GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 308 opinions finded in 3 websites

site_photo3

Nº 112 in 538 in St. Helens

Nº 15 of 79 British in St. Helens

CUSTOMERS TALK ABOUT DISHES WITH..roastcookedsteakporkvegetablescoffeepuddingsaladprawnfishchickensalmonbeautifulpotatoes

comment_iconOpinions

Visited for my birthday meal on 9 March. Food was outstanding and service from Gareth was fantastic. He looked after us really well. Would highly recommend.

site_logo

David P . 2025-03-09

MORE AT TripAdvisor

We had the afternoon tea in celebration of my late mother 90 th birthday, she loved going to the houghwood with my late father. As per usual excellent food and service.

site_logo

Philip . 2024-12-08

MORE AT OpenTable

We had a great lunch at Houghwood Golf club. We are not golfers and wondered if the restaurant was open to all - We were made very welcome and dined in the atmospheric brasserie area overlooking the course. Food and service very good. If you are looking for a relaxed lunch in comfortable surroundings and want to get away from the standard pub offering, then would certainly recommend.

site_logo

Mark . 2024-11-29

MORE AT TripAdvisor

Lovely venue, great service and reasonably priced.

site_logo

Stephen . 2024-10-20

MORE AT OpenTable

A lovely 3 course Sunday lunch. I would highly recommend

site_logo

Caroline . 2024-10-20

MORE AT OpenTable

The staff were pleasant and attentive from start to finish. Decent choice of food for Sunday lunch besides traditional roast and the portions were very good. Lovely view and nice setting. Look forward to dining there again.

site_logo

Joan . 2024-10-13

MORE AT OpenTable

The recently refurbished dining room with a fantastic view is always a pleasure to be in. They now have all new modern glass ware, crockery and cutlery. The staff are always welcoming and nothing is too much trouble for them. Well worth a visit for Sunday lunch. We had the roast turkey as the main course which was cooked and presented perfectly. The deserts are always a delight especially the sticky toffee pudding and chocolate brownie .

site_logo

David . 2024-09-15

MORE AT OpenTable

The food was excellent, just not enough of it Sunday roast was very small , so not of good value at all can’t fault the quality but just needs to be more of it .

site_logo

Nicola . 2024-09-08

MORE AT OpenTable

We both had a lovely lunch with excellent views and a really obliging waitress

site_logo

Sheila . 2024-08-30

MORE AT OpenTable

Very enjoyable meal on Saturday evening. Very attentive staff and nothing too much trouble. Quality of the food was excellent. We will be returning very soon.

site_logo

janet . 2024-08-10

MORE AT OpenTable

Myself and two friends had a lovely lunch at Huff Wood we all had the same steak and Stilton sandwich and it was delicious. It was a lovely atmosphere and the staff were excellent

site_logo

Sheila . 2024-08-09

MORE AT OpenTable

No atmosphere, only 2 tables occupied. Seated with sun in my eyes but would not change our table. Food very average. Service slow. Gave us the wrong bill.

site_logo

. 2024-07-07

MORE AT OpenTable

Was beautiful I will be back Angeljojosaesthetics was very happy

site_logo

. 2024-04-14

MORE AT OpenTable

Disappointed - booked Houghwood for birthday meal with family. Menu had no desserts on and asked twice for this. Only told st the end. Food of average quality.

site_logo

ML200 . 2024-04-07

MORE AT OpenTable

Excellent service very welcoming fantastic place to go

site_logo

. 2024-03-30

MORE AT OpenTable

Had a lovely evening to celebrate 2 birthdays, the food was great and the staff were amazing the lady waiting on us was great couldn't do enough for us ,would highly recommend

site_logo

Claire L . 2024-01-30

MORE AT TripAdvisor

Great meet up with special friend who used to work together. Fantastic surroundings, staff very friendly, service excellent. £25 for 3 course Christmas meal! Food could not be faulted, I had prawn cocktail, braised steak, roast potatoes and all the trimmings, Lemon compote. Will definately be back next year! Well Done Houghwood x

site_logo

Jenny . 2023-12-22

MORE AT TripAdvisor

Attended Houghwood with the family, with ages ranging from 14 to 78! We'd booked ahead and were met by very attentive and friendly staff who showed us to our table. We settled in and ordered a few drinks whilst reviewing the menu. Staff were very approachable and we were given such a lovely welcome. Starters we had included Prawn Cocktail, Melon and a Winter Veg Soup. All were very well presented and tasted delicious! The soup in particular was a real winner! All but one of us had the Christmas Dinner, with the Sea Bass being the other option chosen. The Christmas Dinner was simply devine! Beautifully seasoned and every element was cooked to perfection. The Turkey was succulent and there was plenty of it. The roast potatoes were crispy yet fluffy and the vegetables were cooked just right. The gravy was also exceptionally well seasoned! Various accompaniments were offered and the Cranberry Sauce was equally very nice indeed. The Sea Bass was also cooked to perfection and very well seasoned. Desserts followed. We chose the homemade Cheesecake (which was recommended by our wonderful waitress) and also the Christmas Pudding with Brandy Sauce. One of our group just wanted a small portion of Ice Cream (not on the menu) and they were more than happy to do that. Nothing was too much trouble. Drinks were topped up throughout and the surroundings were very festive. We all left fully satisfied with the food, service and settings - highly recommended. We've dined at Houghwood on several occasions and not been disappointed once. I expected a lot from their Christmas Menu and it certainly delivered. Beautiful.

site_logo

SteveTolcher . 2023-12-12

MORE AT TripAdvisor

I’ve played golf here a few times and so booked in to see how the restaurant was. Wow! I was very pleasantly surprised! 5 of us had a Sunday Lunch and it was exceptional. Food was amazing and the staff were super attentive and friendly. Views out of the terrace were just the icing on the cake. Highly recommended.

site_logo

SteveTolcher . 2023-09-03

MORE AT TripAdvisor

We chose Houghwood to celebrate my mum and dad's 50th wedding anniversary. We invited approx 50 people to join us for the celebration. We had a 3 course meal on a Sunday afternoon. On arrival the room was beautifully decorated and tables set out well. Beautiful views, great parking and excellent choice of drinks / refreshments. We had a fabulous time. The food was exceptional, staff were friendly and helpful. All our guests gave fabulous feedback. We had a guest requiring wheelchair access and this was accommodated with ease. The organisation was brilliant. The staff on the day were exceptional..... Big thank you to Jane, Matthew, Jan and Tilly..... you were all fabulous. Highly recommend this venue and will book again soon.

site_logo

Andy . 2023-08-29

MORE AT TripAdvisor

lovely food although a few things had run out so we could not order it.

site_logo

JillA . 2022-02-27

MORE AT OpenTable

Apart from one other table we were on our own. But our food was excellent would definitely recommend Houghwood. Thank you

site_logo

BrendaR . 2022-02-20

MORE AT OpenTable

Once again the food was wonderful, hot and well presented. The service was good and will return again for another visit in the near future.

site_logo

SteveG . 2022-02-05

MORE AT OpenTable

A very pleasant lunch overlooking a very windy golf course. Service was excellent from happy, cheerful staff. Our food was delicious. The a la carte menu changes according to the season.

site_logo

Cranky . 2022-02-04

MORE AT OpenTable

Easy to book, greeted with a smile, nice view of the golf course, service was a little slow but if in no rush it was fine and food was delicious.

site_logo

Craig . 2022-01-16

MORE AT OpenTable

Disappointed as meal spoilt due to sprouts being extremely hard and almost impossible to cut. Also small portions

site_logo

DavidB . 2021-12-17

MORE AT OpenTable

When we arrived we were offered the Christmas menu which had a selection of options. The staff were very good and the food was lovely. Would recommend to others .

site_logo

LorraineR . 2021-12-10

MORE AT OpenTable

Food was absolutely stunning - I had the chicken which was so unusual and inventive! It had little bits of bacon-flavoured popcorn on top and a café au lait sauce, with little bits of bacon. Loved it! And the skin was perfectly flavoured. Pate and chutney was just as good as always - Houghwood can definitely do a good chutney. Only thing I would say is it was very pricey.

site_logo

JessicaP . 2021-11-28

MORE AT OpenTable

Food was lovely and the waiters very nice and friendly. The downside was having to wait 50 minutes before our meal arrived.

site_logo

AndrewT . 2021-11-07

MORE AT OpenTable

Excellent, tasty food. Good menu and good service

site_logo

IanT . 2021-11-06

MORE AT OpenTable

We had a very enjoyable lunch with excellent service and excellent food. Can’t wait to come again.

site_logo

FrancesH . 2021-11-05

MORE AT OpenTable

After playing golf with my brother in the pouring rain we decided to go inside the cafe . We where met with a stoney reception from a waitress who obviously had no people skills who asked us had we booked .Must have been 1/2 dozen people in there . Sat in the corner and both commented that she was not very polite. Ordered coffee and took out our sandwiches which we now know was against the rules. . Instead of just saying sorry you can’t eat your own food in here , she was very condescending and made sarcastic comments. Because of her attitude we walked out . I paid thousands of pounds for my daughter’s reception there a few years back and guarantee we won’t be going back there . Think someone needs to go on a customer service course.

site_logo

Happiness20584426405 . 2021-05-21

MORE AT TripAdvisor

Fantastic food although not a great deal of choice

site_logo

Lloyd . 2020-12-12

MORE AT OpenTable

Food was fantastic, service was perfect and good value for money, I would definitely visit again, I would only suggest that there be a bit of background music on

site_logo

JulesR . 2020-12-06

MORE AT OpenTable

Booked Sunday lunch for my mums birthday. A 1pm sitting. On arrival I was very surprised at the charmless and empty feeling of the restaurant. The tables were bare, save for candles that wouldn't be used and a paper menu. The place just felt unloved and I immediately regretted booking. Staff took drink orders and then we waited, and waited for our order to be taken. Once done, we then waited an unreasonable time for them to arrive. In the meantime I saw several plates if chips and pie coming out of the kitchen for the bar area. The starters were all fine, hot and well cooked. We then waited again for the mains. 2 were beef and the recipients said it was all good. Mine was pork which was so very dry, and it seemed, a smaller portion than the beef. I left a small quantity of the pork and explain, without fuss, to the waitress that the pork was very over cooked. I said the chef could tell from the portion left. We had one espresso and one tea, which the restaurant said would be free as a 'sorry for the pork'. In summary it was a huge disappointment. I also noticed that other diners that came later got their food an awful lot quicker. I was sorry I had booked there.Tip: please try and cheer the room up with perhaps flowers or something. I know we have covid restrictions but we've dined elsewhere and had more of an effort made.

site_logo

Flossfloss123 . 2020-10-18

MORE AT TripAdvisor

The waiter considering all the 'issues' explained everything so we new exactly was expected of us. The meal was tasty and warm.

site_logo

FrancisC . 2020-09-18

MORE AT OpenTable

My wife’s food was cold and was sent back poor choice of vegetables and minuscule potatoes. Dined at Houghwood over the past fifteen years we have always been well satisfied. Very disappointed on this occasion.

site_logo

josephR . 2020-09-12

MORE AT OpenTable

The starters were very good, the main meals, one was poor (rib eye steak) the salmon was good but needed some vegetables with it. Maybe a one off with the rib eye last time it was excellent.

site_logo

DavidY . 2020-08-29

MORE AT OpenTable

The tables were set out properly to government guidelines, the staff knew what to do the food was excellent a really good experience.

site_logo

DavidY . 2020-08-15

MORE AT OpenTable

The overall experience was fantastic the food and service were excellent. The plans put in place for covid meant there were reduced diners but you felt safe and social distancing observed Congratulations to all the team

site_logo

JohnK . 2020-08-02

MORE AT OpenTable

As usual had a wonderful meal at the Houghwood. Been going there for many, many years and never had a bad meal. Keep up the good work Peter.

site_logo

67missy288 . 2020-03-07

MORE AT TripAdvisor

Very nice location - very out of the way but the views are amazing. Everyone was friendly and the service was good. A bit noisy - access was difficult for our elderly parents but we were told as we were leaving, that there was a lift they could have used.The food was tasty and cooked well. Nicest chips and roasters I’ve tasted for a long while. The steak was cooked to perfection.

site_logo

Giframac . 2020-03-06

MORE AT TripAdvisor

Met up with family for a nice get together. Lovely setting great views across to Liverpool and the Welsh mountains. Nice atmosphere although busy the noise levels where not intrusive. The service and the food was very good, portion size and accompanying vegetables were good. Would have no hesitation in rebooking or recommending this venue.

site_logo

JoeK . 2020-02-23

MORE AT OpenTable

we tend to come here for special occasions and have never been let down either by the quality of the food the service or the staff, parkings a bit of a premium as its also a golf club

site_logo

Stanley C . 2020-02-14

MORE AT TripAdvisor

The service was excellent, but the food was awful, I ordered lamb, but it was more like mutton, the port was hard and dry, and the deserts seemed like they had just been heated up in a microwave. Food wise not a pleaser experience for my and my wife. Could not recommend your restaurant.

site_logo

TerryM . 2020-02-14

MORE AT OpenTable

Popped in at the last minute, for a evening meal with elderly mother and wife , new menu was excellent and great service from the staff warm and welcoming as all ways

site_logo

Armerstewart . 2020-02-11

MORE AT TripAdvisor

I booked a table via OpenTable after reading some excellent reviews. We looked forward to our first visit here and were welcomed by the friendly staff. The starters we ordered were delicious but sadly the main course (rump steak and vegan burger) were not all that great. I think the best way to describe the burger and vegetables is 'bland' and tasteless, with a plain white burger bun that you'd get from the local super market. All in all we've have better for alot cheaper. 3 stars because the staff and atmosphere was pleasant and perhaps we just ordered the wrong thing as the meals other diners had seemed nice.

site_logo

O6743VYvictorias . 2020-02-01

MORE AT TripAdvisor

I booked a table via OpenTable after reading some excellent reviews. We looked forward to our first visit here and were welcomed by the friendly staff. The starters we ordered were delicious but sadly the main course (rump steak and vegan burger) were not all that great. I think the best way to describe the burger and vegetables is 'bland' and tasteless, with a plain white burger bun that you'd get from the local super market. All in all we've have better for alot cheaper. 3 stars because the staff and atmosphere was pleasant and perhaps we just ordered the wrong thing as the meals other diners had seemed nice.

site_logo

VictoriaT . 2020-02-01

MORE AT OpenTable

Lovely staff. Classy interior. STUNNING views. What more do you need. Oh! Plus great food.

site_logo

findlayM . 2020-01-31

MORE AT OpenTable

we went to the houghwood as our first choice of venue was closed, but we were not disappointed in any way at all, i have a disability and the staff took via another entrance where there was access to a chairlift which i appreciated very much, we shown to our table and our drink order taken all the staff here were so helpful over and above the norm really pleasant and polite, our meal = we both had rib eye steak with chips peas mushrooms etc and it was adelight to eat and enjoy, i was given an extra portion of veg and boiled potatoes our desert my partner had some with berries and ice cream i had an old fashioned bread and butter pudding with custard, oh shades of days of our youth its a little bit more pricey than we normal pay but worth every penny for the comfort ambience and the staff

site_logo

Stanley C . 2020-01-12

MORE AT TripAdvisor

We have been coming to houghwood for while, it never lets us down , the menu is varied and all the dishes are fresh

site_logo

IanM . 2020-01-12

MORE AT OpenTable

We choose the Houghwood to celebrate a family get together (8 in total) for Christmas, a couple of Birthdays, a couple of Anniversaries and oncoming New Year.The restaurant is situated on the upper floor so I requested and got, a window table because of the landscape which is truly outstanding.The service and menu were again outstanding at a more than reasonable cost and also host events such as weddings etc.I would highly recommend this venue for whatever event you wish to celebrate or just go out for a meal in a beautiful setting.You will not be disappointed

site_logo

Departure05275200961 . 2020-01-03

MORE AT TripAdvisor

We really enjoyed our family Christmas meal. The service and food were excellent and we felt relaxed in a warm and welcoming environment. The views from the Golf Club are great and we would certainly return with friends and family.

site_logo

419davidd . 2019-12-14

MORE AT TripAdvisor

We enjoyed a delicious meal. Service was excellent, even though the restaurant was very busy. The food was very tasty. A delightful experience in all respects. Thank you to all the staff.

site_logo

PatB . 2019-12-01

MORE AT OpenTable

Lovely freshly cooked food. Great service and reasonably priced. Will be back soon.

site_logo

SteveG . 2019-11-22

MORE AT OpenTable

celebrated my dads 80th birthday at Houghwood on Sun 17/11 and was really pleased with the choice of menu, food served and the service from the staff and bar staff who made it all a very enjoyable experience for my dad and his family. Thank you.

site_logo

Mike K . 2019-11-20

MORE AT TripAdvisor

All around great service, food and surroundings. A quiet evening meal & drinks, reasonably priced. Will be returning to indulge in the freshly cooked food.

site_logo

SteveG . 2019-11-01

MORE AT OpenTable

Lovely setting and good choice of food. My elderly sister has trouble with mobility and was taken up to the restaurant using the golf club’s chair lift. The lady in charge made up a table for us near the bar. Nothing was too much trouble!

site_logo

Christina . 2019-10-17

MORE AT OpenTable

The restaurant is in the golf course club house located on the western side of Billinge Hill.It is spacious light and airy and if you sit in the right place you have a magnificent view over the Lancashire plane and can see as far the docks in Liverpool,That for me was were the pleasure ended.There is a fixed price menu of £14.95 for two courses but the food is poor and expensive for what it is. From what I observed all the starters seem to have a basic salad as a common factor.I had salt and pepper squid, which was hard and overcooked, and my wife had black pudding which was also dry.I chose slowly cooked duck for the main course which was said to be accompanied by pancetta, black pudding and crushed/mashed potato. It was not pancetta, but thickly cut undercooked bacon, which enveloped the duck. The alleged method of cooking would suggest it to be tender and tasty, it was not. The accompanying vegetables of broccoli and carrot were cooked satisfactorily. There was little evidence of ability to prepare and present food to a good standard. On a visit to the same establishment some time ago we had a relatively simple, but well cooked, meal but what has changed is not for the better. The service was very good and the staff helpful but we will not be paying another visit to this place.

site_logo

mimibel22 . 2019-10-17

MORE AT TripAdvisor

Food was very nice and we'll presented. However for our liking it cooled a bit too quickly and was served on coldish plates. Also staff sadly lacking basic social skills in that we were not asked about our meals or engaged with as we left.

site_logo

OpenTable Diner . 2019-10-06

MORE AT OpenTable

Friendly staff, amazing views from the restaurant. Food was perfect. Couldn’t fault it in any way. Would recommend to anyone and will definitely be coming back.

site_logo

mikeystill1986 . 2019-09-04

MORE AT TripAdvisor

An absolutely relaxing occasion with brilliant service and fine cuisine. Thoroughly enjoyed our luncheon. Thank you all so much

site_logo

GeoffW . 2019-08-22

MORE AT OpenTable

Lovely place l, beautiful food, to die for scenery

site_logo

JohannaM . 2019-08-03

MORE AT OpenTable

Overall the occasion was really good. The service was prompt all the food at right temperature and well presented.

site_logo

ClareC . 2019-07-21

MORE AT OpenTable

top quality food and the staff are superb can't do enough for you, definitely going back.

site_logo

KevinR . 2019-07-20

MORE AT OpenTable

First time we have been disappointed, I ordered Thai fish cakes. Only one with two lettuce leaves and two small drips of chilli sauce. Couldn't taste the fish for the lump of potato in the middle. We will be going back because we do enjoy it at Houghwood.

site_logo

josephR . 2019-07-20

MORE AT OpenTable

Always pleasant and helpful welcoming and polite. Their food is always hot fresh and tasty

site_logo

FrancisC . 2019-07-17

MORE AT OpenTable

Went here on Friday 21st June 19. The food was fantastic. Very well cooked. I had the halloumi to start with seafood pasta for main. It was delicious couldn’t fault it. The staff were very friendly and very attentive. Lovely views. Well worth the money. More people should try this place.

site_logo

Vicki G . 2019-06-22

MORE AT TripAdvisor

A hidden little gem. Great food served served by excellent staff. Nothing too much trouble.

site_logo

KarenH . 2019-06-20

MORE AT OpenTable

The restraunt is welcoming very pleasant outlook and the staff are very welcoming nothing is to much trouble

site_logo

FrancisC . 2019-06-12

MORE AT OpenTable

Lovely location with great views, lovely food at a good price and good service. Somewhere you can always rely on for a good meal

site_logo

Tillyfloss . 2019-06-07

MORE AT OpenTable

We took the opportunity of booming Houghwood for a family function. The staff were very good and attentive. The food we ordered was well recieved by our guests and many good comments were passed to us. Drinks were a little expensive and im not sure why, after having been here previously, Any real ale ordered upstairs has to be poured downstairs and brought up by waiters and waitresses. However, the views (on a clear day) are superb and are a great asset for the restaurant.

site_logo

Laughingbear . 2019-06-05

MORE AT TripAdvisor

Our visits are an evening we look forward to for good food, beautiful surroundings and very professional staff who serve us. A brilliant evening

site_logo

FrancisC . 2019-05-29

MORE AT OpenTable

Been here a few times and I’m afraid there is a pattern. Usually good. But Big groups mean poor service. And the food suffers. We were a group of 7. Table booked for 12:45. We left at 3:30 after waiting ages for every course. Halloumi starter ok, but needed the pine nuts it was supposed to have and something like chilli jam to lift it. Just undressed salad bits. Main of chicken and chorizo skewers was just about ok, not proper chorizo though and chewy chicken. General disappointment round the table at deserts. L’s rice pudding had good flavour but stodgy and in need of milk/ cream. You could actually carve it. Microwaved. R’s tiramisu no coffee flavour and bit of a mush. My cheese board just lacked flavour, even in the Stilton’ish slice. But ok. Nice place, get more staff, especially in the kitchen. We said next time we booked we’d definitely ask if there were any big groups at the same time. One bottle of wine, few drinks £27 a head.

site_logo

aidanworsley . 2019-05-19

MORE AT TripAdvisor

first of all there was very little sandwiches provided...and cheapest fillings going..egg tuna..cheese and branston..thinly sliced ham...not much filling in any of them...........then tiny fancy cakes that i buy in big box fulls for grandchildrens parties...and scones fit for building stone walls...i am shocked to pay this price...one of my egg sandwhiches had no filling at all on one half..........cheese grated and only a sprinkle...as i often go out for afternoon tea i was totally shocked at what was served....no coffee pot on table so had to ask for refill.....no pastries i think they have thrown together this food thinking because we were all on the older side of 60/70 that we would be glad of anything served up...i am disgusted...i was treating a very close friend for her birthday which was a couple of days ago and feel so embarrassed....i will be interested to get a reply..

site_logo

. 2019-04-26

MORE AT TripAdvisor

Absolutely stunning views and a lovely room (upstairs restaurant). Staff very attentive and polite. Food experience was average in so far as it was good quality but not much of it (unless you're happy filling-up on cheap veg) and could have been served hotter. Menu choice was limited and could have done with some variety beyond the standard "meat/fish & veg" - no pasta or curry or anything beyond basic. It was also, in my opinion, very expensive for what it was. The bar selection was also very limited. Also of note is the fact that if you have anyone in your party with a disability, there's no lift to the upstairs restaurant.

site_logo

Moonloop17 . 2019-04-08

MORE AT TripAdvisor

The staff greeted us nd and throughout the evening looked after our requirements exceptionally. The food was served beautifully and precisely as was stated on the menu . There was no rush and we were able to enjoy our time

site_logo

FrancisC . 2019-04-03

MORE AT OpenTable

We celebrated my birthday just before Mothering Sunday hence a very quiet restaurant. Gareth made us very welcome and was attentive throughout th meal. He remembered me as I had Sunday lunch on my own. It was very busy but service was slick and courteous. Both meals were very good value. The quality of food and presentation very good. The decor is bland and the table settings could be enhanced with linen napkins and candles. The glorious views of Lancashire more than compensated.

site_logo

Madfred . 2019-03-28

MORE AT OpenTable

Main dining room was being refurbished so we were in the lounge/reception area. This did not deter from the quality of service or food which was excellent.

site_logo

SeniorLady . 2019-03-27

MORE AT OpenTable

Amazing food in a wonderful setting. <br />Service was first class and a good range of beers to wash it all down. <br />Thanks for a wonderful birthday meal.

site_logo

Jaffa . 2019-03-27

MORE AT OpenTable

Good food, served nice &amp; hot. Value for money &amp; great location. Had to wait a while for dessert but was lovely when it arrived.

site_logo

LindaH . 2019-03-17

MORE AT OpenTable

Went last Friday and weren’t disappointed. The food is always good and the veg is always done very well not overdone. Very reasonable. Not been let down there yet

site_logo

SteveG . 2019-03-15

MORE AT OpenTable

We had a very good dinner at Houghwood, very easy to book, good parking, excellent service with a good selection of food that we all enjoyed. We found the drinks a let down, over £5 for a pint of Peroni.

site_logo

RaymondS70 . 2019-03-08

MORE AT OpenTable

Thank you everyone at Houghwood for a lovely evening celebrating my dad's birthday. The lady looking after us was lovely, very helpful and professional. Food was great and everything was presented beautifully.

site_logo

Debj800 . 2019-03-07

MORE AT TripAdvisor

We have been to the Houghwood many times over the last few years and always been very happy with the food. However, when we visited last weekend we had a very poor meal. 2 of our party had beef which they both felt has a strange smell and taste and could not eat it. They left the meat and explained to the staff what they though of it. The member of staff said she would speak to the chef. Nothing else was mentioned until we asked for the bill. They had not charges us for deserts and a bottle of wine. This was most appreciated however when we asked what the outcome was with the chef, we were told that they had been serving beef all day and we were the first to complain. <br />The other two who had the ham in a mustard sauce, (which was very nice at the time) one of them was sick twice during the early hours and the other felt ill all night and was very bloated but not sick.<br />Really not sure what happened but has left a very bad feeling of not wanting to eat there again.

site_logo

Marie . 2019-03-03

MORE AT OpenTable

Lovely location, value for money, nice friendly staff:)

site_logo

JULIEM . 2019-03-02

MORE AT OpenTable

Excellent service &amp; food was great as always... would fully recommend especially for special occasion family get togethers

site_logo

PatriciaB . 2019-02-17

MORE AT OpenTable

We visited Houghwood for an impromptu family lunch at the weekend. The service was really good - very friendly and professional. The food was also good - particularly the desserts; but what really prompted me to post a review is how great the gluten-free options are. My 87 year old dad has coeliac disease, and this always causes issues when we go out to eat. At Houghwood however, all but one of the main courses was gluten-free and a lot of the starters too. If only all restaurants made life so easy and made their sauces gluten-free. Thank you!

site_logo

MsEJH . 2019-02-13

MORE AT TripAdvisor

The menu card doesn’t look like a restaurant, more of a Chain eatery.

site_logo

AustinS . 2019-02-01

MORE AT OpenTable

The staff are very accommodating and helpful the meals are always hot and well presented.

site_logo

FrancisC . 2019-01-16

MORE AT OpenTable

Attended a Xmas party with about100 people. The two course meal was served promptly and was delicious. Staff couldn’t be more helpful. Very impressed

site_logo

P1112014 . 2019-01-06

MORE AT TripAdvisor

first time ive been very enjoyable quite remote trying to find the place , but its a nice place staff very attentive. nice menu and beautiful room with nice ambience .<br />was a very nice chabge

site_logo

EricG . 2019-01-04

MORE AT OpenTable

Very pleasant surroundings with beautiful views as far as the river Mersey. Brunch in the Spikes Bar was okay but the menu has been much reduced including the disappearance of the scrumptious turkey and cranberry sandwiches.

site_logo

M J B . 2018-12-11

MORE AT TripAdvisor

We have been here before and had a reasonably good Sunday Lunch but our latest visit was terrible. The tables were not set properly, staff short on the ground,place looks very tired,and the food was on the verge of inedible. The starters were very poor indeed and the main course where we all chose the roast pork was frankly terrible. Tables either side of us were complaining about their food so it wasn't just us. To my mind Roast Pork should signify the meat had been in an oven. The food before us seemed to have bypassed the oven and might have been microwaved but hard to tell as the plates were cold and any temperature in the food rapidly went.

site_logo

Arthur B . 2018-11-21

MORE AT TripAdvisor

Excellent Sunday lunch, previous meal for friends birthday ( my first visit) earlier in the week prompted me to book for a family Sunday lunch.

site_logo

GailG . 2018-11-18

MORE AT OpenTable

Excellent service, food, atmosphere and value for money! What more can I say

site_logo

OpenTable Diner . 2018-11-17

MORE AT OpenTable

I found the vegetarian choice very poor. I chose the sweet potato steak which came with a small selection of roast veg. There was no protein on the plate, no crumb, or sauce. It was boring, unimaginative and tasteless. It was a lazy excuse for a meal. The alternative was risotto whic again is unamaginative. The rest of the family had roast which they enjoyed but the food could have been warmer.

site_logo

JoyC . 2018-11-04

MORE AT OpenTable

We have driven past the Houghwood for the best part of 21 years en route to my parents house and often wandered what it would be like to eat there. I can&#039;t believe we haven&#039;t booked sooner. On arrival we were greeted and seated (in the lounge) by Graham who took our drinks orders and gave us some menus to look at whilst we waited. My G pea and ham soup, peppered mushrooms, traditional roast beef, chicken or salmon with all the trimmings, delicious roasties and gravy/sauce. Desserts ordered were, chocolate fudge cake with a melt in the middle bit, lemon roulade and vanilla cheesecake all served with berries and ice cream, all of which where devoured. My parents thoroughly enjoyed themselves and I have never seen my mum enjoy her food as much as she did atthe Houghwood. We have all said that we will definitely be returning soon. Just wish we&#039;d gone sooner. Thank you very much for a lovely evening and delicious food. <br /><br />We visited the Houghwood Golf Course on a Sunday evening to celebrate our 25th wedding anniversary.

site_logo

JayneC . 2018-11-04

MORE AT OpenTable

Visiting relatives with a birthday to celebrate we found this a really enjoyable location. The menu choice was varied to suit all tastes and the food was well cooked and nicely presented. Our table was near the window so, being 3 rd November, we were entertained with the many firework displays being held across the Merseyside area from our high viewpoint.<br />The staff were helpful but unintrusive and we had a lovely evening.

site_logo

BarbaraS . 2018-11-03

MORE AT OpenTable

Very enjoyable, lovely food and great staff.<br />Will definitely return and recommend.

site_logo

AndrewF . 2018-11-01

MORE AT OpenTable

Similary restaurants in North West

restaurant_img
4.5

2952 Opinions

location-iconSt Helens Road
British
outdoor_seating_91778takeaway_91778delivery_91778

Not eaten here before, we had been out for the day and needed feeding this came up on Google search. We hadn’t booked but they did find us a table for 2. We both had roasts hubby had beef, I had a children’s vegetarian mushroom wellington. All food very nice, as were the staff we encountered. Good value for money. A very busy day for the staff as the weather was gorgeous. If in the area again I am sure we would pop in

restaurant_img
4.5

231 Opinions

location-iconRitherup Lane
British
outdoor_seating_139293takeaway_139293delivery_139293

Great local pub, live music and decent selection of drinks

restaurant_img
4.5

152 Opinions

location-icon474 Warrington Road
British
outdoor_seating_139281takeaway_139281delivery_139281

I came here again today... The Rocket has never looked better... Paula has the place looking great.. very popular with locals with a friendly atmosphere The outside bar is a great addition, perfect for the the warmer days. Plenty of outside seating and covered patio makes The Rocket a perfect retreat to enjoy some fun times during them hot summer days. Like all punch pubs the Rocket is Dog friendly and has plenty of free carparking. Darts, a pool table and live sports also on offer. 😎

restaurant_img
4.4

495 Opinions

location-icon96 Cambridge Road
British
outdoor_seating_206686takeaway_206686delivery_206686

Food is really nice but they always get our order wrong.

restaurant_img
4.6

970 Opinions

location-icon11 Church Road
British
outdoor_seating_91685takeaway_91685delivery_91685

Were do I start on this one Warm welcome,Pleasant Staff Fantastic food we will definitely go back highly recommend this pub. Ps double the staffs pay there a credit to The Star Inn.