Dean Goodall . 2024-01-11

MORE AT Google

This type of exquisite British tearoom is a pure delight. Beautifully decorated cosy interior with mature staff who know what real customer service means. The food is amazing, at a reasonable price and the total ambience makes you sure to revisit. You’ll need to book as it’s popular with limited spaces but you’ll not regret the experience.

site_logo

362AlanC362 . 2023-12-25

MORE AT TripAdvisor

Lovely food, lovely staff but the way the manager was shouting and balling at her staff in front of the customers was horrendous. I'd hate to see how she treats them behind the scenes.

site_logo

Andi M . 2023-12-21

MORE AT TripAdvisor

Christmas lunch special - and it was! Home made, only to be rivalled by my own Christmas dinner 🥰. Absolutely superb and at £20 a head very reasonable. Lovely environment friendly service. Highly recommend.

site_logo

Hencotes . 2023-12-15

MORE AT TripAdvisor

We ended up here a few days ago because the weather was terrible and we were desperate. You really would have to be to come in here. We clearly regretted it, the lady serving(Natasha?) was very rude, racist and mean. Overall it was a bad experience. One of us wanted to use the bathroom, and the lady insisted that all three of us had to order something first. So in the end we had three softdrinks and a dry, overpriced cookie. The food was disappointing.We did not feel welcome in this rather shabby cafe. Avoid this place at all costs. Also, the price was horrendous. Don't be fooled by the displayed items. False advertisement to say the least. We were absolutely disappointed by the establishment I can only agree with all the other negative ratings. I was shocked to see how many other people were unhappy with this place, which, unfortunately, I only saw in hindsight.

site_logo

Pippa Hill . 2023-12-11

MORE AT Google

Best cafe in Hexham for real home cooked food. From the breakfast to lunch menu and a great Sunday Lunch.

site_logo

David A . 2023-12-10

MORE AT TripAdvisor

Wowzers! Such a cosy traditional place- yummm Sunday roast with some amazing and sharp ladies looking after you. Go you! ;) Thanks lots

site_logo

Vita B . 2023-12-04

MORE AT Google

Well what to say service was truly awful. We asked about gluten free food to be told we don’t do that. Then as we were sat drinking coffee which we could not enjoy due to the strong smell of the cleaning products used. I get yea they need to clean but really use something with less of a smell it was that strong you could taste it is the air.

site_logo

Paradise14319089146 . 2023-11-20

MORE AT TripAdvisor

Dog friendly, pleasant staff and atmosphere, all the reviews I read were spot on. Definitely going to become a regular.

site_logo

Bob By . 2023-11-07

MORE AT Google

Very homely cafe. Food always delicious and portions very good. Staff great and friendly. Atmosphere very warm cosy feel. Desserts are also great. A nice selection of food for choice.

site_logo

Sa B . 2023-10-26

MORE AT Google

Popped in here while visiting Hexham with my parents and young children, and the dog. We were made very welcome and the dog even had his paws wiped on his way in! The service and the food were excellent and not overpriced, there was a lovely homely atmosphere. Would highly recommend.

site_logo

E Keegan . 2023-10-24

MORE AT Google

Popped in today for lunch and had the lamb chops with vegetables which was excellent. The staff were very pleasant and very attentive. The only issue was the being in a cafe I couldn’t lick the plate. I will certainty be back.

site_logo

Morris W . 2023-10-13

MORE AT TripAdvisor

Unbelievably good Sunday Roast. Lovely staff in a proper community cafe. The drinks were a bit limited - but it’s a cafe not a pub so I really can’t hold that against them! The desserts were also lovely. When we got the bill we thought it was about what you’d pay in a restaurant - but really, in a lot of pubs/restaurants you have to pay extra for vegetables and at The Shire Gate you get a huge amount of food included as is so there is no need to order any extras. Really good and we’ll be going back

site_logo

Smemz . 2023-10-10

MORE AT TripAdvisor

Visited Hexham and found this cafe. We were given a warm welcome shown to our table within seconds of arriving and our order was taken quickly after the waitress had told us about the specials boards. I had the omelette and salad it was really nice and so filling. My partner had Ham double egg and chips which he enjoyed. The place was very clean as were the customer toilets. All staff were great especially the waitress on duty she was lovely making time to make everyone as welcome and comfortable as possible. I heard her offer to read out the menu to a couple that had eye sight issues which I thought was lovely of her. I spied the homemade cakes on the counter as I went past and wished I could of fit one in but now it gives me the opportunity to return one day to sample them as they looked delicious. Will definitely return. Well done to all

site_logo

kh1354 . 2023-09-27

MORE AT TripAdvisor

Came across this cafe on the off chance on a Sunday. Had an enormous lovely Sunday roast dinner! Excellent food and service.

site_logo

Julie Watts . 2023-09-25

MORE AT Google

Absolutely top quality food. We both had the roast beef dinner. It was perfection. Beef was melt in the mouth, Yorkshire pud was divine, veggies were properly cooked, gravy was good and thick. For dessert we had individual trifle. This was exactly how I remember it from my childhood. It even had a glacé cherry on top. All in all a wonderful meal. I would highly recommend it

site_logo

Gail Fullilove . 2023-09-24

MORE AT Google

We were greeted straight away on arrival by a friendly waitress. We ordered roast dinners and pots of tea. The tea arrived immediately but the dinners came much later when the tea was cold. The meals looked so appertising BUT the vegetables were so very hard it was almost impossible to cut into them. Would not recommend.

site_logo

michael brown . 2023-09-22

MORE AT Google

Stumbled across this cafe on a wet day, looking for a late lunch Food was excellent and good old old fashioned value as well

site_logo

nigel r . 2023-09-22

MORE AT TripAdvisor

Stumbled across this place on a Sunday around lunchtime, and they advertised Sunday lunch. We did not expect much but it was superb. The meat was beautifully cocked and the veg very nice also, with lots of variety. All finished off with great deserts. Would definitely go back. We were luck to be passing at 11:30 because by 12:300 it was very busy, justifiably so.

site_logo

jonsnell . 2023-09-15

MORE AT TripAdvisor

Visited today. The chips were cooked on the outside raw on the inside. The tomatoes were halved and grilled but not properly. They were chared on top but hard and cold on the inside. The waitress couldn't care less, and she even charged my wife for a cup of hot water.

site_logo

Jamal Abdullah . 2023-09-08

MORE AT Google

Sunday dinner is said to be outstanding and the cafe advertises itself as being vegetarian friendly. The vegetarian Sunday offering is “all the trimmings” (Yorkshire pudding, veg, roasties) and vegetarian gravy. That’s it.. no protein, just Sunday roast without the meat. No nut roast, cauliflower steak, tofu, nothing, just no meat. Not good at all!

site_logo

dzil . 2023-09-02

MORE AT TripAdvisor

Absolutely delicious with fantastic service.

site_logo

P O . 2023-09-01

MORE AT Google

just been here with my mam for Sunday lunch.we ordered 1 beef and 1 pork.the meat was lovely and tender.lots of veg and extra gravy.we got 3 desserts to take away.i git banoffeepie and we also ordered a cheesecake and some choc cake for my dad.all were lovely.100% recommend. staff lovely and friendly and helpful.will defo visit again

site_logo

Leanne . 2023-08-27

MORE AT Google

Lovely home cooked food - very welcoming and a homely feel to the cafe. They gave us plenty time to decide on the delicious menu - all the food looked so tasty! Ours didn’t take long and came hot! Was delicious - we aren’t from Hexham but will defo recommend if anyone visits. Thank you

site_logo

nellie1993 . 2023-08-09

MORE AT TripAdvisor

A lovely local experience! Great cakes, great service and a lovely cuppa.

site_logo

Jason Pennington . 2023-08-03

MORE AT Google

A very nice place to go for lunch!

site_logo

Jill Cowie . 2023-07-04

MORE AT Google

Spoton Great food and really friendly folk. A must stop off whilst in Hexham.

site_logo

David Shaw . 2023-07-01

MORE AT Google

The staff very friendly and helpful and the food was absolutely delicious and the desserts we ad were fantastic all in all everything was to die for and most of all dogs are welcome

site_logo

boltonbaldy60 . 2023-06-22

MORE AT TripAdvisor

Een geweldige plek om iets te eten. Alles home made. Zo goed en lekker. Geweldige service. Echt een aanrader. Het is een familie restaurant het voelt heel huiselijk. Eerlijk eten voor geen grote prijzen.

site_logo

Simon . 2023-06-22

MORE AT Google

Got to have been the best Sunday dinner I've had in many a moon. Can't fault the place, make you fell like you're a part of the furniture 😊.

site_logo

Del Kiley . 2023-05-28

MORE AT Google

Cannot recommend this family run cafe come restaurant highly enough. When I'm in Hexham visiting family two or three times a year and it's my first choice for lunch whatever.. I regularly meet an old friend for lunch and he has through his tourism post taken to recommending cafe as well... 👍

site_logo

David Taylor . 2023-05-26

MORE AT Google

We have just had a lovely lunch at the Shire Gate. My husband had a cheese and tomato toastie served with a side salad that was so tasty and had a lovely variety of ingredients. I settled for a cheese scone which was also very tasty. We finished off with a slice of carrot cake and ginger pudding served with custard. Everything was absolutely perfect as well as the very friendly and helpful staff. Would definately recommend for a place to eat in Hexam. The menu is very extensive too. Very reasonably priced.

site_logo

Christine W . 2023-05-24

MORE AT TripAdvisor

We have visited several times now , always had a friendly welcome and great service. First time we have visited for Sunday Lunch and it was excellent, vegetables all cooked well , Yorkshire pudding and meat so soft and full of flavour. A great little cafe serving hot homemade food . The cakes and puddings also look amazing, I had no room after my dinner ,my wife had the Carrot and Walnut cake and said it was delicious . Dog friendly aswell 🐶

site_logo

alane518 . 2023-05-07

MORE AT TripAdvisor

Beautiful Sunday lunch, every veg you can think of on the plate, lovely Yorkshire puds, meat was so tender, nice gravy, great service

site_logo

Gill Heslop . 2023-05-07

MORE AT Google

Good food experience. Great menu plus specials, good service. Enjoyed everything.

site_logo

Tom Keating . 2023-05-02

MORE AT Google

Friendly, welcoming, really quaint, rustic crockery... Yes! The teapot works without leaking too! Food is amazing, really tasty, well cooked and well presented.

site_logo

Anne Hutchins . 2023-04-19

MORE AT Google

Lovely friendly staff. It was busy which demonstrates how good it is

site_logo

Judith Moore . 2023-04-14

MORE AT Google

Traditional home cooked food, friendly staff, would recommend, unfortunately doesn't seem to have disabled toilets,

site_logo

Robert THOMPSON . 2023-04-03

MORE AT Google

Great food and friendly service

site_logo

Andrew Thomson . 2023-03-28

MORE AT Google

Food cooked to order mostly, assorted scones 😋

site_logo

John Moore . 2023-03-28

MORE AT Google

Beautiful food. Excellent, friendly staff. Prompt service. Fantastic full English breakfast 👌

site_logo

Owen Burgess . 2023-03-19

MORE AT Google

Welcomed by a friendly waitress who seated us immediately with menus and a smile and pointed us in the direction of the specials board. Great service, orders taken and teas delivered promptly. My partner and I admired the quaint decor and an old fashioned appeal of traditional cafes growing up. Quite enjoyed the food but was left with a bitter taste in my mouth as I ate and heard the lady cooking in the open kitchen section berate the young waitress who had been nothing but polite and hard working: the young girl showed a polite and welcoming personality, was eloquent in how she spoke to customers and cleaned tables, served food and responded to service professionally and quickly. Even in the midst of being shouted at by the cook she didn’t crumble despite catching my eyes and clearly noting embarrassment, knowing she was being watched. This girl was beyond tolerant of how she was spoken to: comments like come, get your head out your arse and where’s your head today were unfathomable to my partner and I as this young lady was working very hard. She is certainly developing rhino skin which will no doubt bode well for her in her future adulting career of choice but I was put off from returning to the cafe ever again because of the older lady cooking who absolutely should know better. I understand tight ships need to be run and if I’d witnessed any under performance I’d have kept quiet. Staying in Walwick for the night and I thought about this tenacious waitress over dinner and when I woke in the morning. I do hope she knows her worth and keeps her head held high.

site_logo

msgd2023 . 2023-03-11

MORE AT TripAdvisor

We are fairly regular visitors to this cafe, food is always lovely but today when we visited the lady who cooks and I presume is the owner subjected numerous members of her staff to awful verbal abuse and using bad language, I don’t know if she realised how uncomfortable this was for the whole cafe and the customers exchanging looks with each other, I can only commend her staff as they have always provided friendly and efficient service to us and must have amazing self control as I would have told her exactly where to stick her job.

site_logo

sue123reading . 2023-03-11

MORE AT TripAdvisor

After a lovely morning spent wandering around hexham. Called in here for a spot of lunch . We both had lamb dips . Absolutely beautiful 🤩. With a pot of tea . Cafe was busy , lovely friendly staff . We’re tempted to try one of there cakes , maybe next time .

site_logo

305leannea . 2023-02-27

MORE AT TripAdvisor

Stumbled upon this cafe by accident with a hungry 6 year old, a baby and 4 adults. The staff saw us outside deciding whether to enter and they approached us to welcome us in. Food was lovely, reasonably priced. Best thing was the staff though, genuinely kind and friendly, we really enjoyed our visit, thank you! And the toasties were fab!

site_logo

kso10 . 2023-02-25

MORE AT TripAdvisor

Delighted to find such a great place for lunch on our first visit to Hexham. Excellent home made food and friendly and efficient staff. Will definately be back

site_logo

Rosalind Davies . 2023-01-28

MORE AT Google

Staff very welcoming and friendly, I had cauliflower and Stilton soup which was outstanding and hit the spot on a cold rainy day! All home cooked to a high standard, would highly recommend!

site_logo

Adventure47488807365 . 2022-12-31

MORE AT TripAdvisor

We stopped here for breakfast not realising the cut off for this was 10:30. The chef forgave us for the 7 minutes were were late and rustled us up a sausage sandwich and a plate of ham and eggs. Both delightful - the home cooked...

site_logo

christine c . 2022-12-09

MORE AT TripAdvisor

My wife and I visited here on Monday 31 October. Warm welcome on entering. Very friendly staff with great sense of humour. Great meal, both as regards quality and quantity

site_logo

victoreV5862SF . 2022-11-16

MORE AT TripAdvisor

It was a rather dull wet day in Hexham and we were bedraggled then we noticed this welcoming eatery and on entering the drab day disappeared. We were looking for a light lunch I had a roast lamb sandwich and my partner a prawn salad...

site_logo

Tony L . 2022-11-15

MORE AT TripAdvisor

Superb Sunday lunch! Friendly. Relaxed. Massive portions including 11 vegetables with the roast! Very good value

site_logo

Robert B . 2022-09-25

MORE AT TripAdvisor

Popped in for a sandwich and a coffee.The staff were so welcoming as you enter.The sandwich was freshly made and was real thick ham .The salad with it was lovely and was well presented.To round the meal off we had lemon drizzle cake with cream.It...

site_logo

mrsdRedcar . 2022-09-17

MORE AT TripAdvisor

My wife and I were attracted to the Shire Gate Cafe by the specials board offering Lamb Chops. A friendly welcome the moment we walked in. I enjoyed an excellent meal of Lamp Chops, roast and mashed potatoes, plenty of fresh mixed veg and gravy,...

site_logo

Terry F . 2022-09-17

MORE AT TripAdvisor

Loved the food and the atmosphere. Great staff and the food was amazing too. I would recommend to anyone with or without a dog.

site_logo

K9932MWmaried . 2022-08-06

MORE AT TripAdvisor

Called in here on a visit to Hexham for lunch with my wife. Great service, very friendly and we will definitely return. My wife said she had the best roast chicken dinner she had ever had, and I felt I had the best lasagne anywhere...

site_logo

RichardE007 . 2022-08-03

MORE AT TripAdvisor

Stopped off at Hexham and found you as we wandered around. Great staff who were welcoming and very attentive. Lovely atmosphere. Order was taken quickly and the food came quickly. Delicious toasties had by both of us. And a toasted tea cake to finish. Thank...

site_logo

Richard P . 2022-07-22

MORE AT TripAdvisor

Called in for breakfast on way to Hexham races, well it certainly didn’t disappoint, all freshly cooked and quality ingredients, huge portion it certainly kept us going all day, One of the best breakfast we have had in a cafe and reasonably priced too They...

site_logo

Alipaulstaffs . 2022-06-13

MORE AT TripAdvisor

Lovely, friendly,helpful staff. Nice atmosphere. Fab toasted sandwiches, with tasty salad/dressing etc and good tea. They have an extensive menu... Something for everyone. Generous portions... In fact, we skipped dinner, as we were still nicely full. Highly recommend.

site_logo

Sue M . 2022-05-26

MORE AT TripAdvisor

1st time visiting the Shire Gate Cafe for lunch in hexham The staff were warm and welcoming with a good selection on the menu from breakfasts to nice cakes We had the hot beef sandwich with chips and a jacket potato with tuna All were...

site_logo

Richard-9373 . 2022-04-18

MORE AT TripAdvisor

Called in today initialy ordered two coffees, decided to order Tuna salad,and roast beef, sandwich,beef very nice,oven chips,nothing to write home about,my partner ordered tuna salad,she said it was ok but very small amount of tuna.Near end of salad and underneath, she found a hair....

site_logo

G7273ROdavide . 2022-04-17

MORE AT TripAdvisor

I came to this cafe initially to have the 3 egg omelette but decided to have the roast dinner on the specials board which they must put together every day. It was exceptional - as was the gammon meal I had had there the previous...

site_logo

Paul G . 2022-03-08

MORE AT TripAdvisor

Lunch was yummy, would return… staff were all friendly. Only slight negative was the only 1 highchair and someone was using it, so we juggled our 17 month old in between us, luckily she was well behaved and loved her lunch. Would love staff to...

site_logo

Z5305IXkatel . 2022-01-09

MORE AT TripAdvisor

Sunday 21st November After a lovely walk around Hexham, my friend and I came across, this lovely little café. A welcome sight, rather than the repetitive corporate outlets one usually sees. We were welcomed by a lovely lady, promptly seated and order taken. Everywhere was...

site_logo

595sandyb . 2021-11-21

MORE AT TripAdvisor

We arrived at the Shire Gate at around 1215 on a Saturday and managed to get one of the last tables! The staff were very friendly, helpful and chatty. The place was very clean and tables were sanitized between customers. The place was buzzing and...

site_logo

Cliff J . 2021-11-07

MORE AT TripAdvisor

We had not booked but luckily got a table for 4 and had a superb lunch; excellent menu and goodly portions when the food arrived ensured that we all had a hearty lunch. The food was tasty with all salads being freshly prepared.

site_logo

martinhH5865RD . 2021-11-07

MORE AT TripAdvisor

On our way home from a mini break we called into the Shire Gate.It was very welcoming and an added bonus as our dog was allowed in. The place was absolutely immaculate and the breakfast was off a high standard and very good value.We certainly...

site_logo

snowflake53228 . 2021-10-22

MORE AT TripAdvisor

A friendly welcome e from the second we walked through the door. A bowl of water was available for our dog, and excellent home cooked food was beautifully presented. Pay them a visit, you won’t be disappointed.

site_logo

Tracey S . 2021-09-22

MORE AT TripAdvisor

Similary restaurants in North East

restaurant_img
4.5

45 Opinions

location-icon18 Queen Street
Other cuisines
outdoor_seating_238245takeaway_238245delivery_238245

Found this cafe quite by accident but went in as it was full. Soon got a table which was quickly cleaned by efficient staff. Good menu, proper home cooked food at very reasonable prices. All staff very good and friendly with visitors and locals alike. Hope to return again.

restaurant_img
4.5

353 Opinions

location-iconA68
Other cuisines
outdoor_seating_322537takeaway_322537delivery_322537

Very nice staff, food and service. Our best place to rest before getting to newcastle airport 😊

restaurant_img
4.5

191 Opinions

location-iconMarket Place
Other cuisines
outdoor_seating_216720takeaway_216720delivery_216720

Visited as a party of 12 for Sunday Lunch. Food was top class with a good choice and very reasonably priced. Great service, would recommend.

restaurant_img
4.5

1311 Opinions

location-icon19 Bridge Street
Other cuisines
outdoor_seating_190747takeaway_190747delivery_190747

Warkworth has a small nucleus of great places to eat, and we'd never tried Bertrams, so we went. It was a no brainer given the quality of other reviews. The only downside was that we had to get in and out early so were nearly the first people in hence little "atmosphere" but that was our agenda not the restaurant, and we were there for the food... ... which was first class. Superb hake served with a beautiful herby crab pate and dauphinoise potatoes. The flavours were immense and everything was cooked to perfection. You notice the difference with real quality and top chef standards and this delivered for me. The lemon meringue dessert was the proverbial icing on the metaphorical cake. Superb.

restaurant_img
4.5

38 Opinions

location-icon7 Merton Rd
Other cuisines
outdoor_seating_140856takeaway_140856delivery_140856

Amazing food! Amazing staff! Had my wedding catering made and all of this was delicious and beautifully presented! Thank you so much for everything and making my day stress free! Will 100% recommend and will be back again!