GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.6

Based on 686 opinions finded in 3 websites

site_photo4

Nº 82 in 573 in Chelmsford

Nº 4 of 25 Indian in Chelmsford

CUSTOMERS TALK ABOUT DISHES WITH..bananamustcurryroastchickencookedmeatspicyfishladyricevegetableoldcoconutchillilambprawn

comment_iconOpinions

Yummy food, friendly service and good prices. Would definitely return!

site_logo

Chelsey-Ann Stuart . 2024-11-12

MORE AT Google

Had a meal with the lads. Great host, superb food. Good prices, very authentic

site_logo

Steve Shoosmith . 2024-11-12

MORE AT Google

Great local Karalan food good menu friendly service good luck the local beer is great as well

site_logo

Bruce Hanley . 2024-11-09

MORE AT Google

Very lovely environment and staff was sooo Goooooddd

site_logo

angel mariya . 2024-11-03

MORE AT Google

I had a fantastic experience at this restaurant. The ambiance was cozy and the staff was incredibly friendly and attentive.

site_logo

Damodaran G . 2024-10-30

MORE AT Google

The old Live Dosa renamed to Grand Cochin but still authentic quality South Indian, Keralan food including Dosas. Very reasonable prices. No tea available, didn't ask about coffee, Kingfisher and Cobra bottled beer, wines etc.

site_logo

Andy Botwright . 2024-10-21

MORE AT Google

Very nice atmosphere…songs .. delicious food, chattichor . Highly recommended and great service.

site_logo

Reethu Mariya . 2024-10-17

MORE AT Google

Absolutely loved my dining experience at grand Kochi ! From the moment I stepped in, I was impressed by the ambiance and welcoming staff.”

site_logo

ameershahal Uk . 2024-10-17

MORE AT Google

Grand Cochin in Chelmsford is a spot for authentic South Indian cuisine, particularly specializing in the flavors of Kerala. The restaurant offers a cozy, welcoming ambiance with attentive service, making it suitable for both casual dining and special occasions. They offer dishes like appams, dosas, and a variety of spicy curries, the menu offers a great balance between vegetarian and non-vegetarian options. Chatty choru is one of their specialty. It is located near to the Chelmsford Bus and train stations.

site_logo

Anith John . 2024-10-15

MORE AT Google

Service was awful from Aji, atmosphere was awful, food was awful and the worst part is I got food poisoning. Avoid this restaurant at all costs.

site_logo

K Cee . 2024-10-12

MORE AT Google

The Idli I ordered had three but it was very very small. The size was very disappointing!! The two idlis had a size for one.

site_logo

Merin . 2024-10-11

MORE AT Just Eat

Good food and great atmosphere. Great service and kind owner.

site_logo

Sid K . 2024-10-10

MORE AT Google

Very nice food and customer service. Good ambience.

site_logo

Eldho M Jossy . 2024-10-10

MORE AT Google

If you’re craving a taste of Kerala, this restaurant is a hidden gem that you shouldn’t miss. Their porotta and chattichor are an absolute must-try.

site_logo

Sreelej Sreedharan . 2024-10-10

MORE AT Google

Had a great time with my friend. And good service by the staff.

site_logo

Joel Changayil Kizhakkethil Daniel . 2024-10-10

MORE AT Google

Nice spot for evening dining. Nice ambience.

site_logo

Vijay Prakash . 2024-10-10

MORE AT Google

Awesome ☺️ yesterday we had a group of friends tried Indian dishes especially Kerala spicy 🌶️ curries.. it’s taste still mind blowing and really authentic and the service was really helpful and friendly.. we are proudly recommending this wonderful restaurant to all our friends… back soon.

site_logo

Albin Ann . 2024-10-05

MORE AT Google

Went there last with my family and even after ordering food we needed to wait for almost 45 minutes for the arrival of our dinner . I should firmly say that even the plates provided here are not properly clean and most of the other tables were loaded with residue of others plates. No one even bothered to clean it. Also it's the first time I found an Indian (Kerala) restaurant with the worst preparation of Chicken manthi . So waste of money, and time. The rest of the family ordered Porotta and prawn masala which was also really the worst food we had in the entire UK. Also the hand wash was blocked with water and food residue which leaves the place nasty . The food regulatory authorities should take strict action against this worst provider by having the name of Kerala restaurant. Not recommended at all ..

site_logo

Sion Jos . 2024-10-03

MORE AT Google

Not tasty, not good value for money. Dry and flavourless.

site_logo

Claire . 2024-09-27

MORE AT Just Eat

Grand Cochin in Chelmsford is a delightful gem for anyone craving authentic Indian cuisine, particularly dishes from the Kerala region. The menu is filled with a wide variety of flavorful options, but it’s their Kerala specialties that truly stand out. The rich use of coconut, spices, and fresh ingredients in traditional Kerala dishes like their fish curry, parotta and beef fry is exceptional. Each bite feels like a journey through the coastal flavors of Kerala. The ambiance at Grand Cochin complements the food perfectly. The decor is modern yet warm, with a subtle nod to Indian culture, making it an inviting space for both casual dining and special occasions. The staff are attentive and friendly, adding to the overall pleasant dining experience. Whether you’re a seasoned fan of Indian cuisine or a first-time visitor, Grand Cochin offers a memorable culinary experience with its authentic flavors, excellent service, and charming atmosphere. It’s easily one of the best spots in Chelmsford for a taste of Kerala.

site_logo

Barathnivash Panneerselvam . 2024-09-22

MORE AT Google

Best food, great atmosphere and friendly

site_logo

justin james . 2024-09-20

MORE AT Google

The best place in chelmsford which serves delicious food from kerala. And the owner jose chettan has a great personality and friendly to the customers.

site_logo

Anlin Joy . 2024-09-20

MORE AT Google

We tried this place today for first time and it was great. The food was great and we had a good fun with Joseph as well. Highly recommended!

site_logo

Karthik Balu . 2024-09-19

MORE AT Google

"The food was disappointing and didn't meet my expectations. It wasn't as good as I had hoped."

site_logo

Jomon . 2024-09-19

MORE AT Just Eat

Had a scrumptious and authentic Onam Sadhya! I had a great experience dining here with the most warm and welcoming staff. Their service, quality of food and hospitality is commendable and definitely feels like a journey back home! Special mention to Mr Joseph and Ms Jithu for their infectious smiles and friendly service. A must visit at Chelmsford! 😊

site_logo

Letisha Thomas . 2024-09-15

MORE AT Google

Good food loved the chatti chore will be back soon ❤️

site_logo

Achsa Binoy . 2024-09-06

MORE AT Google

Great place for family and friends to have a quality of time.

site_logo

Sanjana Santhosh . 2024-09-06

MORE AT Google

Delicious food and the service is really good.

site_logo

George Siby . 2024-09-06

MORE AT Google

It was amazing to have an experience with the grand cochin Chelmsford. The shop feels like our home... The food was amazing. We ordered chatti chor, pal kappa with fish... Oo gosh the food was so good.. like our mother cook in our home, exactly feels like our 🏡. Also, amazing customer service. Overall nice experience. Thank you grand cochin.

site_logo

Roshna Babu . 2024-08-10

MORE AT Google

The food was delicious and the staff very friendly but service was somewhat chaotic.

site_logo

Alastair Swaffer . 2024-08-09

MORE AT Google

Amazing food and drinks. Definitely would recommend. 🫶🏻

site_logo

Joesen Roy . 2024-08-09

MORE AT Google

Amazing food and service! Peaceful atmosphere and great south Indian cuisine. The staff is really friendly and welcoming!

site_logo

Nithin Narayanan M . 2024-08-09

MORE AT Google

Amazing food with excellent customer service 🥰❤️

site_logo

Nanda Krishna . 2024-08-08

MORE AT Google

Absolutely amazing service by the staffs and serving fresh and hot delicious foods without any delay.🤌🫠 Highly recommended👍

site_logo

Mayan Mohit . 2024-08-05

MORE AT Google

OKish! Flavours aren’t anywhere close to Kerala food. Honestly quite disappointed. Biriyani is the only item I would recommend from here.

site_logo

Nikhil . 2024-08-04

MORE AT Google

Highly recommended to anyone looking for Kerala cuisine in UK! As someone who grew up with authentic Kerala cuisine, I was delighted to find a place that captures the essence of home. Friendly staff and reasonable price for a wide variety of Kerala dishes they offer. I tried Chattichoru and it was absolute divine. Can't wait to try other dishes in the menu.

site_logo

SHOBIN MATHEW . 2024-08-04

MORE AT Google

I lived and worked in Kerala for 18 months and loved the food there so I am hard to please when it comes to Indian food in the UK and I was nervous about being disappointed again. However, I needn't have worried as the food was excellent, just as tasty as I remembered it. The service excellent, attentive but not in your face, and not long to wait. Hard to judge the atmosphere as it was early on a Wednesday evening. I certainly will be going back

site_logo

I T . 2024-08-02

MORE AT Google

Ordered in based on all the reviews online and was completely disappointed. Ordered biryani, chicken roast and mandi. The chicken in biryani was probably old as it tasted really bad. The roast is made with some boneless chicken and does not taste anywhere close to a Kerala chicken roast. I am not an expert with Mandi and have only tasted in once in India and the rice does not taste anywhere close to the one we get in Kerala restaurants, the chicken was a bit okay. But overall not worth the money and hype.

site_logo

Niji Das . 2024-07-29

MORE AT Google

Tasty food! Highly recommended.Nice service by Joseph uncle.Will visit again.Thanks very much.

site_logo

CHINNU BABY . 2024-07-29

MORE AT Google

Awesome dining experience. Authentic kerala restaurant. Great service by Joseph chettan and team.

site_logo

Kashyap S Babu . 2024-07-29

MORE AT Google

Authentic kerala food with josettan comedy = Dignity

site_logo

Arjunraj KTN . 2024-07-29

MORE AT Google

it was very awful... no taste at all.... never had such food in my entire lifeee

site_logo

Jayachakra . 2024-07-28

MORE AT Just Eat

Delicious authentic South Indian food. Delighted to have found this in Chelmsford and will be back! Loved the chicken roast especially

site_logo

Jonathan Pollick . 2024-07-27

MORE AT Google

Excellent service and amazing food. Loved it.

site_logo

ARAVIND MP . 2024-07-27

MORE AT Google

Feels like Awsome....more scrumptious and delicious food 😋

site_logo

Sneha Sara John . 2024-07-25

MORE AT Google

I ordered chicken manthi, the taste was very good and well organized staff, neet and clean area. Thank you so much.

site_logo

Chinju Shaji . 2024-07-25

MORE AT Google

Nice food, lovely smiling staff and the owner too. Paratha there was so authentic, flaky and crispy, exactly how it's meant to be. Will be back again soon.

site_logo

Satish Kumar . 2024-07-24

MORE AT Google

Had a lovely meal for two on a Sunday evening. The service was very friendly and attentive. The food is delicious, especially the dosa dishes. They have recently undergone a rebrand (used to be Live Dosa) and the menu has been upgraded to include a few new dishes. Recommended!

site_logo

Gareth Morris . 2024-07-22

MORE AT Google

Definitely recommend this restaurant because of its homely food and good service

site_logo

BIPIN T . 2024-07-20

MORE AT Google

Exceptional south Indian dishes and excellent service highly recommend

site_logo

simna jain . 2024-07-20

MORE AT Google

Delicious food and very good service. Highly recommend..

site_logo

Dona Benny . 2024-07-18

MORE AT Google

We ordered chatting chor and kappa biriyani. All the food was so delicious and the customer service was so good. Also, the atmosphere was good. All total good service and experience.

site_logo

Misha Roy . 2024-07-18

MORE AT Google

Excellent food.Tried chattichooru love it super tasty.exceptional service by joseph chettan

site_logo

Josma Joseph . 2024-07-18

MORE AT Google

My best expernce with Nadan food...with cheap price and authentic experence.

site_logo

ARUN GK . 2024-07-15

MORE AT Google

Quality service and food really good experience ❤️

site_logo

Bazil Sabu . 2024-07-15

MORE AT Google

Worst food that I ordered ever. So disappointing, never recommend to anyone. Kuzhimandhi rice is soooo sticky, no aroma or no flavour at all. Paalkappa was fine but fish curry is just a pureee of onion and tomato without fish . Totally waste of money

site_logo

Anu . 2024-07-11

MORE AT Just Eat

excellent.... nice food.. enjoyed 🥰

site_logo

Darvin . 2024-07-11

MORE AT Just Eat

Amazing food and service. Would recommend

site_logo

Julie matthew . 2024-07-10

MORE AT Google

Indian food with a difference , excellent food and friendly service

site_logo

Jeff Macklin . 2024-07-10

MORE AT Google

The best biriyani i have had at Chelmsford. Not only food, customer service as well as the quality ambience it provides deserves praise. Thank you for the great experience.

site_logo

Vivek nair . 2024-07-10

MORE AT Google

Good experience, delicious and tasty food. Nice service. Must recommended.Especially Joseph chettan nice service and customer dealings.

site_logo

Ansu Saji . 2024-07-04

MORE AT Google

I loved the food because it reminded me of my home. I would certainly come back as Joseph chettan and all the other staff were so hospitable. It was almost like coming back to home.

site_logo

Angel Ann Maria . 2024-07-04

MORE AT Google

goood food , goood ambience!! must tryy !!

site_logo

Akhil Sankar . 2024-07-01

MORE AT Google

Food is really good and amazing customer service. Enjoyed the food with beautiful songs and ambience. Must go for everyone especially mallus ✌️

site_logo

Devika Shivakumar . 2024-06-30

MORE AT Google

Joseph bro’s service and his behaviour towards customer is really nice. Food is really tasty and quality & quantity was also great.

site_logo

ashish kumar . 2024-06-30

MORE AT Google

First time in here,Just went in to order a fish curry, the person taking the order was dismissive so first impression not great. Food was ok nothing to write home about. Hope it gets better.

site_logo

Robert Kurian . 2024-06-30

MORE AT Google

Dining at Grand Cochin was a memorable experience.The cozy setting and friendly staff made us feel right at home.We all left happy and satisfied.

site_logo

Jerly James . 2024-06-30

MORE AT Google

Grand cochin is a very pleasant resturant, with delicious authentic food.

site_logo

amy abraham . 2024-06-29

MORE AT Google

Good food yummy and authentic, pleasant behavior of the staffs , pleasant music , ambience

site_logo

Anupama MS . 2024-06-28

MORE AT Google

Had chicken mandhi today. Was really tasty and had a good quantity of food. Also had a good customer service.

site_logo

josna jose . 2024-06-28

MORE AT Google

It was so good. Food was very tasty and fabulous.

site_logo

Melvin jose . 2024-06-26

MORE AT Google

Good food , hygiene good service

site_logo

Aswin Krishna . 2024-06-26

MORE AT Google

Good quality food, must try items , nice atmosphere .

site_logo

Sreelekshmi Ks . 2024-06-24

MORE AT Google

Best experience ever, awesome food must try beef biriyani.

site_logo

Rahul Krishnan. R . 2024-06-24

MORE AT Google

Palkappaa and beef I ordered from was so delicious loved it must try dish🥰❤️

site_logo

chanana padmanabhan . 2024-06-24

MORE AT Google

Good food and good service. Enjoyed South Indian beef biryani after long time in a soothing environment.Food is Worth the rate.

site_logo

Shalima Mc . 2024-06-24

MORE AT Google

Food is very worth to the money , especially the Biriyani was fabulous ❤️🥰

site_logo

Seemanth Vayakkara . 2024-06-24

MORE AT Google

Exotic Indian food. Lovely ambiance. A must visit if you come in Chelmsford.

site_logo

37 Meenu Pradeep . 2024-06-24

MORE AT Google

We had a group of 6 having dinner with our friends, it was wow

site_logo

Tissa C Thankachan . 2024-06-22

MORE AT Google

The best kerala food in Chelmsford includes chattichor, beef, pazhampori, and mandhi with affordable price. Joseph Chettan and his team are excellent hosts, and I appreciate the wonderful experience.

site_logo

VYSHNAV T R . 2024-06-22

MORE AT Google

Authentic kerala food, must try chatti chor. Great Ambience 👍

site_logo

Sojan Thomas . 2024-06-22

MORE AT Google

Grand Cochin in Chelmsford offers an exceptional South Indian dining experience. The moment you walk in, the warm and inviting atmosphere, combined with the friendly and attentive staff, makes you feel right at home. The menu is a treasure trove of authentic South Indian dishes, bursting with rich flavors. The Kerala-style fish curry and crispy dosas are standout choices, each prepared with the perfect blend of spices. The desserts, especially the payasam, are the perfect sweet finish to the meal. As a South Indian, I highly recommend Grand Cochin. The food is authentic, the service impeccable, and the overall experience unforgettable. If you're in Chelmsford and craving true South Indian cuisine, this is the place to go.

site_logo

Adarsh PS . 2024-06-21

MORE AT Google

Why So Many BAD REVIEWS? Food nice enough. The Manager we found to be a bit in ya face; Asked for a spoon, which shoulda been given 1 withOut asking meself, really: He pointed to the spoon designated for another Dish! Dfuq bro!? wha gwan with that? [think, as we werent western [English etc]; he took a liberty by being a bit overly familiar and overstepping boundaries - he was a "habitual line stepper!", as the late great CHARLIE MURPHY would say lol] Jokes aside: The younger waiter-who stands by the door in a Bouncer's outfit, was cool, easy going, openminded, hospitable, as well the other, bigger, less formally dressed waiter - towering over tables with his taller frame, slightly hunched over, wearing jeans, et al, respectively :) - They're both 2 REALLY NICE Guys! [again, separate to the 2 younger lads; the Manager, who was actually smiley a.f. in general, which was nice, and chatty/making small talk with English ppl tho, not us - damn shame! Q. for you, big Sir: Didn't u feel the need to try as hard with us tho, is that right? - With your very same community of ppls, no? 🤦🏽‍♂️ So, the Foodings: -veg somasa, above average+) -the chicken korma, lots of sauce, decent amount of chicken pieces - a few more would have been good! TIP: - if just ya getting the korma chicken for a main course - its not enough imo.. -good thing we got the veg biriyani rice- that was nice still! 4/5! -paneer dosa was good!! :D THE MISSUS loved it - 'best indian food in chelmsford- I found it!' We'd been here a coupla times prev - eaten in and had take out - so guess good enough for a repeat return visit:] DISCLAIMER: its the1stime written review tho :) (the boy kinda said for us to do so lol - the bigger Totoro guy 😸 said we can hire the whole place out for bdays parties etc.... ...k, we get it, they want the biz and the google reviews, fine sure - albeit, was a bit of a reach/ask - but I guess its okay - tbh it wasnt that that bad lol - they're both actually legit nice lads in my exp tbf!:) ...Again, another Question [2]: for the Manager: can you genuinely just relax man? AND [3]: make ALL of your Customer's also really be truly relaxed, too?? x He came over, asked how food was standard Q's; he saw there were piled up plates and used tissues on the table; did he get them cleared up? Did he fk! We literally saw him saunter over to the table in front of us with the older white ladies - and clear up their table himself, no less - this aint a a racial ting BUT what else can I say? Help me out here bro! :D Lastly-ish, needed the food for me to be mild and the chilli chicken was said to be okay; "we'll make it mild for you" but atch wasn't so mild - was eatable too - u know, u dont want food to be so chilli/spicy that u cant enjoy it, get me? :) only ordered the chilli chick, AS I asked for Chicken Manchuiarian - chilli-ish chicken balls, they didnt make it, so I got the chilli chicken seen? :D ps was a bit expensive ? ish :) Love! - Feedback is NEVER PERSONAL: It's just feedback bout our own very individual experience - remember that, n IF only you can MAKE THE NECC IMPROVEMENTS - of course, only IF you guys really care about ther business, and the customers' real experience, of which that I AM, who is allowed to share their opinion, then there'll be more comfort and a natural authentic reason for us to tell our friends and colleagues ourselves, and Not just cos u told me to, do u get me? :D xx I'd like to come back with me mates ? :) visited feb 2024

site_logo

s P . 2024-06-12

MORE AT Google

Had a pre Theatre Masala Dosa and accompaniments. Great food and great service. Thanks

site_logo

Gerry Bender . 2024-05-20

MORE AT Google

Very nice and tasty food, I recommend to everyone atlist tray once from here.very nice ambience and good vibes

site_logo

DANIMOL SEBASTIAN . 2024-05-20

MORE AT Google

Enjoyed your food. Its nice & tasty. Also thank you so much for your service.

site_logo

Thrishali Perera . 2024-05-20

MORE AT Google

Love this place, wonderful food & quick service - Masala dosa for lunch today was just perfect for a slightly hungover start to a sunny Sunday, they are the best

site_logo

Roxanne Needham . 2024-05-19

MORE AT Google

Hands down the best restaurant I have been to, from the service to the food, to be made to feel so welcome and Joseph's people skills, we laughed a lot!!!. All dishes were obviously completely fresh and the Poratta were out of this world. Everything we had, we had not tried before, chilli paneer, chicken 65, chilli beef, and I personally loved the Chettinad Chicken as it was lovely and spicy. Everything was cooked to perfection. As a table of 6 friends, who only see one another twice a year, it was a refreshing change not to be rushed, it really was a lovely relaxing evening. I wish this restaurant was just up the road from me!!! Highly recommend.

site_logo

Vikki Ashford . 2024-05-13

MORE AT Google

I had great time in this restaurant..food was really incredible and the owner was really friendly…Definitely will try again…

site_logo

Franklin Mathew . 2024-05-04

MORE AT Google

Really delicious food and excellent service.

site_logo

Treesa Mathew . 2024-05-04

MORE AT Google

Well served ,amazing customer service ❤️

site_logo

Amalendu A.R . 2024-05-04

MORE AT Google

Really delicious Kerelan food and some of the best Indian food we have eaten outside India. The owner was really helpful ensuring we didn’t order too much - we didn’t realise how huge the dosas were going to be! The samosas were possibly the best I’ve ever had, so crispy, tasty and not greasy at all. Chef certainly knows his spices as the food was hot but wasn’t just chilli’s. Will be going back very soon to try some other dishes. Highly recommended

site_logo

Chrissy Morris . 2024-04-30

MORE AT Google

Lamb was over cooked and sauces in both dishes were very average but seemed like jars from tescos nothing but sauce and meat. Also dips for popadoms were not up to scratch.I’ve been to India many times and the food here is nothing like. Staff were very friendly but food needs to improve also needs a bit of a refurb.

site_logo

Aaron Feeney . 2024-04-21

MORE AT Google

Really pleased with their Vishu sadya(Kerala meal feast) . Saved me from a Nirmal frozen sadya horror😁 They don't have Kerala meals in the menu which is a bit disappointing 🙄

site_logo

Meera Mahesh . 2024-04-20

MORE AT Google

Had a really great experience. Tried chilly chicken and appam and fish. Food was delicious.

site_logo

Anisha Tandon . 2024-04-19

MORE AT Google

Super sadhya… Wow …. You need to book a seat before you visit there… HAPPY TUMMY😋😋

site_logo

Sajana Sajan . 2024-04-14

MORE AT Google

Service was terrible - we were expected to pass very hot plates down the table for both starter and mains Good was generally very sweet. Red wine was poor quality. Toilets not clean

site_logo

Sally Driscoll . 2024-04-13

MORE AT Google

We were a group of 8 people and decided to have dinner at this establishment because we really wanted to try Authentic South indian food. The food was great along with service. The host was very lovely and helped us with ordering some of the food. I highly recommend this place!!!

site_logo

womens alley . 2024-04-13

MORE AT Google

Excellent food ever had......Live Dosa⏩Love Dosa ❤️

site_logo

Shalden Aj . 2024-03-30

MORE AT Google

The best of all I ever had in UK.The Porrotta bread was super soft and Beef roast was well cooked with our loved kerala spices.Super happy to share the review before leaving the restaurant.Friendly staff and well maintained ambience. Foodies can't ignore LIVE DOSA.To be frank It's "Ours".......nothing else to say....Luv it "Live Dosa"♥️♥️♥️

site_logo

Thejus Santhosh . 2024-03-30

MORE AT Google

Similary restaurants in East of England

restaurant_img
4.5

757 Opinions

location-icon30 Rainsford Road
Indian
outdoor_seating_153633takeaway_153633delivery_153633

Decent Indian restaurant. The fact that it has been around in various incarnations for the last 40 years (that I know of) is a testament to the consistency in food and service. We had a 7pm table booking on a Saturday night, and it was BUSY and therefore noisy! Every table was occupied, and as soon as a table cleared, it was being dressed and occupied by another group of diners. Food selection is good, and the quality is excellent. It took slightly longer than usual between courses, but given how busy that could be expected. Price for dishes are where they should be, and overall, the experience was enjoyable. Would recommend

restaurant_img
4.5

22 Opinions

location-icon4 Baddow Rd
Indian
outdoor_seating_326156takeaway_326156delivery_326156

Had dinner here with friends on a Saturday night. Booking on line didn’t work so booked face to face in the restaurant in advance. The food was excellent, fresh and tasty. Service was friendly and genuine. The food is cooked within a couple of feet of the seating area. Loved the authenticity. Guessing that this is family owned and run. Good value as well. We will be back.

restaurant_img
4.3

1047 Opinions

location-icon1 Bridge Street, Writtle CM1 3EY England
Indian
outdoor_seating_249335takeaway_249335delivery_249335

Delicious food, amazing hospitality and great ambience.

restaurant_img
4.2

95 Opinions

location-icon159 Robin Way
Indian
outdoor_seating_153977takeaway_153977delivery_153977

Lovely fresh tasty Indian food one of the best in Chelmsford for an Indian takeaway

restaurant_img
4.2

333 Opinions

location-icon9 Baddow Road
Indian
outdoor_seating_153694takeaway_153694delivery_153694

It was a Monday night in late October so out group of 7 were the only ones in at the time we visited. I think this was just an odd quiet time. Staff were super friendly and helpful. Birthday person got a bottle on the house. We also were given a box of mints not just one each! Portions were generous. Including the chutney. All came out hot. Great mix of flavours. I particularly liked my chickpea main. All were in agreement we were glad we went there. Management thanked us and shook our hands at the end. Nice to be in somewhere that appreciates your custom.