Based on 231 opinions finded in 2 websites
Based on 231 opinions finded in 2 websites
Nº 350 in 1203 in Northumberland
Nº 91 of 237 Other cuisines in Northumberland
CUSTOMERS TALK ABOUT DISHES WITH..meatvegetablescakeoldbaconcookedeggpiehamsandwichladysteakcheesecoffeesaladquicheroastOpinions
Had a great breakfast there yesterday. The full English was spot on and good value. My partner had a delicious porridge served with fresh berries and honey 😋 Lovely friendly staff too. We'll definitely be back
Neil Blackett . 2024-09-01
MORE AT Google
Staff are amazing so friendly. Food is out of this world. Highly recommend the quiche.
Eli Bee . 2024-08-27
MORE AT Google
A delicious Sunday lunch! A wide variety of fresh vegetables and tender lamb. The portions were very generous and we couldn't fault the meal. A lovely atmosphere, too.
Sandancer . 2024-07-14
MORE AT TripAdvisor
If you want breakfast, please go before 10.30 (unless you are known in this reviewers perception). Got in at 10.40 (my bad and didn't see breakfast time before saw menu). Couple ordered before me by about 2 mins. Received full breakfast (looked and smelt good). I ordered a breakfast sandwich and told not doing them. (Waitress looked nervous to ask again if could do). When couple left, comments were 'good to see you. Not seen you for a bit' so appear to be locals?! Coffee was nice, though and they are dog friendly. Very nice country decoration. I understand kitchen is small, so it has a time limit, but maybe it should be consistent with all?!
Debbie . 2024-07-08
MORE AT Google
Beautiful food as always. Never had a bad meal from here. I always pop in when in Hexham, staff are always friendly. Well done 👏
Martin C . 2024-07-08
MORE AT TripAdvisor
Popped in on our way back from a drive in the countryside. Fancied a roast lunch and boy did they deliver! Copious amounts of roast beef, homemade Yorkshire pudding and too many vegetables to mention. Also they have a huge selection of deserts. Defo will be back!
Richtoon . 2024-06-23
MORE AT TripAdvisor
First visit and won't be our last! Good fresh food made to order. Great staff, friendly and polite. The cafe itself is what I'd call 'traditional ' but in the best possible way. Very clean and smart - looked recently decorated, I recommend this place!
Janice R . 2024-06-21
MORE AT TripAdvisor
We had the hot beef sandwich and chips off the specials board and it was amazing. Succulent beef and the best chips I've had since my mum cooked them in 1978. The hubby and I were well impressed. The service was quick and very friendly. Can't recommend highly enough.
Connector35244207915 . 2024-06-19
MORE AT TripAdvisor
The Farmhouse Breakfast was the best cooked breakfast I've eaten in a cafe in ages and excellent value.
Gloria Gayer . 2024-06-17
MORE AT Google
Food is lovely, cakes are amazing and the prices are reasonable. Definitely recommend
Richie “Richie” Smith . 2024-06-16
MORE AT Google
The cheesecake here is better than any cheesecake I’ve had. Delicious and presented beautifully. Dog friendly so no one needs to miss out. Great staff, very friendly.
PHB . 2024-06-15
MORE AT Google
Lovely hot beef sandwich and chips 🍟 always enjoy visiting Shire Gate cafe when we come to Hexham
Brenda Young . 2024-05-30
MORE AT Google
Really nice cafe friendly staff clean surroundings and tasty scones really nice
will H . 2024-05-28
MORE AT Google
Great place for a relaxing snack or meal. Excellent food. Great, friendly service. Food amazing. Highly recommend a visit.
Lesley Kelly . 2024-05-24
MORE AT Google
Allot better than I was expecting. Service is top notch and the value for money is great.
Alex Hopkins . 2024-05-12
MORE AT Google
Glorious farm house breakfast. All the trimmings. Nice friendly atmosphere and great value for money. Will shall be back.
Rich Gibson (SaintGibson) . 2024-05-04
MORE AT Google
We had a ploughmans and a prawn salad Both were wonderful, fresh, tasty and a plateful ..served with a warm roll Wish we had space for the puddings and cakes on offer
Elaine Allan . 2024-05-02
MORE AT Google
Food was average good service alright for a quick bite but unfortunately I wouldn't go back
Angie Howse . 2024-04-30
MORE AT Google
Lovely food and friendly service with cakes to die for
Stephen Mead . 2024-04-24
MORE AT Google
We have lived in Hexham for one year and have sampled just about all the cafes, pubs, restaurants. This little cafe is an absolute jem we went on a Sunday and had the most amazing Sunday roast. The veg was lovely and not overcooked in fact there were 6 vegetables on the plate. The meal was served hot, the beef and the lamb was delicious. Because this cafe only serves Sunday roast on Sunday they can really put a lot of time and effort into making it exceptional. Tina the lady that served us was lovely although the restaurant was very busy she was very efficient and very attentive. The deserts were lovely too. Would highly recommend this café especially on a Sunday.
Marie Paull . 2024-04-15
MORE AT Google
Had Sunday dinner and because of the service and quality of food we returned this morning for a full English breakfast. Both times we were made to feel welcome and although there was only one cook/chef she still served up quality food in very reasonable time, even with my personal requirements (fussy eater). I would like to thank the chef and give her our compliments and also mention the great service from the lady waitress who served us both days. I fully recommend this place, great service great food and very reasonably priced. We will definitely be back in the future 👍
Jack English . 2024-04-01
MORE AT Google
Stopped in Hexham by chance to find something to eat on Mother’s Day. Stumbled across this great cafe. Even though they were busy and we obviously didn’t have reservations, they squeezed us in and served a wonderful Sunday Dinner. Service was great, the staff were lovely, and the food was fantastic!
Traigh G . 2024-03-10
MORE AT Google
Absolutely outstanding food.My husband had the steak pie and I have never seen so much steak, it melted in the mouth. I had the ham broth delicious. Dog freindly to
Diane Prater . 2024-03-02
MORE AT Google
lovely little restaurant - booking is advised as it was almost full. my husband had the pork dinner- huge beautifully cooked chop, buttery mash, broccoli piping hot gravy whilst i had a tuna salad, selection of fresh crunchy leaves, eggs tomatoes and coleslaw with delicious tuna. lovely friendly staff. we will be back again!
ann a . 2024-02-29
MORE AT TripAdvisor
Popped in mainly as I seen dog friendly sign on the window 👏 There was a small corner on hard floor suitable for my pup. We were made to feel very welcome and Jasper too, dog treats and water for him supplied. We ate sandwich, fries , scones and homemade cheesecake ( fantastic ) all of the food was delicious and homemade. All of the ladies serving are very helpful,friendly and polite. Nothing was a bother for them. 🥰👏 Visited toilets which are upstairs but extremely clean and tidy as was the rest of the seating area. Was advised they do a cracking Sunday lunch and look forward to trying that soon. Highly recommend this lovely place, you won’t be disappointed ! 👏👏
JKDoll . 2024-02-18
MORE AT TripAdvisor
As a retired head chef ,50 plus years in the trade this is by far the best Sunday dinner I have had out and I’m very difficult to please.keep up the good work !
Steve M . 2024-02-11
MORE AT TripAdvisor
Ordered ham broth looking forward toeating this dish on being served with broth we were told not to add salt as it was already salty and o boy it certainly was infact it was watery i edible and were was the ham! We have bee regular customers at this cafe but we will mot be back
Drewrys123 . 2024-02-10
MORE AT TripAdvisor
Found by chance as walking around town - we both plumped for homemade quiche. Excellent value - plenty of quiche and ample salad and chips, Pity we didnt have room for cake as they looked awesome.
dave c . 2024-01-13
MORE AT TripAdvisor
Popped in for lunch with my wife. I had the lasagna and my wife the prawn sandwich . Both were absolutely delicious. The staff were very friendly and the prices were very reasonable. We will definitely visit again next time we are in Hexam. Oh nearly forgot what a selection of cakes and goodies only problem was I was too full to try.
Dean Goodall . 2024-01-11
MORE AT Google
This type of exquisite British tearoom is a pure delight. Beautifully decorated cosy interior with mature staff who know what real customer service means. The food is amazing, at a reasonable price and the total ambience makes you sure to revisit. You’ll need to book as it’s popular with limited spaces but you’ll not regret the experience.
362AlanC362 . 2023-12-25
MORE AT TripAdvisor
Lovely food, lovely staff but the way the manager was shouting and balling at her staff in front of the customers was horrendous. I'd hate to see how she treats them behind the scenes.
Andi M . 2023-12-21
MORE AT TripAdvisor
Christmas lunch special - and it was! Home made, only to be rivalled by my own Christmas dinner 🥰. Absolutely superb and at £20 a head very reasonable. Lovely environment friendly service. Highly recommend.
Hencotes . 2023-12-15
MORE AT TripAdvisor
We ended up here a few days ago because the weather was terrible and we were desperate. You really would have to be to come in here. We clearly regretted it, the lady serving(Natasha?) was very rude, racist and mean. Overall it was a bad experience. One of us wanted to use the bathroom, and the lady insisted that all three of us had to order something first. So in the end we had three softdrinks and a dry, overpriced cookie. The food was disappointing.We did not feel welcome in this rather shabby cafe. Avoid this place at all costs. Also, the price was horrendous. Don't be fooled by the displayed items. False advertisement to say the least. We were absolutely disappointed by the establishment I can only agree with all the other negative ratings. I was shocked to see how many other people were unhappy with this place, which, unfortunately, I only saw in hindsight.
Pippa Hill . 2023-12-11
MORE AT Google
Best cafe in Hexham for real home cooked food. From the breakfast to lunch menu and a great Sunday Lunch.
David A . 2023-12-10
MORE AT TripAdvisor
Wowzers! Such a cosy traditional place- yummm Sunday roast with some amazing and sharp ladies looking after you. Go you! ;) Thanks lots
Vita B . 2023-12-04
MORE AT Google
Well what to say service was truly awful. We asked about gluten free food to be told we don’t do that. Then as we were sat drinking coffee which we could not enjoy due to the strong smell of the cleaning products used. I get yea they need to clean but really use something with less of a smell it was that strong you could taste it is the air.
Paradise14319089146 . 2023-11-20
MORE AT TripAdvisor
Dog friendly, pleasant staff and atmosphere, all the reviews I read were spot on. Definitely going to become a regular.
Bob By . 2023-11-07
MORE AT Google
Very homely cafe. Food always delicious and portions very good. Staff great and friendly. Atmosphere very warm cosy feel. Desserts are also great. A nice selection of food for choice.
Sa B . 2023-10-26
MORE AT Google
Popped in here while visiting Hexham with my parents and young children, and the dog. We were made very welcome and the dog even had his paws wiped on his way in! The service and the food were excellent and not overpriced, there was a lovely homely atmosphere. Would highly recommend.
E Keegan . 2023-10-24
MORE AT Google
Popped in today for lunch and had the lamb chops with vegetables which was excellent. The staff were very pleasant and very attentive. The only issue was the being in a cafe I couldn’t lick the plate. I will certainty be back.
Morris W . 2023-10-13
MORE AT TripAdvisor
Unbelievably good Sunday Roast. Lovely staff in a proper community cafe. The drinks were a bit limited - but it’s a cafe not a pub so I really can’t hold that against them! The desserts were also lovely. When we got the bill we thought it was about what you’d pay in a restaurant - but really, in a lot of pubs/restaurants you have to pay extra for vegetables and at The Shire Gate you get a huge amount of food included as is so there is no need to order any extras. Really good and we’ll be going back
Smemz . 2023-10-10
MORE AT TripAdvisor
Visited Hexham and found this cafe. We were given a warm welcome shown to our table within seconds of arriving and our order was taken quickly after the waitress had told us about the specials boards. I had the omelette and salad it was really nice and so filling. My partner had Ham double egg and chips which he enjoyed. The place was very clean as were the customer toilets. All staff were great especially the waitress on duty she was lovely making time to make everyone as welcome and comfortable as possible. I heard her offer to read out the menu to a couple that had eye sight issues which I thought was lovely of her. I spied the homemade cakes on the counter as I went past and wished I could of fit one in but now it gives me the opportunity to return one day to sample them as they looked delicious. Will definitely return. Well done to all
kh1354 . 2023-09-27
MORE AT TripAdvisor
Came across this cafe on the off chance on a Sunday. Had an enormous lovely Sunday roast dinner! Excellent food and service.
Julie Watts . 2023-09-25
MORE AT Google
Absolutely top quality food. We both had the roast beef dinner. It was perfection. Beef was melt in the mouth, Yorkshire pud was divine, veggies were properly cooked, gravy was good and thick. For dessert we had individual trifle. This was exactly how I remember it from my childhood. It even had a glacé cherry on top. All in all a wonderful meal. I would highly recommend it
Gail Fullilove . 2023-09-24
MORE AT Google
We were greeted straight away on arrival by a friendly waitress. We ordered roast dinners and pots of tea. The tea arrived immediately but the dinners came much later when the tea was cold. The meals looked so appertising BUT the vegetables were so very hard it was almost impossible to cut into them. Would not recommend.
michael brown . 2023-09-22
MORE AT Google
Stumbled across this cafe on a wet day, looking for a late lunch Food was excellent and good old old fashioned value as well
nigel r . 2023-09-22
MORE AT TripAdvisor
Stumbled across this place on a Sunday around lunchtime, and they advertised Sunday lunch. We did not expect much but it was superb. The meat was beautifully cocked and the veg very nice also, with lots of variety. All finished off with great deserts. Would definitely go back. We were luck to be passing at 11:30 because by 12:300 it was very busy, justifiably so.
jonsnell . 2023-09-15
MORE AT TripAdvisor
Visited today. The chips were cooked on the outside raw on the inside. The tomatoes were halved and grilled but not properly. They were chared on top but hard and cold on the inside. The waitress couldn't care less, and she even charged my wife for a cup of hot water.
Jamal Abdullah . 2023-09-08
MORE AT Google
Sunday dinner is said to be outstanding and the cafe advertises itself as being vegetarian friendly. The vegetarian Sunday offering is “all the trimmings” (Yorkshire pudding, veg, roasties) and vegetarian gravy. That’s it.. no protein, just Sunday roast without the meat. No nut roast, cauliflower steak, tofu, nothing, just no meat. Not good at all!
dzil . 2023-09-02
MORE AT TripAdvisor
Absolutely delicious with fantastic service.
P O . 2023-09-01
MORE AT Google
just been here with my mam for Sunday lunch.we ordered 1 beef and 1 pork.the meat was lovely and tender.lots of veg and extra gravy.we got 3 desserts to take away.i git banoffeepie and we also ordered a cheesecake and some choc cake for my dad.all were lovely.100% recommend. staff lovely and friendly and helpful.will defo visit again
Leanne . 2023-08-27
MORE AT Google
Lovely home cooked food - very welcoming and a homely feel to the cafe. They gave us plenty time to decide on the delicious menu - all the food looked so tasty! Ours didn’t take long and came hot! Was delicious - we aren’t from Hexham but will defo recommend if anyone visits. Thank you
nellie1993 . 2023-08-09
MORE AT TripAdvisor
A lovely local experience! Great cakes, great service and a lovely cuppa.
Jason Pennington . 2023-08-03
MORE AT Google
A very nice place to go for lunch!
Jill Cowie . 2023-07-04
MORE AT Google
Spoton Great food and really friendly folk. A must stop off whilst in Hexham.
David Shaw . 2023-07-01
MORE AT Google
The staff very friendly and helpful and the food was absolutely delicious and the desserts we ad were fantastic all in all everything was to die for and most of all dogs are welcome
boltonbaldy60 . 2023-06-22
MORE AT TripAdvisor
Een geweldige plek om iets te eten. Alles home made. Zo goed en lekker. Geweldige service. Echt een aanrader. Het is een familie restaurant het voelt heel huiselijk. Eerlijk eten voor geen grote prijzen.
Simon . 2023-06-22
MORE AT Google
Got to have been the best Sunday dinner I've had in many a moon. Can't fault the place, make you fell like you're a part of the furniture 😊.
Del Kiley . 2023-05-28
MORE AT Google
Cannot recommend this family run cafe come restaurant highly enough. When I'm in Hexham visiting family two or three times a year and it's my first choice for lunch whatever.. I regularly meet an old friend for lunch and he has through his tourism post taken to recommending cafe as well... 👍
David Taylor . 2023-05-26
MORE AT Google
We have just had a lovely lunch at the Shire Gate. My husband had a cheese and tomato toastie served with a side salad that was so tasty and had a lovely variety of ingredients. I settled for a cheese scone which was also very tasty. We finished off with a slice of carrot cake and ginger pudding served with custard. Everything was absolutely perfect as well as the very friendly and helpful staff. Would definately recommend for a place to eat in Hexam. The menu is very extensive too. Very reasonably priced.
Christine W . 2023-05-24
MORE AT TripAdvisor
Beautiful Sunday lunch, every veg you can think of on the plate, lovely Yorkshire puds, meat was so tender, nice gravy, great service
Gill Heslop . 2023-05-07
MORE AT Google
We have visited several times now , always had a friendly welcome and great service. First time we have visited for Sunday Lunch and it was excellent, vegetables all cooked well , Yorkshire pudding and meat so soft and full of flavour. A great little cafe serving hot homemade food . The cakes and puddings also look amazing, I had no room after my dinner ,my wife had the Carrot and Walnut cake and said it was delicious . Dog friendly aswell 🐶
alane518 . 2023-05-07
MORE AT TripAdvisor
Good food experience. Great menu plus specials, good service. Enjoyed everything.
Tom Keating . 2023-05-02
MORE AT Google
Friendly, welcoming, really quaint, rustic crockery... Yes! The teapot works without leaking too! Food is amazing, really tasty, well cooked and well presented.
Anne Hutchins . 2023-04-19
MORE AT Google
Lovely friendly staff. It was busy which demonstrates how good it is
Judith Moore . 2023-04-14
MORE AT Google
Traditional home cooked food, friendly staff, would recommend, unfortunately doesn't seem to have disabled toilets,
Robert THOMPSON . 2023-04-03
MORE AT Google
Great food and friendly service
Andrew Thomson . 2023-03-28
MORE AT Google
Food cooked to order mostly, assorted scones 😋
John Moore . 2023-03-28
MORE AT Google
Beautiful food. Excellent, friendly staff. Prompt service. Fantastic full English breakfast 👌
Owen Burgess . 2023-03-19
MORE AT Google
Welcomed by a friendly waitress who seated us immediately with menus and a smile and pointed us in the direction of the specials board. Great service, orders taken and teas delivered promptly. My partner and I admired the quaint decor and an old fashioned appeal of traditional cafes growing up. Quite enjoyed the food but was left with a bitter taste in my mouth as I ate and heard the lady cooking in the open kitchen section berate the young waitress who had been nothing but polite and hard working: the young girl showed a polite and welcoming personality, was eloquent in how she spoke to customers and cleaned tables, served food and responded to service professionally and quickly. Even in the midst of being shouted at by the cook she didn’t crumble despite catching my eyes and clearly noting embarrassment, knowing she was being watched. This girl was beyond tolerant of how she was spoken to: comments like come, get your head out your arse and where’s your head today were unfathomable to my partner and I as this young lady was working very hard. She is certainly developing rhino skin which will no doubt bode well for her in her future adulting career of choice but I was put off from returning to the cafe ever again because of the older lady cooking who absolutely should know better. I understand tight ships need to be run and if I’d witnessed any under performance I’d have kept quiet. Staying in Walwick for the night and I thought about this tenacious waitress over dinner and when I woke in the morning. I do hope she knows her worth and keeps her head held high.
msgd2023 . 2023-03-11
MORE AT TripAdvisor
We are fairly regular visitors to this cafe, food is always lovely but today when we visited the lady who cooks and I presume is the owner subjected numerous members of her staff to awful verbal abuse and using bad language, I don’t know if she realised how uncomfortable this was for the whole cafe and the customers exchanging looks with each other, I can only commend her staff as they have always provided friendly and efficient service to us and must have amazing self control as I would have told her exactly where to stick her job.
sue123reading . 2023-03-11
MORE AT TripAdvisor
After a lovely morning spent wandering around hexham. Called in here for a spot of lunch . We both had lamb dips . Absolutely beautiful 🤩. With a pot of tea . Cafe was busy , lovely friendly staff . We’re tempted to try one of there cakes , maybe next time .
305leannea . 2023-02-27
MORE AT TripAdvisor
Stumbled upon this cafe by accident with a hungry 6 year old, a baby and 4 adults. The staff saw us outside deciding whether to enter and they approached us to welcome us in. Food was lovely, reasonably priced. Best thing was the staff though, genuinely kind and friendly, we really enjoyed our visit, thank you! And the toasties were fab!
kso10 . 2023-02-25
MORE AT TripAdvisor
Delighted to find such a great place for lunch on our first visit to Hexham. Excellent home made food and friendly and efficient staff. Will definately be back
Rosalind Davies . 2023-01-28
MORE AT Google
Staff very welcoming and friendly, I had cauliflower and Stilton soup which was outstanding and hit the spot on a cold rainy day! All home cooked to a high standard, would highly recommend!
Adventure47488807365 . 2022-12-31
MORE AT TripAdvisor
We stopped here for breakfast not realising the cut off for this was 10:30. The chef forgave us for the 7 minutes were were late and rustled us up a sausage sandwich and a plate of ham and eggs. Both delightful - the home cooked...
christine c . 2022-12-09
MORE AT TripAdvisor
My wife and I visited here on Monday 31 October. Warm welcome on entering. Very friendly staff with great sense of humour. Great meal, both as regards quality and quantity
victoreV5862SF . 2022-11-16
MORE AT TripAdvisor
It was a rather dull wet day in Hexham and we were bedraggled then we noticed this welcoming eatery and on entering the drab day disappeared. We were looking for a light lunch I had a roast lamb sandwich and my partner a prawn salad...
Tony L . 2022-11-15
MORE AT TripAdvisor
Superb Sunday lunch! Friendly. Relaxed. Massive portions including 11 vegetables with the roast! Very good value
Robert B . 2022-09-25
MORE AT TripAdvisor
My wife and I were attracted to the Shire Gate Cafe by the specials board offering Lamb Chops. A friendly welcome the moment we walked in. I enjoyed an excellent meal of Lamp Chops, roast and mashed potatoes, plenty of fresh mixed veg and gravy,...
Terry F . 2022-09-17
MORE AT TripAdvisor
Popped in for a sandwich and a coffee.The staff were so welcoming as you enter.The sandwich was freshly made and was real thick ham .The salad with it was lovely and was well presented.To round the meal off we had lemon drizzle cake with cream.It...
mrsdRedcar . 2022-09-17
MORE AT TripAdvisor
Loved the food and the atmosphere. Great staff and the food was amazing too. I would recommend to anyone with or without a dog.
K9932MWmaried . 2022-08-06
MORE AT TripAdvisor
Called in here on a visit to Hexham for lunch with my wife. Great service, very friendly and we will definitely return. My wife said she had the best roast chicken dinner she had ever had, and I felt I had the best lasagne anywhere...
RichardE007 . 2022-08-03
MORE AT TripAdvisor
Stopped off at Hexham and found you as we wandered around. Great staff who were welcoming and very attentive. Lovely atmosphere. Order was taken quickly and the food came quickly. Delicious toasties had by both of us. And a toasted tea cake to finish. Thank...
Richard P . 2022-07-22
MORE AT TripAdvisor
Called in for breakfast on way to Hexham races, well it certainly didn’t disappoint, all freshly cooked and quality ingredients, huge portion it certainly kept us going all day, One of the best breakfast we have had in a cafe and reasonably priced too They...
Alipaulstaffs . 2022-06-13
MORE AT TripAdvisor
Lovely, friendly,helpful staff. Nice atmosphere. Fab toasted sandwiches, with tasty salad/dressing etc and good tea. They have an extensive menu... Something for everyone. Generous portions... In fact, we skipped dinner, as we were still nicely full. Highly recommend.
Sue M . 2022-05-26
MORE AT TripAdvisor
1st time visiting the Shire Gate Cafe for lunch in hexham The staff were warm and welcoming with a good selection on the menu from breakfasts to nice cakes We had the hot beef sandwich with chips and a jacket potato with tuna All were...
Richard-9373 . 2022-04-18
MORE AT TripAdvisor
Called in today initialy ordered two coffees, decided to order Tuna salad,and roast beef, sandwich,beef very nice,oven chips,nothing to write home about,my partner ordered tuna salad,she said it was ok but very small amount of tuna.Near end of salad and underneath, she found a hair....
G7273ROdavide . 2022-04-17
MORE AT TripAdvisor
I came to this cafe initially to have the 3 egg omelette but decided to have the roast dinner on the specials board which they must put together every day. It was exceptional - as was the gammon meal I had had there the previous...
Paul G . 2022-03-08
MORE AT TripAdvisor
Lunch was yummy, would return… staff were all friendly. Only slight negative was the only 1 highchair and someone was using it, so we juggled our 17 month old in between us, luckily she was well behaved and loved her lunch. Would love staff to...
Z5305IXkatel . 2022-01-09
MORE AT TripAdvisor
Sunday 21st November After a lovely walk around Hexham, my friend and I came across, this lovely little café. A welcome sight, rather than the repetitive corporate outlets one usually sees. We were welcomed by a lovely lady, promptly seated and order taken. Everywhere was...
595sandyb . 2021-11-21
MORE AT TripAdvisor
We had not booked but luckily got a table for 4 and had a superb lunch; excellent menu and goodly portions when the food arrived ensured that we all had a hearty lunch. The food was tasty with all salads being freshly prepared.
martinhH5865RD . 2021-11-07
MORE AT TripAdvisor
We arrived at the Shire Gate at around 1215 on a Saturday and managed to get one of the last tables! The staff were very friendly, helpful and chatty. The place was very clean and tables were sanitized between customers. The place was buzzing and...
Cliff J . 2021-11-07
MORE AT TripAdvisor
On our way home from a mini break we called into the Shire Gate.It was very welcoming and an added bonus as our dog was allowed in. The place was absolutely immaculate and the breakfast was off a high standard and very good value.We certainly...
snowflake53228 . 2021-10-22
MORE AT TripAdvisor
A friendly welcome e from the second we walked through the door. A bowl of water was available for our dog, and excellent home cooked food was beautifully presented. Pay them a visit, you won’t be disappointed.
Tracey S . 2021-09-22
MORE AT TripAdvisor
We stopped here for coffee and enjoyed it so much we went back for lunch. Staff were attentive and helpful. I enjoyed the Ham, Egg & Chips; the ham was excellent being thick cut and tasty. My wife had a lovely jacket potato with Tuna....
Goblinmad . 2021-09-19
MORE AT TripAdvisor
We stopped in Hexham on our way home from a weekend away, while travelling cross country to avoid the bank holiday traffic jams. How glad were we we stumbled upon the Shire Gate! Steak pie and chips…..amazing! Absolutely what we needed, delicious and home made....
Janeyb24 . 2021-08-30
MORE AT TripAdvisor
What a sandwich! Hot turkey, stuffing & gravy (with chips!!) Mmmmm! Lovely little cafe, great service, cakes looked v good too!!
shonah571 . 2021-08-05
MORE AT TripAdvisor
Popped in for our lunch. Busy but very friendly staff and well spaced tables. Lovely sandwiches and soup. Good prices.
sarahcK781SR . 2021-08-02
MORE AT TripAdvisor
delicious! have been several times and it just gets better. piping hot, veg perfectly cooked huge portion of beef and its so tender. mashed and roast potatoes, gravy lovely and a huge crispy proper yorkshire pud. the staff are all very friendly and nothing is...
ann a . 2021-07-25
MORE AT TripAdvisor
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in North East
171 Opinions
Tried this pub/restaurant with friends on our fortnightly trip out. The reviews on meals seemed promising.There was no parking. The back ground music was annoying.felt it was more of drinking sports w
meatvegetablescakeoldbaconcookedeggpiehamsandwichlady