GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.9

Based on 605 opinions finded in 2 websites

site_photo4

Nº 914 in 1517 in Southwark

Nº 63 of 89 Italian in Southwark

CUSTOMERS TALK ABOUT DISHES WITH..mustfishcookedspaghettitiramisugarlicpastapizzarisottocarbonarachickensaladcheeseprawnscreampay

comment_iconOpinions

As soon as I entered Ristorante Olivelli, the cosy and welcoming atmosphere set in motion a delightful eating experience. The comfortable lighting, elegant furnishings, and laid-back vibe made it the ideal place to eat With its abundant toppings, flawlessly crisp dough, and a deep sauce that brought everything together, the pizza was simply amazing. Good ingredients and attention to detail were evident in every bite. A particular thank you to Chef, whose talent and enthusiasm were shown in each dish. The food was done with a great deal of care, and it made the meal unforgettable.

site_logo

Sujata Rai . 2025-05-14

MORE AT Google

Friendly, freshly cooked delicious neighbourhood restaurant.... Excellent

site_logo

Adam Woods . 2025-05-09

MORE AT Google

What an amazing time we had, the food was delicious and felt like a taste of Italy 🇮🇹

site_logo

David Datt (Real Hoxton Chef) . 2025-04-13

MORE AT Google

We had a fabulous dinner here today. Lovely tasty authentic Italian dishes and amazing service. Thanks!

site_logo

Becca Teers MindPlus . 2025-04-13

MORE AT Google

Came here for my wife’s birthday meal. I had the scoglio and it was excellent. My wife had the Granchio E Brandy and she enjoyed it. The service by Giorgio was top notch.

site_logo

Folawole Sanwoolu . 2025-03-26

MORE AT Google

An absolutely wonderful restaurant. Food and service top notch. Would highly recommend

site_logo

Jason Gordon . 2025-03-23

MORE AT Google

Had dinner here on Tuesday evening to celebrate an anniversary. We’ve been before and enjoyed but this visit was exceptional. The lady serving us was attentive and friendly, the food was fantastic (I think there must be a new chef now taking it from good to great) and overall just a wonderful meal - prawns cooked perfectly and pastas were rich and delicious. Highly recommend.

site_logo

Steve C . 2025-03-12

MORE AT Google

A decent experience overall—good selection of food and wine, and we had a nice evening. While nothing particularly stood out, there wasn’t anything negative to note either. It is on the pricier side, especially compared to other equally good (or better) spots outside of Dulwich. That said, the location likely factors into the pricing.

site_logo

R dlr . 2025-02-15

MORE AT Google

The service & staff were good. But the food was not nice. Everything was just doused in herbs. Garlic bread had whole springs of rosemary on! Just not tasty. Microwaved.

site_logo

Nicole Kent . 2025-01-24

MORE AT Google

An amazing meal, crab linguine with alot of crab in it. Service was perfect. Well done 5 star review

site_logo

Anthony Philp . 2025-01-22

MORE AT Google

A restaurant that goes above and beyond! The meals were incredible, featuring vibrant flavors, fresh ingredients, and the perfect portions.

site_logo

Gerard Mell . 2025-01-13

MORE AT Google

Lovely and cosy Italian restaurant

site_logo

CAROLINA BELTRAN . 2024-12-01

MORE AT Google

Underwhelmed by food. Ordered nocellara olives and was given queen pitted. Pasta was same base for both mine & partners dishes, ingredients were not fresh or plentiful. Service was wonderful, even if waiter gave our plates to wrong table they were nice. Maybe try their calzone.

site_logo

holly williams . 2024-11-09

MORE AT Google

The food was absolutely delicious and the service was amazing also if you asked for something they would bring it to you instantly,also they were quite friendly to us.

site_logo

Timothy Kobelev . 2024-08-21

MORE AT Google

The food was absolutely delicious and the service was amazing also if you asked for something they would bring it to you instantly,also they were quite friendly to us.

site_logo

Timothy Kobelev . 2024-08-21

MORE AT Google

We had lunch here yesterday, the venue is absolutely stunning, clean and it makes you think from the first step in that you are somewhere in Italy (especially on a sunny day!). The food was delicious, a bit pricey but think it is worth it. It took a bit longer for one of the waiter to approach us, we had a bit of walking around as we were not even sure if we can use the outside table but after few minutes he finally spotted us and proceeded to seat down and get served. We will return as overall we have enjoyed the experience.

site_logo

Vlad Hudges . 2024-08-02

MORE AT Google

Overall a nice experience - we had lunch here yesterday and did not regret. We had Carbonara Pasta and Calzone Pizza. The portions are generous, although a bit pricey in my opinion, but worth it (as my husband also agrees!). We will definitely return as we liked the atmosphere, the food and the service (could be slightly improved as we had to wait quite a bit to be acknowledged and it wasn’t even busy).

site_logo

Iulia Alexandra Marutan . 2024-08-02

MORE AT Google

Overall a nice experience - we had lunch here yesterday and did not regret. We had Carbonara Pasta and Calzone Pizza. The portions are generous, although a bit pricey in my opinion, but worth it (as my husband also agrees!). We will definitely return as we liked the atmosphere, the food and the service (could be slightly improved as we had to wait quite a bit to be acknowledged and it wasn’t even busy).

site_logo

Iulia Alexandra Marutan . 2024-08-02

MORE AT Google

Delicious food, especially the Salmone pasta. The children's pasta dish could be a little larger as my kids were still hungry and wanted more; This is equally a compliment to them enjoying the dish. We have been here many a times and will keep returning. Great food, atmosphere and service is always calm and kind.

site_logo

Sabriye Cambulat . 2024-07-02

MORE AT Google

Nothing memorable. The super attentive waitresses. The appetiser is the great quality wine. But she was disappointed with 2 orders of Tagliolini salmon, pasta completely off point, poor quality salmon. The order of Masa with carbonara, the dough completely out of point, the carbonara had no flavour and the pancetta completely burned, with a bitter taste. Simply the manager made me pay half a d and a dish that was not consumed

site_logo

Eliesio Batista . 2024-04-29

MORE AT Google

The Food and wine were brilliant. The service and ambience was also very good - would visit again

site_logo

Alex McGillicuddy . 2024-04-14

MORE AT Google

Had a lovely pizza here. Will come back.

site_logo

Barbara Janiszewska . 2024-03-26

MORE AT Google

Had a take away Risotto Frutti Di Mare was delicious! My only problem was my 3 year old daughter wanting to eat it all!!!

site_logo

Coach Harvey . 2024-03-21

MORE AT Google

Well it was Mother's day so a free glass of prosseco always brightens the day. Good Sicilian menu...also blessed with the presence one of my favourite comedians and local celeb... I'll let you guess...my 2rd visit, which certainly is a good sign...treat yourself

site_logo

Tyrone Thomas . 2024-03-12

MORE AT Google

Really good food, nice setting and excellent service. Will definitely be returning.

site_logo

Jude Scott . 2024-02-05

MORE AT Google

Sooo happy with the vegan menu! It was so lovely to have so many vegan options with vegan protein. Yummy! We will definitely be back lots and the service was lovely.

site_logo

Lauren Clarke . 2024-01-06

MORE AT Google

The food is honest, authentic and refreshing. I love the simplicity of the food and the taste.

site_logo

rmorris111 m . 2024-01-04

MORE AT Google

Nice Italian restaurant in Dulwich Village.

site_logo

Mikel López . 2023-12-22

MORE AT Google

Dined at this lovely restaurant We made reservations in advance to ensure a table was available for 5 people. I visited twice lunch times. And evening. The is a nice set lunch time menu avaliable. I liked the decor and the atmosphere the cleaniness overall is top, some of the tables were well spaced apart.The service was outstanding by the waitresses,so kind patience and helpful with the menu's. Each course came out on time and piping hot! I was very happy the way the waitresses served us.! Everything we ordered was delicious .Portion sizes are on the large side. We couldn't finish our plates. We also never felt rushed. Good opening hours for Lunch.If you are looking for a very nice Italian restaurant this one is the best. But very pricey!!!!

site_logo

Mimi Mimi . 2023-12-19

MORE AT Google

Fantastic food and going again this weekend. Highly recommend

site_logo

Surjeet Singh . 2023-12-11

MORE AT Google

We live local but not heard great things about this place so avoided it. We got some vouchers as a gift and thought we would use them for my mums birthday lunch. All I can say is what an unpleasant experience. The service was terrible and the food not far behind. The 2 stars are for the decore and look of the place but wish we didn't chose my mums birthday to go as it was not nice for her. We took a cake which they brought out when we asked but the waiter just stood there and was looking where to place it and didn't even say Happy Birthday. When we were leaving I took the box and packed the cake myself with no offer from any staff. Most of the food was left and nobody asked us why. Never again.

site_logo

Tiamaria15 . 2023-12-03

MORE AT TripAdvisor

Cozy place for Italian dinner. With nice food and vine. We were happy to stay quite late but didn’t feel pressure from staff. Definitely will come back.

site_logo

Anastasiia Koliesnik . 2023-11-15

MORE AT Google

Beautiful pizza after work! Very very quick service (although very quiet time of day). Definitely will return if work brings me this way again. Many thanks

site_logo

Kellie Stephenson . 2023-09-28

MORE AT Google

LOVED it!! Great with gluten free and dairy free/vegan needs whilst feeling very authentic. Food was delicious!

site_logo

Maria Hemming . 2023-09-14

MORE AT Google

Mediocre food, service okay- not friendly, no smiles- just hunting for the next customer

site_logo

Suhani Rumi . 2023-09-09

MORE AT Google

Got a takeaway from here, was charged £10 for a calamari starter and only got a few pieces (see the attached photo), terrible service and value

site_logo

Henry Britton . 2023-08-21

MORE AT Google

Prompt service with stupendous meals for the three of us, my wife was extremely impressed with the Lamb stew ( sorry cannot remember the correct menu title). We went to Olivelli, East Dulwich and were glad to have done. Maremma in Herne Hill was full up.

site_logo

Bruce Scragg . 2023-08-18

MORE AT Google

The atmosphere is lovely with dimmed lighting. Service is excellent too, our waitress was very competent. The food is also delicious, I had the Polpette Amatriciana with pasta instead of bread which was crazy good!

site_logo

Freya Porter . 2023-08-14

MORE AT Google

Service was great but very expensive for food that was completely average. Ingredients tasted cheap - eg the parmesan on the parmesan truffle fries (that cost £5) had no flavour depth whatsoever. The pizza was ok but there is far better and more authentic pizza elsewhere in Dulwich. The nero d’avola wine tasted vinegary. Will not be returning.

site_logo

Aaron KG . 2023-08-05

MORE AT Google

I came here to the Dulwich branch with my partner for a afternoon lunch I ordered a carbonara and I don’t eat pork so they accommodated for me and I was able to add prawns and chicken, guys when I tell you the food was soo delicious and the portions was plenty I couldn’t finish, the service was really good also I will defoo recommend coming here if your into Italian food and want tasty food.

site_logo

Izzy Realsss . 2023-07-28

MORE AT Google

They booked us as a large party at short notice. Accommodated all our needs. Great food, good choices.

site_logo

Philippa Levy . 2023-07-25

MORE AT Google

On a personal recommendation, we took our friend to Olivelli's for their special birthday. We were not disappointed! Everything was wonderful and our friend was delighted. We all had such a great experience that we booked our Christmas meal straightaway!

site_logo

Shelley Leckey . 2023-07-11

MORE AT Google

I love Olivelli East Dulwich. They have a substantial vegetarian and a vegan menu. George the manager is lovely. I held my birthday party in the upstairs function room and had a brilliant time - we could play our own music - fabulous! :-) Sometimes my partner and I pop in just for pudding as the desserts are ridiculously good. The service is always exceptional and the food divine. Tip - ask for the chilli oil with pizza - it's gorgeous. Thanks Olivelli! 😀

site_logo

Project Dare . 2023-07-10

MORE AT Google

Visit this restaurant in a fairly regular basis. It’s got great food and always good service. The pizza is great and the goats cheese salad is also a winner. They do a great aperol spritz as well.

site_logo

Brian MacDonald . 2023-06-19

MORE AT Google

Woooow superb in every way! The view into the restaurant is like a sunny magnet with Sicilian art on the walls and beautiful warm lighting lifting out fresh flowers set in authentic Sicilian vases. You feel as though your there and enjoying the real deal, without the pain of Gatwick. The food is exceptional and the service matches it. My wife and I went for the "specials" Tagliolini Granchio with Crab and prawns in brandy, it was absolutely georgus and topped off with the Tiramisu which is a must.

site_logo

Roger Beckett . 2023-06-12

MORE AT Google

Great food, definitely worth a visit

site_logo

Jayne Beasley . 2023-05-23

MORE AT Google

Wonderful food and atmosphere. Service also outstanding! We had the mixed starters, followed by fish and home made desserts. We will come back!

site_logo

G S . 2023-05-07

MORE AT TripAdvisor

Lovely meal at this restaurant in the middle of E Dulwich main street. Sicilian food - delicious, well presented and good choice. Staff efficient, friendly and welcoming. Would definitely recommend.

site_logo

Lynn D . 2023-05-07

MORE AT TripAdvisor

Ended up here by mistake when the restaurant we wanted to try was full; however, very pleased to have ended up here! Both our pizzas were fantastic - great base, tasty sauce and quality toppings. Starters were okay, but would suggest giving them a miss and going straight into the mains.

site_logo

isobel knight . 2023-05-06

MORE AT Google

I'm reviewing again as I went here on Saturday. Olivellis is just as good as I remember. Different flower decorations around the front window (very nice 😊), the staff were as good as ever, always smiling, always happy to help. The food is definitely as good as I remember 😋!! Olivellis is a very reasonably priced restaurant for the quality and taste of their food, let alone the top quality of their staff...I will be back, thank you so much for an amazing evening 😊.

site_logo

Lap 62 . 2023-05-01

MORE AT Google

jenny was amazing, lovely girl , beautiful service! definitely will return

site_logo

Esmeindia Martin . 2023-04-29

MORE AT Google

A rare treat to share an evening meal with our son, daughter and son in law..A good choice of venue, food, wine and ambience that made this a, special evening to remember..

site_logo

John Barchan . 2023-04-02

MORE AT Google

Great food and friendly staff I recommend for anyone, 100% authentic Italian food ⭐️⭐️⭐️⭐️⭐️

site_logo

Ștefania Brânduș . 2023-03-26

MORE AT Google

Rude manager, it is unbelievable that in 2023 Italian restaurants in London are serving fake Italian food . Should be given to prisoners as a punishment .

site_logo

Mimmo Frattini . 2023-03-20

MORE AT Google

Very expensive and average food. Spaghetti allo scoglio did not have the squids in it although listed in menu and it was just ok. Prawns I had in my pasta were the usually already peeled prawns and linguine rather overcooked

site_logo

Gracy Moonlight . 2023-03-08

MORE AT Google

£15.50 for salmon pasta main dish hugely inflated on two counts. (1) flavour and quality, (2) size of the meal. My previous experience was a tad nicer but based on my enjoyment on this occasion I would be reluctant to return to Olivelli Dulwich.

site_logo

Abbas V . 2023-02-24

MORE AT TripAdvisor

Average food. Risoto a bit tasteless. Average starters. Good service.

site_logo

engel RM . 2023-02-05

MORE AT Google

We went to this restaurant pretty much by accident, and when we entered we were impressed by the striking decor and friendly service. The wine they serve is delicious but the real show-stopper is their gnocchi hazelnut dish, the flavours were absolutely divine. I had insalatta pantelleria - a hearty and generous salad of chicken, also with excellent flavours, servings are generous, and even the plates are beautiful. Great ambience and playing nice music- 100% recommend.

site_logo

Samara . 2023-01-23

MORE AT Google

A cracking little authentic Italian restaurant in the heart of East Dulwich. Quality food, honestly priced. Would heartily recommend it.

site_logo

Andrew Haley . 2023-01-22

MORE AT Google

Nice food, but slightly overpriced, the quality and flavour could be better for the price.

site_logo

Steven Ryall . 2023-01-09

MORE AT Google

Used to eat here a lot when we lived in East Dulwich and loved their vongole in particular. Returned in between Christmas and new year for the first time in a while and was sorely disappointed. Extreme surly service throughout, portions massively increased (well the pasta element at least) perhaps to justify the price hike and food taste and quality much diminished. Tiramisu utterly vile and when we mentioned to the staff and queried if they had changed suppliers we were told it’s the same as always. It wasn’t. My children look forward to that part of the meal and have eaten it often there. The manager took half the pudding off the bill. So we then asked for the service to be removed. (£17). He asked why and my husband explained the service had been bad. The manager then brought back the other half of the pudding cost in loose coins - a complete insult. Never been so offended and having spoken to several friends they agree it is not what it was. A shame as it was pre Covid, a friendly restaurant with consistently good food. Staff overhaul needed.

site_logo

Theoneandonlymrsj . 2023-01-07

MORE AT TripAdvisor

Excelente restaurante italiano em East Dulwich, recomendo a lasagna e o spaghetti with salmon and pesto.

site_logo

Bruno Fortes . 2022-12-25

MORE AT Google

Service from the lady yesterday was rude and she clearly hated being in the job. Serving across the table as too lazy to walk around. Offering a spoon across the table. Very sad miserable face. Frustrated with payment even though we paid it all. You didn't deserve service charge but I secretly paid my friends shares myself

site_logo

serin cafer . 2022-12-22

MORE AT Google

Came here yesterday evening for a 60th birthday meal and afraid we were let down by an unpleasant experience with the manager on duty. The restaurant was quite busy with a large party upstairs and we were left waiting a long while for our starters - the bruschetta eventually arrived and we were all perplexed as to what we had been served. The bread was barely toasted and left to sit soggy with a mound of tomato piled on top. We refused the meal and the manager on duty was seemingly quite frustrated. Our mains arrived not long after and credit where credit is due it was absolutely delicious. I then went to pay for the meal and informed the manager that we were a little disappointed considering the above. At this point he began to get extremely confrontational with very little apology offered. It seems as though our criticism was accurate as I can see many photos of the bruschetta online and it looks like a completely different dish to what we were offered! Besides the point really my real frustration is how I was spoken to by the manager. Adversarial and antagonistic at times. The rest of the staff were lovely. Hopefully he reads this and reconsiders his approach next time round!

site_logo

Josh Woodall . 2022-12-17

MORE AT Google

Solo estuvimos en la terraza tomando unos cafés. El sitio agradable y el personal atento

site_logo

Juan Orviz . 2022-12-16

MORE AT Google

I had been to this restaurant in Waterloo so was expecting good things and it delivered! Service was excellent, gorgeous dim lighting and great restaurant for any occasion. I opted for the salmone tagliolini with black and white truffle cream which was perfectly cooked and absolutely delicious, flavours packed a punch. Prices about average. Fantastic Italian choice in Dulwich.

site_logo

BunchOfLilies . 2022-12-05

MORE AT TripAdvisor

While there are plenty of Italian-light restaurant chains around, Olivelli offers a far more authentic experience, both in terms of the menu and the ambience. Having enjoyed the bustle of their Waterloo venue, I booked for an early supper at East Dulwich where the evening session atmosphere is more intimate and relaxing. Once again, top marks for fresh-cooked , quality cooking (you can see and speak to the chef and his team) and attentive service.

site_logo

D McC . 2022-11-26

MORE AT Google

Great experience - Italian, as name suggests. Authentic and cooked to order...

site_logo

Julia me . 2022-11-08

MORE AT Google

I called in to my favourite local Italian – Olivelli – the other evening with a friend. Food five star as always. A starter of Bruschetta Paesana followed by Insalata Serafino (that’s the chargrilled goats’ cheese salad with caramelised onions and other delights) and a glass of the excellent Chianti. The staff are always friendly and welcoming so the temptation is to linger. (The new hand-painted plates are lovely, by the way!) A word to the Instagrammers: the colourful autumnal floral theme is worth a look….

site_logo

Vicky Huntley . 2022-10-07

MORE AT Google

I called in to my favourite local Italian – Olivelli – the other evening with a friend. Food five star as always. A starter of Bruschetta Paesana followed by Insalata Serafino (that’s the chargrilled goats’ cheese salad with caramelised onions and other delights) and a glass of the excellent Chianti. The staff are always friendly and welcoming so the temptation is to linger. (The new hand-painted plates are lovely, by the way!) A word to the Instagrammers: the colourful autumnal floral theme is worth a look….

site_logo

vickyhN249OF . 2022-10-07

MORE AT TripAdvisor

Really nice food and atmosphere 😍🙏

site_logo

Jimmy Chiba . 2022-09-04

MORE AT Google

Ottima pizza e buona scelta negli altri piatti. Buon servizio e staff cortese. Bel locale.

site_logo

Joy Taylor . 2022-09-03

MORE AT Google

My husband and I went to the restaurant in Lordship Lane for our Anniversary and my birthday. The staff are so friendly and helpful. The food was amazing. Definitely going back there.

site_logo

Diane Jeanpierre . 2022-08-28

MORE AT Google

Good food and service, but a bit disappointed that the beer is put as 330ml on the menu but we receive a glass of half a pint (230ml). we paid for 100ml we did not receive. this 330ml costs the price of a full pint

site_logo

Sophie GDC . 2022-08-28

MORE AT Google

We visited this restaurant when on a trip to London and I have to say it is one of the best Italian restaurants I have ever set foot in. The food was top quality and the service excellent. Would definite recommend.

site_logo

667dorothyr . 2022-08-25

MORE AT TripAdvisor

Negative and erroneous service staff on a recent visit was unacceptable. The food is fine, but also coupled with the price tag, this isn’t an experience I would recommend.

site_logo

Alastair MacFarlane . 2022-08-15

MORE AT Google

Been twice a good experience and lovely outdoor seating All dishes cooked well, nice portion sizes, nice prompt and professional service.

site_logo

A H . 2022-07-31

MORE AT Google

This unequivocally one of the best Italian restaurants in south London. The food isn’t cheap, but you get what you prefer pay for. The pest pistachio is particularly yummy. I recommend changing the pasta noodle though. Choose classic pasta dishes over the specials as they are even better. Desserts selection are average, but the main dining food is wonderful. Service was prompt, knowledgable about the food and very warm.

site_logo

Heather Mason . 2022-07-10

MORE AT Google

Such a cute place, fabulous meal, and great service. Every dish was spectacular and timely. Cannot wait to eat here again.

site_logo

Sasha Victoria . 2022-06-27

MORE AT Google

Fantastic atmosphere, sumptuously delicious food and attentive warm service! Can’t wait to return.

site_logo

Ane Peer . 2022-06-25

MORE AT Google

A very nice friendly restaurant, menu good, food excellent, service good totally enjoyed visit would recommend this place to all.

site_logo

Brian Wickens . 2022-06-25

MORE AT Google

Whenever I visit here I always have a great meal and the icing on the cake for me is that they serve gluten free pasta (Penne).

site_logo

LadyHaddon . 2022-06-14

MORE AT TripAdvisor

Excellent! Love it. Really authentic and amazing

site_logo

Gina Slotosch . 2022-06-14

MORE AT Google

We have been several times before as we are locals and always enjoyed our food. Food was again lovely last night, however what a disappointment with the staff. They need to seriously address that and I might just pop in and tell them as they will lose customers. They must be fairly new as we didn't have problems before. We dealt with several waiters who were either rude or incompetent or both at the same time. I can't even go into details as there were too many issues. As it was my birthday and we had friends with us, I didn't want to make a fuss but I should definitely not have paid for the service charge as service was poor. All of us found the staff unpleasant and mostly unfriendly.

site_logo

Laurence Arora . 2022-06-05

MORE AT Google

We had a wonderful meal at Olivelli last night.Fab limoncello cocktail, not too sweet. Delicious starter platter and sea bass. Ans it has the best tiramisu anywhere!

site_logo

Diana Beckett . 2022-05-28

MORE AT Google

Good local Italian restaurant with flavourful food and helpful, pleasant staff.

site_logo

James Small . 2022-05-15

MORE AT Google

Nice food, good service but I just thought it needed a bit more "wow" for the price

site_logo

Chris Richardson . 2022-05-02

MORE AT Google

We were walking around Dulwich and we found out this italian place. Honestly one of the BEST pizzas we ever tried in London. I High recommend this place!!!! Pizza was tasting very good! Very happy about this Pizzeria 🇮🇹🇮🇹🇮🇹

site_logo

Sudha V . 2022-04-18

MORE AT Google

Nice food great staff would definitely go back nice local place to go

site_logo

Joann Slattery . 2022-03-31

MORE AT Google

Very small lasagne for £15...not worth the cost!

site_logo

Nicholas Dunn . 2022-03-26

MORE AT Google

We had the calamari and arancini for starters. The arancini was nice, but the calamari was small and half of the portion was essentially small pieces of batter (see photo). For mains we had the veal milanese and the lasagne. Both were disappointing especially for the price. The veal was very dry, and the chips were soft and came to the table luke-warm. The lasagne was in a single layer. Essentially a bowl of Bolognese, a tiny amount of pasta and an incredible mountain of cheese which rendered it inedible. We couldn't finish the veal or the lasagne. We expressed our concerns with the manager who spent time telling us that while we may have a point regarding the veal, that they had never had any complaints about the chips (apparently they were supposed to come like that) or the lasagne. We didn't feel we were listened too and while the dishes may otherwise be made well, we certainly didn't think the ones we were given were. When the bill came they had not offered any discount, but did offer us 2 further drinks on the house. We left feeling we'd rather had gone to pizza express.

site_logo

Chris Marks . 2022-03-13

MORE AT Google

Olivelli in east Dulwich is a fine restaurant. Offering authentic Italian food with an impeccable service.

site_logo

Maddy Schiavone . 2022-03-03

MORE AT Google

I went to this restaurant a couple of weeks ago and was the first to arrive at 12:00pm when they opened. I had made an enquiry about whether we had a reservation and the waiter looked horrified. I sat outside and waited before going for a brief walk, before my sister called to say they had ordered. My sister and her husband had already order margarita pizza for my nephew who were 4 sliced in when I arrived and she noticed a hair poking through the cheese. We immediately notified the waitress who asked said “how do you know it’s not one of your hairs? We were not caucasian and so evidently upon looking at the fine hair, it clearly wasn’t from one of us. The waitress asked if we wanted another one but judging from the first one, hygiene may have been an issue and as my nephews were young we didn’t want to take the risk? I enjoyed my pasta nonetheless. They didn’t mention it again. Didn’t apologise? Nothing. Make of their service as you will?

site_logo

Miriam . 2022-02-26

MORE AT Google

Wow! Finally an Italian restaurant that has been to Italy! Delicious seafood, beautifully cooked pasta and best of all - fried courgette flowers just like you get in Rome, I have never found these in the UK. I wish I lived closer so I could order boxes of these at a time. Friendly service, nice drinks, lovely atmosphere, but the food is the absolute star of the show.

site_logo

Teresa H . 2022-01-23

MORE AT TripAdvisor

I came here as a group to celebrate a birthday and had a delightful evening. The menu here has a lot of variation which includes classics like pastas, pizza and lasagna, but also really amazing main courses like veal, fish/seafood, risotto, arancine etc. We ordered a wide variety of different dishes and everything came out timely, perfectly cooked and tasty. Our waiter was polite, attentive and friendly. I ordered the Scallopine al Funghi and absolutely loved it. Would definitely come back :)

site_logo

Tiffany H. . 2022-01-17

MORE AT Google

Had dinner in NYE and food was delicious. We were looked after the Colombian waitress (sorry don't remember her name) who offered us an excellent service. Will be back.

site_logo

Rocio Ruiz Chavero . 2022-01-09

MORE AT Google

Had coffee it was delicious (a latte) and the service was above par

site_logo

RIDICULAS NICKNAME . 2022-01-06

MORE AT Google

£14.15 for a very basic flavourless watery spaghetti. Literally had no flavour! Also some of the mince was stuck together in lumps. As a Italian restaurant spaghetti Bolognese should be your speciality. Clearly no effort or care goes into your food.

site_logo

Money Monroe . 2022-01-01

MORE AT Google

Super service , great menu choices ( maybe heavy on veal) and truly lovely service.

site_logo

Alan Clare . 2021-12-31

MORE AT Google

Fine dine in. Had a good experience. Nice staff as well

site_logo

Billy June Nacion . 2021-12-04

MORE AT Google

Similary restaurants in London

restaurant_img
4.0

1221 Opinions

location-icon161 Bellenden Road
Italian
outdoor_seating_67782takeaway_67782delivery_67782

Came for the Sunday set menu - phenomenal value!! Every course was superb, portions were generous and service was great too, highly recommended!

restaurant_img
4.0

3460 Opinions

location-icon25 New Globe Walk
Italian
outdoor_seating_83181takeaway_83181delivery_83181

Very beautiful location, the service was top notch. The waiter was very caring and chatty. Thank you for great experience, will come back again.

restaurant_img
4.0

833 Opinions

location-icon184 Bermondsey Street, London SE1 3TQ England
Italian
outdoor_seating_265508takeaway_265508delivery_265508

A fantastic experience from start to finish. From being greeted by a wonderful slightly flamboyant (hope he doesn't mind me saying that) chap. To excellent, just right table service by the staff. Attentive but not over the top. The simplicity of the food that tasted awesome. Top notch place. Could well be our new fave. Minor point - blokes loos. A slight let down but hey, not a deal breaker.

restaurant_img
4.0

526 Opinions

location-icon45 Shad Thames
Italian
outdoor_seating_71920takeaway_71920delivery_71920

Barista is not good at making coffee. Cappuccino is not good. Price is too expensive.

restaurant_img
4.0

1913 Opinions

location-icon75-79 Dulwich Village
Italian
outdoor_seating_78037takeaway_78037delivery_78037

The place has a beautiful atmosphere between modernity and antiquity. The service is fast. The food is very delicious 👌🏻 (the taste is 100% Italian) Perfecto Lasagna 👌🏻 Arugula salad with parmesan (regular) Restaurant tables where you can see most of the dishes I went to Weekend on Saturday at 3pm and entered quickly without a reservation. I strongly recommend the restaurant