GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 333 opinions finded in 1 websites

site_photo4

Nº 99 in 483 in Charnwood

Nº 8 of 36 Indian in Charnwood

CUSTOMERS TALK ABOUT DISHES WITH..curryonionchillicookedgarliclambspicyfriedricemeatprawnchicken
Score
OpinionsNoteTripAdvisor3334.5

comment_iconOpinions

My boyfriend and I have been visiting Ryan’s quite a lot over the last year and last night we went with his family. Without fault, every time we go to Ryan’s we are met with friendliness and incredible hospitality combined with the most amazing Indian food. The food is always delicious and my favourite Indian restaurant by a mile. I couldn’t recommend Ryan’s enough and we will miss it so much now we have both graduated!

site_logo

Lily-Rose F . 2024-07-17

MORE AT TripAdvisor

Delicious curry and sides! Best curry I've had in Loughborough. Thanks for the free side to! Really friendly customer service and we will be back!

site_logo

Charlotte R . 2024-06-29

MORE AT TripAdvisor

Ryan’s is amazing they went the extra mile to celebrate our engagement alway amazing food friendly staff and in 4 years never been disappointed best Indian restaurant for miles around truly awesome

site_logo

Jon R . 2024-04-20

MORE AT TripAdvisor

We have been here many times, meeting up with friends at least once per month. The food is consistently of a high quality: we have never had an "off" night. The staff are welcoming and attentive, without being overly invasive. It's a real treat to visit and eat here.

site_logo

NorthStar40771657484 . 2024-03-21

MORE AT TripAdvisor

Walked in we hadn't booked a table . Got a table straight away. Staff absolutely perfect so polite and friendly. No rush .no pressure .food amazing absolutely beautiful. Highly recommend. Prices very reasonable

site_logo

Estelle P . 2024-03-10

MORE AT TripAdvisor

Ordered a meal tonight at 5 came at half 5 it was awful worst one I’ve had from Ryan’s ordered honey chicken it was mostly onions about 6 bits of very thin sliced chicken which was from a packet it was very dry and as for the sauce don’t know we’re that was it was horrible and very dry and tasted very peppery my husband had the chefs special tandoori mixed grill awful one chicken leg one piece of tandoori chicken and a small kofte with bhuna sauce to tip over the top no taste in the sauce whats so ever dont think we will be ordering from here in a hurry again

site_logo

603masonb . 2020-12-18

MORE AT TripAdvisor

Tried Ryan's for the first time last weekend. Food was delivered in the expected timescale. Ordered three mains, Korma, Dhansak and Pathia and all were excellent. Will be using again.

site_logo

Andrew P . 2020-11-10

MORE AT TripAdvisor

We have been several times as a family to Ryan’s and have never had a bad meal. Lovely food and excellent service.

site_logo

ChristinaHorsley . 2020-10-15

MORE AT TripAdvisor

Had a takeaway on Friday 9th Oct. Disappointed, very disappointed. Delivery took almost 1.5 hours and was cold when arrived. It was also salty and overall very poor with little flavour. Complained to the owner Sami on Friday as I know him a little...and finally got a reply on Monday ( 4 days later?) and after loads of excuses about how busy they were?...offering me £10 off my next purchase!!!..WOW is that really what you call acceptable?...The meal it cost me £28 and went in the bin. I didn't accept the offer of £10 as quite insulted, so instead I find myself writing you a poor review...Sami - Your standards have dropped massively, since lockdown, we've eaten in the restaurant too 6 weeks ago and it was also average at best but dent complain as thought it was a blip and gave you the benefit of the doubt? I've been a customer since you opened this restaurant but if this is the best you can do, then I won't be having a takeaway or a meal here again and I suggest others think twice

site_logo

sisuperfox . 2020-10-13

MORE AT TripAdvisor

Absolutely amazing food. One of the best curry’s I have every had! (And I have had quite a few cause it’s my fav)

site_logo

573tobya . 2020-09-16

MORE AT TripAdvisor

Hatzz Off to Chef THE FOOD IS Exellent Keep It UpAdvantage Of Restaurant ::If you are dining in I would recommend the restaurant because food is tasty and You have made the right choice and came to the right place in Loughbrough BUTDisadvantage of Restaurant::I don’t recommend the restaurant if ordering through Uber Eats , Deliveroo etc . I have phoned the restaurant 3 times all the time the same person attending call and saying Your food will arrive after 15 minutes. Even the person who attended the call had no idea when the delivery driver arrives to pick up delivery food for next customer. Took way too long.I believe the management will look into this matter deeply and give a good buildup for the Online Delivery Order s. Thank You By a Sincere Customer

site_logo

Boneymezone . 2020-09-13

MORE AT TripAdvisor

We love Ryans. EXCELLENT SERVICE. Quality food. With a good mix of traditional Indian Cuisine to the English style food like chicken tikka Masala. Everything a family of differing tastes could want. The ambience is lovely the toilets are clean and comfortable. All hygiene and COVID-19 rules are followed Cannot recommend high enough.

site_logo

mariamE5140JG . 2020-08-27

MORE AT TripAdvisor

Just had the best meal at Ryan’s. The food from start to finish was lovely and tasted really fresh. The staff were really polite, even at the end of the meal we were asked our opinion and where they could improve. Well done Ryan’s

site_logo

846clairef . 2020-08-26

MORE AT TripAdvisor

Poor excuse for indian food!The service here although friendly is extremely slow part of my order was missed twice..The starters are nicely cooked and tasted fair.The mains were all poor and the Curries are either all loaded with sugar or heavily loaded with food colouring.. taste wise there is none at all. The meat in the dishes tasted like it’s been cooked and reheated in the sauce which isn’t what Indian cooking should be like. I wouldn’t recommend

site_logo

Foodiderby . 2020-08-18

MORE AT TripAdvisor

I never usually write reviews but figured I would for this restaurant seeing as it’s always very pleasant eating in at Ryan’s. (I’ve also had takeaways from them with no issues) they get swamped with customers and it’s always busy, I see why! The food is great and always on time and piping hot when it arrives to the table. The workers and boss are also very friendly, they cannot be faulted. I’ve seen many regulars who always continue to come back for the great food and hospitality. Me and my husband are also regulars and never have any issues eating in. Being an Asian myself and eating curries at restaurants don’t always feel “authentic” it most definitely does at Ryan’s. I also give my 1 year old daughter naan bread whilst she’s sitting with us and she absolutely loves it, it’s never undercooked or overcooked. Their food is made to perfection every time!

site_logo

YasmynHussain . 2020-08-07

MORE AT TripAdvisor

Very good food and service even in these difficult times never had a bad meal and we use these every weekend

site_logo

aph185 . 2020-07-31

MORE AT TripAdvisor

We Had a lovely time !! And we was treated with a lot of respect !! The food is Great !! And the service is always excellent !! We are looking forward to eating there again !!

site_logo

russellr654 . 2020-07-30

MORE AT TripAdvisor

This was the first time we’d eaten out since lockdown and despite the difficulties the staff are having to endure we were treated with utmost care.The food was first class as always and they couldn’t do enough for us.Please, support your local restaurant, as we don’t want to lose.Thanks Sami for a gorgeous evening.

site_logo

loonydoonie56 . 2020-07-28

MORE AT TripAdvisor

We order a few weeks ago and was disappointed with the service. It was almost 2 hours late after ringing to find out what was going on (they should also mute the call when they are shouting at staff as I could hear all of the drama, but awkward). The food was okay, but not amazing and by this point we were past the point of hungry. We've since tried others Indian restaurants in the area and had much better service.

site_logo

mselliemarie . 2020-07-15

MORE AT TripAdvisor

Fabulous takeaway food this evening ordered the Chicken Horiana which had some very nice spices plus onion,peppers and tomato without being too hot highly recommend.Many thanks Ryans

site_logo

davidcI4464AO . 2020-06-26

MORE AT TripAdvisor

Thank you Ryan’s for a fab takeaway, very enjoyable and delivery was on time . Great service 👌😀looking forward to visiting the restaurant soon.

site_logo

D8868VFjayneh . 2020-06-20

MORE AT TripAdvisor

In these sad times we decided to have a takeaway from Ryan’s and we weren’t disappointed great food with lovely taste loads to eat for the 3 of us. It also arrived 30 minutes early on a Saturday night.

site_logo

Katie J . 2020-05-03

MORE AT TripAdvisor

Ordered and took nearly two hours to get to us. Some of order missing (Naan) Onion bhagi soggy and dripping in grease, Naan bread that did arrive was undercooked, chicken tikka masala tasteless and husbands butter chicken bland. All in all really disappointing- won’t be back or recommending

site_logo

U892WOlouiseb . 2020-04-18

MORE AT TripAdvisor

We entered the place to find that we were almost the only people in there. We were ushered past tables still splattered with food, and crammed into a corner. I noticed almost immediately that my knife was dirty, and told the man he could take it away. He did, but never brought a replacement (there were 5, rather than 6 of us, so I used the spare). The service was casually indifferent, and the food adequate at best. Mine was actually very hot, which it hadn't said on the menu. The dal was very poor. They couldn't do a lassi (for a guy who was driving). It is not exactly difficult!

site_logo

876dylanb . 2020-02-20

MORE AT TripAdvisor

1st visit on Valentines Night. Lovely lady greeted us and had a great fairly priced Curry. Cobra on tap ! Good menu choice will definately revisit .

site_logo

Jimdraper . 2020-02-14

MORE AT TripAdvisor

After a film, Ryan's was the perfect place to enjoy a relaxed curry. It was easy to book a table and as soon as we arrived we where well looked after. The food was excellent and it was refreshing to find unique or unusual dishes on the menu.At the end of the meal, we were asked if there was anything they could do to improve their service. It was a genuine enquire.

site_logo

391darcym . 2020-01-18

MORE AT TripAdvisor

My second visit with 10 of my friends for Christmas dinner in Ryan’s. every thing was as good as my first visit. Staffs are really really friendly. Recommended to everyone.

site_logo

vijay P . 2019-12-29

MORE AT TripAdvisor

Visited Ryan's this evening and I would like to state first that the service was very good, but unfortunately the food did lack in taste and quantity, I'm not going to run the place down because the waiting staff were really good. In my opinion there are better places to try Indian cuisine not to far from Ryan's but thought we would try somewhere different, but some times it's best to stick to what you know, disappointed to say the least.

site_logo

Forest1972 . 2019-12-28

MORE AT TripAdvisor

visited last friday afternoon as part of works xmas meal. the service was good and the food excellent well worth trying out

site_logo

tonywhit1957 . 2019-12-11

MORE AT TripAdvisor

Now our fav Indian in Loughborough! Fab food , fab service, great takeaway service too! Thank you Ryan’s 🤩

site_logo

JUDEROADLEY . 2019-12-08

MORE AT TripAdvisor

Staff were friendly and welcoming. Food was excellent. All facilities were clean and tidy. Staff were extremely apologetic believing the service was slower than usual but it seemed fine to us! Good value for money. Would definitely recommend.

site_logo

Rachel A . 2019-11-25

MORE AT TripAdvisor

Best Indian in Loughborough. As an Indian I have to admit Ryan’s exceeded my expectation about the quality Of food I had been served. Recommend to any one .

site_logo

vijay P . 2019-11-19

MORE AT TripAdvisor

Ryans make delicious curries and their starters are hit. The staff are very friendly and helpful. Also, they give a 10% discount on collection.

site_logo

Naaz1364 . 2019-11-15

MORE AT TripAdvisor

We had a table booked for 4 adults and one child. The restaurant was clean and modern, the staff were very attentive All the food we ordered was tasty and plentiful. I have no doubt in recommending this restaurant to anyone. Furthermore the staff were so kind when serving Tyler ( aged 7) and treated him like the special little person he is Well done to all the staff at Ryan’s.

site_logo

832janeto . 2019-11-15

MORE AT TripAdvisor

Excellent. Could not fault a thing (and I’m known to be a bit picky!) Staff were friendly and happy to give recommendations if needed, service could not be faulted and food simply excellent. Our table was tidied and crumbs removed after every course and everything was just perfect. I was visiting with my son who is at university so we are sure to visit again. My only regret is that you aren’t in my home town! Thanks for a lovely evening and a great meal.

site_logo

HomeForTea . 2019-10-27

MORE AT TripAdvisor

Just had to share this review after experiencing the food here.Was craving for vindaloo late night after a good workout so decided on a Saturday night takeout and on previous orders elsewhere its hit or miss when you order it the food comes hot and the nan inside the foil packet comes all soft and mouldy but I would like to say this has had to be a 5 star ⭐️ a rare score from me The food was not only hot but full of flavour and the nan breads were all fresh as you’d expect when dining in side the restaurant The owner was friendly and his restaurant was clean and modern Well done I’d recommend the food and restaurant to my friends and may book our work Xmas party here

site_logo

Khan129 . 2019-10-12

MORE AT TripAdvisor

Loughborough is a new town for me and I wasn't sure where to go for a family meal. I had a look around and decided to go for an Indian meal. I ended up settling for Ryan's. The food was excellent. The owner Mr Shamim was very friendly and professional. Excellent food presentation and the quantity was more than enough for us. Needless to say the food tasted very good .We were delighted with the service . The restaurant itself is very modern and I would highly recommend Ryan's if you like Indian food. I will definitely look forward to having a meal again at Ryan's. In my opinion it is one of the few excellent restaurants in Loughborough.

site_logo

Shohied . 2019-09-30

MORE AT TripAdvisor

Possibly the best Indian takeaways we have had, food always cooked perfectly. The service is always spot on as well

site_logo

skybluestinky . 2019-09-16

MORE AT TripAdvisor

I work away from home a lot, and don't particularly enjoy eating alone. Last week I fancied an Indian meal, and after the first place I tried was full (on a Tuesday!) I found my way here.What a happy chance! The food, staff and environment were all excellent, and the Prawn Puri (one of my favourite starters) was probably the best I've had.So much so that I'm sitting in Ryan's again, one week on, typing this review....The only downside is that they stock no beers, only a variety of interchangeable lagers. But that won't stop me coming back here. Probably next week.....

site_logo

Yorkshrman . 2019-08-13

MORE AT TripAdvisor

My husband’s daughter and her family were visiting from the States in June. Brought them to this restaurant as the food is alwa1ys spectacular. Son-in-law has travelled all over the world and eaten Indian food many, many times. After his meal he said that this was the best indian he had ever eaten. What praise. The atmosphere is very cheerful. The decor is really clean and modern. The members of staff can’t do enough for you and want only to make your visit memorable, they certainly do that. When, sadly, the time comes to leave you are made to feel like dear friends.Had a takeaway delivered to us recently. Perfect! Hot and so delicious. As good as in the restaurant.When can I go next please?

site_logo

loonydoonie56 . 2019-08-12

MORE AT TripAdvisor

Went for my son's birthday. Well the food was amazing, so so good. Service great, nothing any trouble. Thoroughly enjoyable evening. And stuffed so bonus!

site_logo

Torick68 . 2019-08-10

MORE AT TripAdvisor

Customer service was the best I have ever seen. Went with some friends from Uni and ended up not being able to eat all the food I ordered so they packaged it up for me. But like a numpty I forgot the food when leaving! I phoned the restaurant a few hours later when I got back to my flat and they offered to drop it off to me free of charge!! All the waiters were lovely and the fact that they dropped off my food was just surprisingly lovely! I even offered money feeling bad that they had to come out of their way to drop it off but they wouldn't take it and so I just had to write a review! I also require gluten free which most indian restaurants will cater for and I'm so glad Ryan's did! Great food! Great service!

site_logo

Kavitap760 . 2019-08-06

MORE AT TripAdvisor

Outstanding service and food. The waiters were very attentive and generous. They offered a brilliant deal for all of us! The food arrived quickly. I will definitely be visiting this restaurant.

site_logo

miacaps . 2019-07-04

MORE AT TripAdvisor

Amazing food. The taste was spot on and the meat was cooked to perfection. The staff also were so friendly and made the evening for us. Especially the lady who was serving us. Definitely recommend!! Thank you xx

site_logo

jhanr24 . 2019-06-24

MORE AT TripAdvisor

Easily the best Indian restaurant in Loughborough. Always excellent service and food. If you like a hotter curry, would strongly recommend the Goan King Prawn Jalfrezi or Garlic Chilli Chicken.

site_logo

anthonytR6789AV . 2019-06-16

MORE AT TripAdvisor

My partner and I had a nice dinner there and the staff were lovely, very helpful and Looking forward to another chance to visit.

site_logo

harris1990 . 2019-06-06

MORE AT TripAdvisor

We've never eaten in this restaurant but we have had takeaway food on several occasions and every time the food has arrived on time and has always been piping hot.Another plus is the fact that from other Indian restaurants, when it is takeaway food, it usually seems to be very oily but from Ryans there is never any of this residue.

site_logo

Peter M . 2019-06-04

MORE AT TripAdvisor

Came up to Loughborough to visit our son and, after a couple of drinks, wanted some food and saw we were opposite an Indian restaurant . They found us a table and we had a fantastic meal. Every dish was delicious and, as it was our son’s birthday, he got a complementary Baileys. Will come back again when in Loughborough.

site_logo

SurreyStargirl . 2019-05-20

MORE AT TripAdvisor

I've been to Ryan's for my son's birthday meal and he visits quite often with friends. Service was prompt and friendly and the food was excellent. I'll definitely visit again.

site_logo

skent12018 . 2019-04-07

MORE AT TripAdvisor

When ever in a town or city away from home you try and find an Indian restaurant “like you have at home” so that you feel comfortable and enjoy itI have eaten at this restaurant 4 times and it’s consistently good food with welcoming service Would recommend!

site_logo

BrownMildLad . 2019-03-19

MORE AT TripAdvisor

Let me just say, this restaurant is by far the best Indian I have actually personally been to. Me and my partner went out after a trip to the cinema across the road. One of the managers greeted us, showed us to the table, pulled our seats out and placed the napkins on our laps. If this doesn’t show firstly how brilliant this service is, I don’t know what will! The meals were just 10/10 - service was fast and pipping hot. They checked up on us to see if everything was ok (which it was of course.) Drinks came promptly just to add.Bill came quickly after we asked but not as in they wanted us to leave. Service was so exceptional that they opened the door for us as we left.All these comments below, please just ignore. There’s nothing wrong with the meals, there’s nothing wrong with the decor... and there’s nothing wrong with the staff.If you’re looking for a nice meal out, then this is the place to go.

site_logo

Kate_Reffin . 2019-03-12

MORE AT TripAdvisor

The service at Ryan's was great. They were very busy and as it transpired they were one waiter down front of house so there were some delays but this did not effect our meal experience (and can't punish the restaurant for staff being off). The meal itself was superb. Hope to return.

site_logo

hemsd2019 . 2019-02-24

MORE AT TripAdvisor

There seems to be a 3 part cycle to Indian restaurants. Brilliant when they first open, a slow slide into mediocrity and finally, profit taking/cost cutting.Ryan’s has a good start up and I wanted to sample it.Events conspired to prevent me visiting until this month. I really wanted it to be good as most established Indian restaurants in Loughborough are either mid cycle or final stage.The decor is modern and inviting. The location is good. The menu reads well and presentation is good. Staff were attentive without being intrusive.However something isn’t quite right. The pickle selection accompanying the papadoms was colourful but bland, hard to detect flavours.The chef special starter again looked good but the preponderance of onion segments in a red sauce was more a “plate filler” and didn’t taste or feel authentic.The South Indian chicken curry, which I was warned would be hot, disappointed. Yes there was heat from the green chillies but the curry sauce binding the chicken and chillies was bland. I couldn’t pick out what spices had been used. It didn’t revive memories of other South Indian meals. Part of me wondered whether the missing “umph ” was a lack of salt? (Healthy but bland consequences)The rice however was nice, thick and fluffy but the naan could have done longer in the tandoor.I had Cobra to drink, was ok but I think some refresher training on pipe cleaning would have made it sparkle more!Sadly Ryan’s didn’t meet my hopes for a regular Indian eaterie. I will however give them another try next time I’m around.

site_logo

DoowyehB . 2019-02-13

MORE AT TripAdvisor

Took my Mrs out for our anniversary. Never had an issue with service, come here often and always leave happy. Staff are fantastic, Cant wait to go back

site_logo

harris1990 . 2019-02-11

MORE AT TripAdvisor

Had a takeaway from here which was ordered online, no added delivery charge. Arrived before stated time and driver was very pleasant. Starters was delightful and a good portion size. Mains was also very good, good quality meat used (unlike some others...) good flavours very happy all round and will definitely recommend.

site_logo

Rob H . 2019-01-15

MORE AT TripAdvisor

SIx of us had our annual New Year's eve meal at Ryan's. We were not disappointed even though the restaurant was very full (we had booked in advance) This shows the popularity of Ryan's and it is our favourite Indian Restaurant in Loughborough at present. Cost including drinks was £25 per person which was very acceptable considering the amount of food that we had !

site_logo

Maxjonz . 2019-01-11

MORE AT TripAdvisor

Dining in the restaurant is a good experience but forget about ordering a takeaway! Our 1st takeaway turned up 45 minutes after the stated delivery time .. with no communication from the restaurant ... and now, on NYEs, it has been over an hour with no takeaway ... being late on an evening like tonight can be expected because they can be busy however simply communication from the restaurant regarding our order would be appreciated! The phone is engaged with no email received from Ryans! JustEat have been a much better source of support!

site_logo

Jessica H . 2018-12-31

MORE AT TripAdvisor

Well this place was a pleasent surprise. When on business sometimes you just want something quick and tasty and basically go to the nearest place that looks clean. This was the case on a Monday night in Loughborough. But this little restaurant was a wonderful surprise. Three of us had drinks starters and mains with a couple of breads for about £25 each and it was amazing.The staff were also really friendly and welcoming. Highly recommended.

site_logo

mikegC2130JC . 2018-12-03

MORE AT TripAdvisor

One of the best Indian restaurants I've had with really friendly staff. I go here fairly regularly. My mum didn't eat Indian food she went to Ryan's, now whenever she had it she always ends up going "hmm, it's nice... but not as nice as Ryan's". I feel that speaks for itself.

site_logo

Simmous . 2018-11-06

MORE AT TripAdvisor

There are plenty of curry restaurants in Loughborough and this one is well worth a try. Staff are helpful and friendly, and there is a good atmosphere. Plenty of choice at reasonable prices, and the food is excellent.

site_logo

LCFC1974 . 2018-11-03

MORE AT TripAdvisor

Soon as we walked in we was made very welcome left the order with the waiter and he delivered fantastic food and service all night 10/10 we will be back thanks again

site_logo

DolphinDJG . 2018-11-02

MORE AT TripAdvisor

The food here was faultless. Absolutely delicious, not too spicy & very well cooked. The prices were very reasonable too. The service was great as well. Very attentive & quick. Will definitely recommend & will be returning

site_logo

darrenhepworth . 2018-10-27

MORE AT TripAdvisor

We usually have Ryan’s for takeaway, but decided to pop here after the cinema. Food was plentiful, hot and professionally served. Particularly enjoyed the honey chicken and chicken dansak. Restaurant was able to accommodate our requests to not include coriander in main courses and starter. Excellent experience. Service was attentive without being over the top - got a real sense of pride in the food they served.

site_logo

graemes76 . 2018-10-21

MORE AT TripAdvisor

Popped in for a quick meal before the cinema. Staff were very friendly and efficient. Food was served quickly, even though the restaurant was rapidly filling up . Our food was fresh, full of flavour and had plenty of succulent meal. Would definitely recommend Ryans!

site_logo

charnysaz . 2018-10-06

MORE AT TripAdvisor

The food here is absolutely amazing! The staff are so kind! Overall its a 12/10. Being to other Indian restaurant nothing beats this restaurant. I do recommend the lamb maxhani curry, really nice and sweet and the lamb is so tender.

site_logo

ellak657 . 2018-10-06

MORE AT TripAdvisor

Hands down the best Indian in the Loughborough area. Staff are incredibly welcoming and the food is so good and extremely reasonably priced. Wouldn’t hesitate in recommending Ryan’s to anyone. Eating in or delivery they are the go to Indian!

site_logo

KrystianMoson . 2018-10-06

MORE AT TripAdvisor

Visited for first time tonight, what a find. We were shown to our table and offered drinks - the menus came and we ordered. Everything was superb - from start to finish, the staff were very kind and could not do enough- they even asked if they could improve in anyway!!!! Perfection

site_logo

Elsupremowow . 2018-09-22

MORE AT TripAdvisor

Our favourite restaurant by some considerable distance! The food is excellent and cooked exactly how you require it. The service is superb and the attention to detail shown by Sami and his staff is amazing. Five stars in not enough for Ryan's!!!

site_logo

keithewilson594 . 2018-09-15

MORE AT TripAdvisor

My partner and I visited Ryan’s after the cinema and although we arrived at 10.30pm the waiters and waitresses were really accommodating. The food was perfect too and great portion sizes

site_logo

jdavis1990 . 2018-09-01

MORE AT TripAdvisor

Went for a quick bite to eat after a few drinks and wow the food was absolutely amazing. Thoroughly enjoyed easily the best curry I have had in Loughborough by some way. Fine dining curry at good prices!

site_logo

lindahulley66 . 2018-08-29

MORE AT TripAdvisor

Very clean and fresh feeling restaurant, service was good with friendly staff. Food was very good. Will go again.

site_logo

Adam N . 2018-08-24

MORE AT TripAdvisor

The food was OK , nothing special to be honest. The disappointing thing is that we had requested a change to one of the dishes , but this was completely ignored. Will not be using them again.

site_logo

mccorkt . 2018-08-11

MORE AT TripAdvisor

Had the 4 course menu for £13.... excellent value for money ..portions are plentiful, staff very nice and helpful...reasonable priced drinks...all had a great mea andl very filling.. top marks

site_logo

I7875IAsusanf . 2018-08-08

MORE AT TripAdvisor

Very pleasant restaurant, clean and well organised. Staff very friendly and attentive. Food was very good indeed. We will definitely be visiting again!

site_logo

andy998 . 2018-08-01

MORE AT TripAdvisor

We had a lovely meal here for our anniversary. For starters we both had a popadom each; I had an onion bahji dish, there were two on the plate, medium size and well fried with a side of salad, nicely presented and my boyfriend had the Samosa dish where there was also two and a side of salad. They were well priced too. For the main, we had a chicken tikka masala each with pilau rice. The rice wasn't overly hot when served and the masala was nice but it wasn't as thick as we would have liked it, it was quite tomatoey but that is down to personal preference. We prefer a thicker, richer sauce. We also ordered a side of Saag Aloo which was one of the best I've tasted in a while. We also ended up with a Gobi Saag which we didn't order but didn't have the heart to say this when they served it up as the staff were lovely. Both side dishes were tasty and with two lemonades and a water the bill came to just over £30.

site_logo

WispyFairyWings . 2018-07-22

MORE AT TripAdvisor

Absolutely brill food and service. So friendly. Reasonably priced. You get what you pay for and extras.

site_logo

Julie B . 2018-07-09

MORE AT TripAdvisor

Service is very professional helpful and friendly. The elderly waiter is very courteous. The food is delicious although portions at other restaurants can be more generous. The restaurant is very clean and smart and it’s well located opposite the new cinema complex.

site_logo

tomp164 . 2018-07-09

MORE AT TripAdvisor

We regularly eat at Ryan's every Saturday and it has been the best food experience I've ever eaten. We receive discounts from the owner who works very hard to ensure that everyone eats happy. Thank you!

site_logo

mjordan0305 . 2018-07-08

MORE AT TripAdvisor

Went here with friends. 3 really good meals but the other was just ‘ok’ as it was very dry with no sauce. Nice offer of a little after dinner aperitif and staff were friendly

site_logo

Simo117 . 2018-07-06

MORE AT TripAdvisor

We eat here more than regularly...like 4 times a week!!!The owner Sam, is very welcoming and the staff are all fantastic! The chef and some of the staff were hired after our previous favourite “Out of India” was taken over after Mr Ali retired....hence, the food is still the best indian food you will buy in Loughborough or surrounding areas!! We have our own “usual” table and no longer have to order as they know our order off by heart Do yourself a favour and pay them a visit Free complimentary liquors at the end of the night. Tell ‘em Mike sent you!!

site_logo

MikeKerrieO . 2018-06-18

MORE AT TripAdvisor

2 words top notch 5 in our group we all totally loved the attention of the caring staff not to mention the absolutely fantastic, well presented food 5 star

site_logo

louis34 . 2018-06-08

MORE AT TripAdvisor

I ordreered the nan bred wiv chikkin teeker and it woz spicy it comed wit free poppaloppadum wich woz cruncheer than I visit sune agen gud kwallitty foode

site_logo

Sheila M . 2018-06-04

MORE AT TripAdvisor

Another good evening out food is very tasty, staff are very polite, nothing is too much trouble if you have a problem with the food they will sort it also if you tell them the food you like they will recommend curries. Alway helpful. We have been many times would recommend to anyone.

site_logo

Tracy L . 2018-05-31

MORE AT TripAdvisor

was in Loughborough on business and popped in to Ryans for a meal. shish kebab starter followed by Goan king prawn jalfrezi. both absolutely delicious.enjoyed the meal so much that i ate there again the next night. chili chicken starter and then the mixed grill curry. again, delicious.think the king prawn jalfrezi was my favourite main course. but it was not easy to make this decision. struggled more with the 2 starters. enjoyed them both equally and cannot come up with a winner.place is clean and well presented and the staff were fantastic.would definitely eat there again..........again!!

site_logo

Dave G . 2018-05-24

MORE AT TripAdvisor

Had a take away following rave reviews by the wife 2 days previously My food was edible, however it wasn’t anything special, my chicken tikka madras wasn’t spicy it was was basically chicken tikka in a tomato sauce I was very disappointed My wife food was very nice but mine was mediocre at bestSorry to say the take away was disappointing and we won’t be ordering again, we may try eating in

site_logo

keefb2001 . 2018-05-01

MORE AT TripAdvisor

After a strenuous badminton match what could be better - a tantalisingly tasty curry with a glass or two for accompaniment. The food here is always of high quality, freshly prepared and the staff are so welcoming. Owner Sam always makes a fuss of us and answers any questions we may have about the ever developing menu. I have been here over 10 times and would overwhelmingly recommend you try it too!

site_logo

John S . 2018-04-28

MORE AT TripAdvisor

First time eating here and was not disappointed. Really good choice, all your usuals but some great chef specials and recommendations. Will be back.

site_logo

tazb . 2018-04-23

MORE AT TripAdvisor

We have been to Ryan's for "date night", a family meal and for take aways.Staff are very friendly, attentive and happy to accommodate any specific requirements. Food is served quickly and well presented.We have tried new dishes and have not been disappointed! Dishes are full of flavour and the portions of meat and more than generous! When eating in, staff were happy to box up our left overs to take home!Would definitely recommend Ryan's!

site_logo

charnysaz . 2018-04-02

MORE AT TripAdvisor

Very nice Indian but may not be the best for special orders...e.g. small potatoes etc. Very nice chicken tikka masala though!!! Defiantly recommend to the non-fussy eaters

site_logo

lottiejai . 2018-04-02

MORE AT TripAdvisor

This is the best curry takeaway by far. Real big king prawns. The restaurant was busy too. And lots of deliveries going out too.

site_logo

Jon P . 2018-03-24

MORE AT TripAdvisor

Good food, although the bill took ages to come! Not recommended if movie starts straight after your dinner. My date wasn’t that bad though.

site_logo

G6437EAseanm . 2018-03-24

MORE AT TripAdvisor

I recently went with a big group and we had pre-ordered our mains. The food was really lovely, everyone enjoyed it and the service was excellent. We were so well looked after, even though we were a big group of 25. Really recommend.

site_logo

BarrowClare . 2018-03-18

MORE AT TripAdvisor

Recommend by a taxi driver we where not disappointed! Didn’t have a bad dish and my main and naan bread was fantastic, and loved choice the menu too! The staff where so friendly and looked after us well. The only annoyance was it took two years to eat here as we tried closer Indian restaurants first. We will be back!!

site_logo

G1479AOashleyb . 2018-03-11

MORE AT TripAdvisor

I've sat in and had a few different curries with friends here and have never been disappointed. The curries always taste fresh and the sides (I usually have peshwari naan) tasty as well.Staff are also nice and friendly.Takeaways are every bit as good and while they can take a little while to deliver (about an hour), the wait is every bit worth it.Would recommend to anyone who loves a curry!

site_logo

nessasmithuk . 2018-03-03

MORE AT TripAdvisor

After finally trying a fish curry I was definitely not disappointed! My mother also found her curry very nice, and the service was excellent (even though they seemed very concerned it would be too spicy! )

site_logo

EmSwan1306 . 2018-02-15

MORE AT TripAdvisor

Had another fabulous meal at Ryans last night, if we go in a group, with the family or just my husband and I it is always fantastic service, the owner always comes to the table to check that you are happy with everything. The food is fantastic, with a level of spice that you don't always find in Indian food. It is very well priced for the quality of food

site_logo

Badbadgerlhw2013 . 2018-02-07

MORE AT TripAdvisor

Visited Ryan’s for a return visit to celebrate a 30th birthday. Table of 16 of us. Food was its usual excellent standard, all brought in good time. Service was excellent & would recommend Ryan’s to anyone. Thanks for a great evening

site_logo

DocColgate732 . 2018-02-04

MORE AT TripAdvisor

Been here lots of times and the staff and food are fantastic!! Top quality restaurant, easily the best in the area!! Sam the owner, really goes out of his way to make your visit as enjoyable as possible. All of the staff are super friendly and this is now our regular treat!! ⭐️⭐️⭐️⭐️⭐️

site_logo

MikeKerrieO . 2018-02-02

MORE AT TripAdvisor

This place can’t be bettered, you won’t find a better Indian! We all ordered different dishes and they were all delicious and totally individual in taste, the Bombay Aloo was the best I’ve ever had!

site_logo

Gary M . 2018-01-22

MORE AT TripAdvisor

Always helpful with superbly cooked food. As the menu is very extensive Ryan's will be very happy to offer you some suggestions

site_logo

Billyplanb . 2018-01-05

MORE AT TripAdvisor

Similary restaurants in East Midlands

restaurant_img
4.5

171 Opinions

location-icon10 Leicester Road
Indian
outdoor_seating_79174takeaway_79174delivery_79174

Went here on Saturday night …food is great the service was dreadful…I think they were understaffed or maybe too busy, went with family for first time so really disappointed

restaurant_img
4.5

1132 Opinions

location-icon9 Leicester Road
Indian
outdoor_seating_183943takeaway_183943delivery_183943

Excellent food Excellent service Excellent hospitality Best Indian restaurant Highly recommend

restaurant_img
4.6

243 Opinions

location-icon1770 Melton Road
Indian
outdoor_seating_79050takeaway_79050delivery_79050

Food was great as we tryed the place after a long time and service was good but the place was cold inside but overall great , needs more iteams on the menu frm the original 3 klims

restaurant_img
4.4

690 Opinions

location-icon17 Loughborough Road
Indian
outdoor_seating_163973takeaway_163973delivery_163973

Chicken tikka masala bland chicken not marinated sauce runny and tasteless more like a shop brought cook in sauce .. very little chicken ! Nan bread was soggy and under cooked wife's meal was OK but very little lamb for the price !! Many better places

restaurant_img
4.3

1284 Opinions

location-icon35, Bridge St
Indian
outdoor_seating_178601takeaway_178601delivery_178601

Was beautiful food very hot and fresh and good value driver very friendly