GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 2.299 opinions finded in 3 websites

site_photo4

Nº 381 in 503 in North Norfolk

Nº 136 of 196 British in North Norfolk

CUSTOMERS TALK ABOUT DISHES WITH..puddinggarlicmustcrabmeatchickenpiesandwichfishsaladcookedoldsteakbeautifulcheeseroast

comment_iconOpinions

Lovely little pub. Friendly staff. Dogs welcome. Just missed the time for food but will definitely go back when I’m back in the area.

site_logo

lindahertf0rdshire . 2025-01-10

MORE AT TripAdvisor

We enjoyed our visit for lunch after going to see the seals. With hindsight we would have parked here and walked the mile or so to the beach rather than pay the £4 fee (for 2 hours)at the main Horsey Gap car park. It's a nice old fashioned cosy pub. Lots of memorabilia such as old marshman's tools and guns etc. on the wall, a dartboard and so on. Very busy and quite small inside. We were lucky to get a table especially as there were a group of what appeared to be Asian tourists visiting. Very popular with those going to view the seals in winter. Good cellar with great selection of beers and ciders. Friendly staff/service. Reasonable prices. We will go back.

site_logo

g0akc . 2025-01-06

MORE AT TripAdvisor

Last pub visit for 2024. On aarivaknthw beer choice was smaller than expected but during my time there new beers were popping up on the beer list. A good choir in the end. Food, cheesy chips, was probably the worst I have had recently

site_logo

Rob W . 2025-01-01

MORE AT TripAdvisor

We had a lovely lunch here after visiting the seals

site_logo

Alison Shand . 2024-12-30

MORE AT Google

What a lovely pub , genuinely a lovely atmosphere . It's not flash or a fancy pub but a tradtional boozer . Food was fantastic , john the landlord made us feel so welcome . Very very dog friendly.

site_logo

Andy J . 2024-12-29

MORE AT Google

Dog friendly, historic rural pub, great atmosphere and friendly patrons.

site_logo

Gary Bridgeman . 2024-12-26

MORE AT Google

Lovely traditional pub, no airs or graces, warm and friendly

site_logo

stuart wells . 2024-12-16

MORE AT Google

Lovely little quietly old fashioned pub, with fabulous pub food, lots of choice, good veggie options, and the bar staff were so friendly and helpful, would love to come back!

site_logo

Raye . 2024-12-13

MORE AT TripAdvisor

Glad to have a pub here to rest with my group after enjoying the seals nearby. The dinner portions were big, and there were vegan options available - I had a vegan burger, which seemingly was like veggie burger (not fake protein).

site_logo

Joey Googs . 2024-12-05

MORE AT Google

Proper pub. Good beer good food, friendly and interesting.

site_logo

Bob Curtis . 2024-12-03

MORE AT Google

Nice food beer and people. Seals irrelevant

site_logo

Andy Haig . 2024-11-14

MORE AT Google

Lovely atmosphere in small establishment offering good food and cosy dining area away from the crowds with easy parking.

site_logo

Clive Bunn . 2024-11-10

MORE AT Google

Was busy but rather dark inside

site_logo

Philip Worsell . 2024-11-10

MORE AT Google

We decided to go to see the seals at Horsey and googled pubs nearby. Nelson Head came up and the reviews were good so we thought we would give it a go! The pub was smaller than I expected but we got a warm welcome. There were quite a few things unavailable on the menu but all 6 of us found something we would like. Food was quick and everybody enjoyed their meal. Very friendly service and if we were in the area again, we would definitely come back. Thank you for a lovely lunch.

site_logo

Elizabeth B . 2024-11-09

MORE AT TripAdvisor

Had a nice buzz, would recommend

site_logo

Mark Freeman . 2024-11-09

MORE AT Google

Lovely people, great food-very tasty, this place is a dogs social dream! Fields around for a run. Parking available.

site_logo

Samantha Madigan Hennessy . 2024-11-08

MORE AT Google

Wonderful hidden gem full of local interest. Great pint and good food selection. Friendly staff

site_logo

Peter Townsend . 2024-10-27

MORE AT Google

Recently did a motorhome stopover, which allowed us to stay free overnight if we dined at the pub. So welcoming and a lovely original country pub. From the staff to the locals, they all made us feel at home. Food was fresh and tasty. Drinks were reasonably priced. Would definitely recommend and will return.

site_logo

Lisa Frosdick . 2024-10-27

MORE AT Google

Best cod and chips "in the world!!" Great cider, perfect pub. And still the same!!

site_logo

Michael Short . 2024-10-26

MORE AT Google

gorgeous place food is 10 out of 10 stunning location

site_logo

Liam Goldthorpe . 2024-10-24

MORE AT Google

We visited on a Monday lunch time. Took our lab puppy for his first pub visit. Our Older lab knew where he was! Dog friendly welcoming pub. A real pub. Great food and although some items were unavailable there was more than enough choice. Fish and chips and but had by us and satisfied our hunger well.

site_logo

dicky wicky . 2024-10-21

MORE AT Google

An absolute gem. Great beer, lovely food friendly staff. Everything you'd want in a proper pub.

site_logo

Norton Townsend . 2024-10-20

MORE AT Google

Great wee country pub that is easily accessible by both road or broads. Lovely old feel about it and very welcoming. I had the ploughman's and a pint, Great, looking forward to my next visit.

site_logo

Glenn Sheppard . 2024-10-20

MORE AT Google

The food was very nice and hot staff was very helpful and friendly lovely atmosphere keep up the good work congratulations to all ov the staff and the owners we will be back

site_logo

Neil Clarey . 2024-10-18

MORE AT Google

Very nice pubvery nice people 👍

site_logo

Kathleen Clarey . 2024-10-18

MORE AT Google

Old fashioned pub. Space outside as well as in in sit. Reasonable priced. Friendly staff. Toilets not flushing and no soap in toilets. Believe issue with water in area when visited.

site_logo

Donna Cyd . 2024-10-18

MORE AT Google

We parked on the pub carpark , booked a table, then walked to the beach to see the seals. What an excellent decision this proved to be. The 20 min walk to the beach was quiet and pleaseant and we stoped to watch deer in the woodlnd, Then, at the beach we were blown away by the number of seals we saw just chilling and not at all bothered by us taking photos. Then back to the pub to be greeted by very freindly staff and shown to our reserved table. The food was all freshly prepared and was excellent. ( recommend the crab sandwiches, they were lovely) The locals were really friendly too and made us feel very welcome.

site_logo

ct4169-1 . 2024-10-06

MORE AT TripAdvisor

Good food good beer friendly staff but please update your website.

site_logo

Rob Skelton . 2024-10-04

MORE AT Google

Great home cooked food, great beer and friendly service from this dog friendly traditional pub, what's not to like. Highly recommended.

site_logo

Andy Saxby . 2024-10-02

MORE AT Google

Small, cosy pub. Good beer - barman knows his beers. Landlord very friendly. Sandwiches were huge. Good moorings at Horsey Mere and 20 minute walk to the pub. Loved it.

site_logo

Duncan Williams . 2024-10-01

MORE AT Google

Lovely old unspoilt pub. Limited menu but fab crab sandwiches. Guest ales & ciders.

site_logo

Maggie Simmons . 2024-09-27

MORE AT Google

A dated traditional pub. The service was great, a very friendly barman. We sat in the pub garden aka a field on a lovely sunny day and had lunch. Lots of customers sitting outside with their dogs. Highly recommend

site_logo

anne w . 2024-09-26

MORE AT TripAdvisor

Went to sea the seals 🦭 at Horsey Beach and came here for some lunch as it is close. They are very dog friendly. We had fish finger sandwiches with chips and it was delicious.

site_logo

Ian Jarrett . 2024-09-24

MORE AT Google

Old pub, fish and chips were great, good beer selection too

site_logo

Alex Matthews . 2024-09-22

MORE AT Google

What happened??? 😭 This feels like punching an old friend and something I never thought I'd do as we've been here so many times over the years and had amazing meals, so we were greatly looking forward to one for my birthday Son and I were craving some of the steak with stilton and mushroom sauce that we'd not had in a couple of years (oh boy was that GOOD), but we sit with menus to see they don't do steak anymore (nor much that used to be on the menu unfortunately) Very generic pub food, didn't fancy much but decided on garlic mushrooms as a starter, and spaghetti Bolognese from the Specials Board - "sorry we don't have spaghetti", ok I'll try ham egg and chips then 'Starter' comes, was absolutely huge and could have fed all 4 of us! They were ok, no more no less Mains arrived, my Mum on finally being given her Halloumi burger was informed "we're out of chilli jam" (it was what sold her on it, had she been told they were out she'd have ordered something else) Ham, egg and chips - eggs good and cooked nicely, but unfortunately the ham was so sweet and dry, and the chips (unlike what seemed like fresh last time we came) were clearly frozen, dry, and like cardboard making those two elements almost inedible We had to ask for cutlery and condiments (which now come in fiddly packets rather than bottles/dispensers), asked for a bottle of water and the waiter slammed it down and took two of our glasses away 😆 Ladies toilet was out of order so we had to use the men's, which smelled like it hadn't been cleaned in a year (a fact we were reminded of every time someone entered as we were seated quite close) So to say we were disappointed with our food is an understatement, plus point and saving graces were that the ale I had was very good, there were a couple of very nice customers and an extremely lovely dog who I'd have run off with! Pub itself is as gorgeous and atmospheric as ever but please please please sort out your food! Last rating I gave was 5 across the board, never envisaged leaving anything lower yet here we tt

site_logo

Mary-Beth Gaskill . 2024-09-21

MORE AT Google

Great food, friendly staff, it is the 2nd time we have visited, dog friendly, plenty of parking

site_logo

Susan Ferdinando . 2024-09-16

MORE AT Google

We had an absolutely brilliant time here. The pub is so welcoming and food and drinks are great. Definitely recommend the fish and chips lunch it was awesome.

site_logo

Susan Woodward . 2024-09-16

MORE AT Google

Good choice of beer Woodfordes plus others food looks excellent but have not tried it yet

site_logo

Bruce Brownsell . 2024-09-11

MORE AT Google

Pub that does what it says on the tin.. Good selection on non- alcoholic beers. Excellent crab sandwich and proper chips

site_logo

Mark Cosstick . 2024-09-11

MORE AT Google

Just stop for refreshments! A bit shabby but great service and banter with the locals, £4.60 for a pint for the crafted cider and a garden the size of a football pitch.

site_logo

alan staples . 2024-09-08

MORE AT Google

REAL pub. V good crab sandwich. Staff - just right.

site_logo

Nigel Hague . 2024-09-05

MORE AT Google

Stopped here to eat after spending a long time at Horsey Gap. Ample parking, great traditional pub with a brilliant atmosphere. The food was fantastic, and there was plenty of room to eat, both inside and out.

site_logo

Amanda McRae . 2024-09-05

MORE AT Google

Great pub in a tucked away location, parked there to go to the beach and then back for food. Food is excellent and plentiful for a decent price.

site_logo

Simon Duke . 2024-08-26

MORE AT Google

Lovely food, good portions, friendly staff and good value

site_logo

georgie16 zzz . 2024-08-25

MORE AT Google

We ate here on a stopover, the service was friendly but slow, we asked for additional bread which took a good 20 mins to arrive at the table! The food was at best average, not bad, but at best standard pub food! The bar was very poorly stocked, each wine I asked for wasn’t available and when I asked what they did gave I was told “I don’t know!” Settled for a beer as was easier!

site_logo

Emma White . 2024-08-24

MORE AT Google

A traditional country pub with good food choices. Plenty of space inside and out. Dog friendly too. Ideal spot to park, eat then walk down to the beach to see the seals. They are happy for you to do this providing you use the pub also before or after.

site_logo

Kathryn Robbins . 2024-08-18

MORE AT Google

Great rustic pub. Great atmosphere and great location.

site_logo

Quintin Viljoen . 2024-08-17

MORE AT Google

Stopped here whilst cycling the area. Super friendly staff and lovely, spacious beer garden. Would def return as food looked good

site_logo

Kate BC . 2024-08-16

MORE AT Google

Quirky countryside pub with lots of charm and good things going for it! Strictly no tap mixers here. If you want cola or lemonade it comes in a tin or from a bottle. Good selection of ales and lagers. We stuck with the Wherry’s. No shortage of choice on the Specials Board including three crab and three prawn dishes. The Ploughman’s was good too! Reasonable prices. We sat in the garden. Friendly, diligent staff. Overall very good!

site_logo

Alan H . 2024-08-15

MORE AT TripAdvisor

We visited the Nelson Head as it was the closest to the beach. The staff were friendly enough, though nothing to remember. Food was average, halloumi burger had minimum halloumi & a cold bun. One thing I will say is that the whole pub needs a complete clean & upgrade from top to bottom ~ not sure where the earnings go, certainly not on improvements.

site_logo

Buchanan . 2024-08-11

MORE AT TripAdvisor

If you're staying at any of the campsites near Waxham , always recommend a recovery meal from this pub and restaurant. Shepherds pie and their chicken burgers went down a treat. Big up to the young lad with long hair behind the bar 🤙

site_logo

Theo Tsoi . 2024-08-08

MORE AT Google

Nice little pub. They had run out of several dishes having been busier than usual. Food was good. Staff were friendly.

site_logo

bunburyd . 2024-08-04

MORE AT Google

This restaurant offers a wide selection of dishes and drinks. A real insider tip, also suitable for hikers exploring the coast like us, for example to observe the nearby seal colony. Nice location a little inland. Outdoor tables too.

site_logo

AW1784 . 2024-07-31

MORE AT TripAdvisor

We stayed just down the road and often wandered up there for food and drink. Very relaxed in the large outdoor garden on a summer evening. Interesting selection of ciders. Good place.

site_logo

Jane . 2024-07-31

MORE AT Google

Shush, don't tell anybody!!! Great that they invited dogs in! Great service and food.

site_logo

Phill Main . 2024-07-29

MORE AT Google

Fantastic pub. Great atmosphere, lovely beer garden, exceptional food and service. Extra mention to the young chap who took the trouble to refill and bring over the dog bowl of water. Something so simple, but had a massive effect on our enjoyment

site_logo

David Filce . 2024-07-29

MORE AT Google

Brilliant pub. Like stepping back in time to what English pubs used to be.

site_logo

philip martin . 2024-07-27

MORE AT Google

Traditional pub. Not a chain or franchise. Decent ales on tap.

site_logo

Nathan Seery . 2024-07-25

MORE AT Google

Very friendly and welcoming. Big garden to sit in and happy for you to use the pub and walk to see the seals. Def would recommend this pub to anyone

site_logo

Natalie H . 2024-07-23

MORE AT TripAdvisor

Not been to the Nelson Head for a few years and it use to be an old favorite but sad to say we won't be back anytime soon. The attitude of the young lady serving at the bar and taking food orders really set the scene from the beginning, completely disinterested, not an ounce of warmth or any senses of customer service. Commenting to someone as she poured our drinks that she had enough and was already looking forward to the end of the shift and this was at about 18:30! The food was okay though not cheap and there was a long list of things whilst on the menu that were not available which seemed strange so early on a Saturday evening. We were not expecting fine dinning or 5 star service but it would have been nice to have been made to feel welcome customers rather than just an inconvenience.

site_logo

Tom R . 2024-07-21

MORE AT TripAdvisor

In need of some TLC, looking a little run down, but the food is good. Quite a small little place so doesn't take long for it to look crowded. Definitely a locals pub but do not let that put you off, they were all friendly and welcoming. Very dog friendly too.

site_logo

Paul Brooker . 2024-07-21

MORE AT Google

We only had a sandwich but it was fantastic and served with loads of salad. Fish and chips looked awesome. Beers and cider were excellent and such a great range of choices. Wish it was closer to home.

site_logo

Mark Walland . 2024-07-17

MORE AT Google

We stopped in for a couple of drinks when staying local. Well placed just off the main road if in the area of Horsey, Waxham, Sea Palling. Lots of quirky old maritime memorabilia scattered around and on show helps add to the atmosphere of the pub. Service was friendly and great choice of drinks. We didn't eat but food served looked pretty good and decent sized portions. Main criticism is the cleanliness. The toilets were very dated and not very well maintained and some of the decor is very old with some areas not great to look at, ie, the radiators with spills, stains, etc splattered on them

site_logo

Chris Barnard . 2024-07-15

MORE AT Google

Very good range of beer. Very interesting pub, garden is huge with great views.

site_logo

Matthew Rowe . 2024-07-13

MORE AT Google

No bells and whistles just a country pub , nice atmosphere, good beers and food all reasonably priced, some fascinating things to look at inside the pub

site_logo

Jonathan Weavers . 2024-07-11

MORE AT Google

We went unannounced - group of 11 as we were camping at Waxham nearby. Couldn’t have been more welcomed. Great food fab service. Lovely staff. Beautiful historic pub. Loved it.

site_logo

Steve H . 2024-07-10

MORE AT TripAdvisor

Great "take us as you find us" pub, friendliness in spades and fantastic food.

site_logo

Viv Marsh . 2024-07-05

MORE AT Google

The fish and chips and scampi and chips I would recommend. The staff are really friendly and Dogs are more than welcome. A true traditional pub. They let me leave my van there as we went to see the seals.

site_logo

Garth Brooks . 2024-07-01

MORE AT Google

Excellent bar man gave me a taster of the cider before buying was very knowledgable !! Food was lovely - garden amazing . Service great . Would defo return again .

site_logo

Debbie . 2024-06-29

MORE AT TripAdvisor

Just had a meal and a drink outside in the beer garden, food came really quickly and was lovely! I had the fish finger sandwich, which came with chips and salad. I had enough chips to share with my wife who had a really nice jacket potato with chilli. Now the fish fingers were huge! Flaky fish in a crunchy golden batter, served with tatare sauce, both looked homemade and were delicious!

site_logo

Lee Foster . 2024-06-28

MORE AT Google

Tucked away in Horsey, not far from the windpump and in walking distance to the beach. You can also take a permissive walk from the windpump, which is nicer than the road route. Huge meadow opposite, with picnic tables. We stayed 50 yards down the road and so far have eaten there twice. Friendly staff. Dogs welcome. Fish and chips is huge, vegetarian meals on offer .. I had a vegetarian curry I couldn't finish. They do ask if you park there that you also use the pub, which is fair enough as it would be rude not to. Landlord and his dog are friendly too.

site_logo

Fearless02629640805 . 2024-06-26

MORE AT TripAdvisor

We stopped off here before a walk. Lovely traditional pub food, delicious. Very friendly staff and atmosphere for a lunch time excellent

site_logo

Sue Sargent . 2024-06-25

MORE AT Google

Great out of the way pub with lots ale and cider choices and good food

site_logo

STEPHEN GANNON . 2024-06-17

MORE AT Google

Absolutely fabulous place, staff very friendly n hard working, they're a credit to the pub....very dog friendly which is a bonus, this little pub is well worth the long walk or drive to.....well done ✔️ 😀

site_logo

Deb Hill . 2024-06-11

MORE AT Google

Went in for some food, did an excellent crab sandwich. Nice pub

site_logo

Gary Baker . 2024-06-09

MORE AT Google

Excellent food , atmosphere and very friendly staff, shame we only have a chance to enjoy the Nelson when we are on holiday , great craft ales and cider

site_logo

Bruce Ferguson . 2024-06-06

MORE AT Google

Lovely traditional pub with a wide selection of beers and ciders. Would have loved to stay for longer but unfortunately had to drive so couldn't take full advantage..

site_logo

Stephen Plummer . 2024-06-04

MORE AT Google

Enjoyed a lovely lunch in the sun after a short stroll back from the beach, has a lovely big beer garden with plenty of seating areas very dog friendly too, food was large portions and very nice would deffo return

site_logo

tinkabell123 . 2024-06-03

MORE AT TripAdvisor

Brilliant food, friendly staff and great range of beers and ciders

site_logo

Sophie Thornley . 2024-06-03

MORE AT Google

The kitchen must have been woefully understaffed. We waited 1 hour 35 minutes for a weekday lunch, which is just unacceptable.

site_logo

grumpytyke . 2024-05-31

MORE AT TripAdvisor

A must visit to a proper pub with lovely food 👍

site_logo

Chris Butcher . 2024-05-31

MORE AT Google

One of the worst pubs I’ve been to in a long time. The family dining area smells of urine from the pretty men’s toilets next door. The table we sat down at hadn’t been cleaned. The service was dire - when ordering food they said it “might take a while”. 1.5 hours later it still hadn’t turned up. No refund, no offer of free crisps that we ordered because we had too famished children with us. Just a dire experience. Understaffed too.

site_logo

Oliver Smiddy . 2024-05-30

MORE AT Google

Cosy, comfortable and local - welcomed us with muddy boots and paws and made us and our dog feel like part of the family! Recommended some excellent local ales and we had some great conversations with people who were living on and touring the Broads

site_logo

Aimee Haynes . 2024-05-30

MORE AT Google

Unchanged for decades, which is a good thing. Staff were very friendly & welcoming. Great outside space, with tables on the road & large grassy area. Excellent choice of beer...bitter & IPA.

site_logo

Adrienne Law . 2024-05-28

MORE AT Google

What a lovely lunch before a walk to the beach which is 20mins away. Arrived to an empty bar which within 10minutes was full of families, dogs and couples all enjoying the Sunday sun. The staff were brilliant from talking us through the ‘still’ cider on tap to the food menu. Food arrived hot and plentiful. Fish n chips were brilliant. The Nelson is a traditional pub with a great food, a great atmosphere and great beer/cider. Thankyou

site_logo

Ian & Pauline . 2024-05-19

MORE AT Google

Beer nelson revenge great and the main point it's very reasonably priced £ 3 60 a pint ,staff brilliant and food very good 👍

site_logo

Eddie Bagley . 2024-05-18

MORE AT Google

Lovely crab sandwiches and chips. Quiet location with a very relaxed vibe. Traditional pub

site_logo

Jo Aldridge . 2024-05-09

MORE AT Google

Lovely pub, perfect for a post beach pint after a visit to Horsey Gap to see the seals. Had a big garden for play and sitting but sadly we couldn't get food because the kitchen had closed.

site_logo

Jahulath . 2024-05-06

MORE AT Google

Called in on my way to view the seals on Horsey beach. Received a warm and friendly welcome and the couple of local ales I tried were good and in good condition.Didn't try the food, but was came out of the kitchen all looked good. Well worth a visit if in the area.

site_logo

P H . 2024-05-03

MORE AT Google

Lovely food. I had fish and chips and it was a very good portion and served hot. From here we walked towards Horsey Gap about 20min including dog stops and sniffs along the way and then used same route back. They allow people to leave cars there to go and see the seals but ask to also use the pub for food or drinks. Great pub!

site_logo

Maricor Roberts . 2024-05-01

MORE AT Google

Called in for lunch with our two doggies before walking down to Horsey Gap to see the grey seals. Lovely meal served by very friendly staff, lovely homely traditional English pub decor. Was great to know we could leave our camper van in their carpark whilst going to see the seals as the main carpark for Horsey Gap doesn't allow camper vans.

site_logo

Simon Roberts . 2024-04-30

MORE AT Google

Had a delightful lunch at the Nelson Head. The pub is very atmospheric. However at lunchtime- if you want a starter as well as a main meal you get the two courses served together. A little off the wall.

site_logo

Kris Allers-Stone . 2024-04-09

MORE AT Google

Huge plates of good value food.

site_logo

Ian Taylor . 2024-04-06

MORE AT Google

What a fantastic place! Having had a lovely morning at the beach visiting the Seals we travelled into Horsey where we stopped at the Nelson Head. We received a very warm welcome before sitting down to an extremely tasty lunch. What made our visit more of a challenge was we were a group of 15! Despite this fact the team at the pub were awesome and were very helpful and catered for all our needs. I highly recommend you add the Nelson Head to your plans when visiting the local area.

site_logo

Keith G . 2024-04-04

MORE AT TripAdvisor

We could not eat because of a party of 20 turned up at the last minute so they had run out of food. But the menu and staff looked great staff were most helpful.

site_logo

Stuart Crowe . 2024-04-03

MORE AT Google

Lovely pint of cider after a 5 mile walk.🙂👍

site_logo

Kevin Taylor . 2024-04-01

MORE AT Google

The food here was absolutely amazing and would definitely recommend coming in, especially if you’re going to look at seals on the beach.

site_logo

Jack T . 2024-04-01

MORE AT TripAdvisor

I had been hiking along the coast and discovered this lovely secluded old pub when I went inland. Wonderful selection of traditional ciders. Excellent young staff who were most accommodating and gave me accurate directions on how to travel by public transport to Cromer.

site_logo

Peter Riches . 2024-03-30

MORE AT Google

A perfect find. We visited for lunch based on TripAdvisor reviews and they were not wrong. Friendly greeting on arrival, good choice menu and specials. Portion sizes were generous and food you could not fault. Dog friendly. So glad we gave found this gem.

site_logo

angelapT2958FQ . 2024-03-27

MORE AT TripAdvisor

Stayed overnight in our campervan at the pub at the agreement with the landlord and spent a very pleasant evening. Good selection of real ales and food fantastic! Dog friendly. Staff and feel of the place was excellent. Definitely coming back/

site_logo

Jcepxw . 2024-03-24

MORE AT TripAdvisor

Similary restaurants in East of England

restaurant_img
4.0

277 Opinions

location-iconMarket place
British
outdoor_seating_200826takeaway_200826delivery_200826

It pains me to say this however I was a regular since this opened until last few months. All of the staff pretty much left and unfortunately the quality of drinks has really declined as has the customer service. I feel alot of the time staff have little idea of what they are doing. I now do not use costa as the quality has declined

restaurant_img
4.0

3583 Opinions

location-icon1 New Street
British
outdoor_seating_140259takeaway_140259delivery_140259

Fish and chips served freshly cooked in a nice light batter. We treated ourselves to fish and chips here. It is on the pricey side for fish and chips but the staff and environment made it decent value. The views from the table were also nice, especially as it was a cold day. Toilets were nice and clean and hot water to wash and warm hands up. Good that we arrived at 12noon opening time as we could choose a table with a good view. It was busy when we visited. Overall will go again and again go early.

restaurant_img
4.0

101 Opinions

location-iconOld Yarmouth rd
British
outdoor_seating_176230takeaway_176230delivery_176230

Stayed for one night, all the staff were friendly and helpful, the room was spacious, clean , light and comfortable with an excellent bathroom. Breakfast was very good with an excellent choice of freshly cooked food, cereals, pastries and fruit. Will definitely return and would certainly recommend staying here

restaurant_img
4.0

712 Opinions

location-iconThe Street
British
outdoor_seating_184908takeaway_184908delivery_184908

I have to be honest, we can't describe how disappointed we were with our Christmas day dinner 2024. We spent £330.00 for four of us, and we didn't even receive a drink on arrival. Instead we were ushered to the back of the pub having waited about 15 minutes to get to the bar due to the locals being served. Rubbery potatoes, and cold veg, chewy, fatty, beef. Spending this sort of money, I expected better treatment. Very disappointing. Will definitely be cooking Christmas dinner at home in future. Shame.

restaurant_img
4.0

130 Opinions

location-iconThorpe Market Rd
British
outdoor_seating_164226takeaway_164226delivery_164226

we had been recommended this restaurant, so was looking forward to it. sorry but very disappointed had a toasted turkey sandwich and chips with gravy, the turkey was a piece of very chewy cardboard (couldnt call it meat). the sandwich itself was very dry. when the young lady collected my plate she asked if all was well i said no it was dry she said there was gravy to dip it in. never dipped a sandwich in gravy before. not very helpful, shant be going again