GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.7

Based on 530 opinions finded in 2 websites

site_photo4

Nº 135 in 792 in Bournemouth

Nº 6 of 24 Other international cuisines in Bournemouth

CUSTOMERS TALK ABOUT DISHES WITH..porkskewerscurrymediterraneanpotatocookedcheeseribscoconutpizzachickensaladgoatricesandwichtenderspicymeatsteakpita

comment_iconOpinions

Absolutely love this place. The owner is the nicest man and they really care about the food that they put out. Best hummus I’ve ever had in my life

site_logo

Kristin Ziegler . 2025-03-16

MORE AT Google

Came in for the first time here since I was in the area. Cozy little spot. There are probably 5 tables only. Ordered the beef shawarma and cheese fries. Been shawarma came in a bowl. There was plenty of hummus. It also came with 2 whole pita which was nice for the big portion. I like my beef sliced thinner but this wasn't bad.

site_logo

C Xyooj . 2025-03-13

MORE AT Google

Quality food and large portions!! The owner is probably the nicest guy I have ever met. The hummus chicken shawarma platter is mouth drooling 🤤 👌

site_logo

Jeffrey Tauriello . 2025-03-13

MORE AT Google

Super Clean Restaurant and the gentleman behind the counter was super friendly and accommodating on any questions about the cuisine. Had the beef Shawarma Wrap was so good I forgot to take a picture before hand. Fried Okra was yummy, as you can expect with just about and breaded and fried finger food! Will be returning! Also $31 for two entrees, an appetizer and two sodas is hard to find nowadays for food that feels good in the body! Bravo!!

site_logo

Dougie Doug Anderson . 2025-03-08

MORE AT Google

Excellent food, Excellent service, I'm so glad my family discovered this place!!!

site_logo

Kate Bolinski . 2025-03-08

MORE AT Google

Amazing food! Amazing service!!!! Love it here!! Will definitely be coming back often!!!!

site_logo

Edwin Silva . 2025-03-01

MORE AT Google

The falafel and hummus were great and the service was fantastic. The owner was super friendly and attentive.

site_logo

Leena Hassan . 2025-02-28

MORE AT Google

Amazing food, very friendly employees. My new favorite local place

site_logo

Lita Saldivar . 2025-02-23

MORE AT Google

Absolutely amazing food for an amazing value! Everything is fresh made to order! The Humus is a must have. I am not even a big Humus fan and I practically licked the plate clean.

site_logo

Jellings . 2025-02-15

MORE AT Google

Food was so fresh and yummy! Loved the lentil soup and the chicken and rice skewer with the garlic butter mix was yummy. The guy who work there are nice as well.

site_logo

Alicia Marie Garcia . 2025-02-07

MORE AT Google

One of the best local spots in the area, it’s a consistent go-to in our household! Their homemade hummus is the most delicious I’ve ever had. We’ve tried different wraps and sandwiches, chicken, falafel, gyros, and I can confidently say you can’t go wrong with anything on the menu, they’re ALL hits. They even have the best fries! My bf says the Philly cheese steak is so amazing, he only wishes he had room to eat 5 in a row :) if that wasn’t enough praise, the man who owns the restaurant is great, and everyone in there is always very friendly and kind!! 10/10, have experienced nothing short of amazing food and service, and can’t recommend this place enough seriously.

site_logo

Nicole Mogan . 2025-02-03

MORE AT Google

Great gyro and the best hummus I have ever tasted

site_logo

John Loza . 2025-02-02

MORE AT Google

Best middle eastern food in Milwaukee. I recommend hummus&beef sharwarma. It will fill you up with good macros. Healthy food. The owner is very kind and friendly.

site_logo

PAt7x Sevenfold . 2025-02-01

MORE AT Google

Incredible spot for delicious Mediterranean food! I had the hummus and beef shawarma—it contained the best hummus I’ve ever had, tasty tender shredded shawarma, some chopped up green pepper and sumac added flavor, and a generous helping of pita bread. The guys working were super nice and friendly. Highly recommend!

site_logo

Liza Loza . 2025-02-01

MORE AT Google

Good food, friendly service. Will definitely be back.

site_logo

Bill Mulkey . 2025-01-31

MORE AT Google

I got the beef and hummus platter last night and it was SO good. One of the best I've had in a long time. The owner was there and was so friendly and accommodating. Definitely a repeat!

site_logo

Andrea Holyszko . 2025-01-26

MORE AT Google

very good food. the owner is fun to chat with and always upbeat. i usually get the chicken tawook, and it is 10/10 every time

site_logo

Matthew Noyes . 2025-01-25

MORE AT Google

They took amazing care of our team! Food came out fast and was absolutely delicious!

site_logo

Avery Smith . 2025-01-19

MORE AT Google

This is hands down the best Mediterranean food I have had! The Hummus is AMAZING!!! Everything was authentic and fresh. The falafel was out of this world! Unlike anything I have had in the past. My husband and I had a wonderful conversation with the owner and the passion he has for his art shines through! We will be coming back!!! It is worth the trip for us. A new favorite. 100%

site_logo

Anna Fasoldt . 2025-01-19

MORE AT Google

Great food, great flavor and fresh taste. This place has range!

site_logo

Maass Media . 2025-01-18

MORE AT Google

The best hummus I've ever had and wonderful friendly staff. I'll be coming back again!

site_logo

Stacy M . 2025-01-07

MORE AT Google

EXCEPTIONAL! First time there. (We live in Green Bay, just stopped to eat.) We were treated like we eat there all the time. Have an empty stomach, because they will overfill it. It's not a fancy restaurant, just a stop in and enjoy good food, and super nice people. Thank you!

site_logo

Jason Anatole . 2025-01-04

MORE AT Google

Crazy good sandwiches and super nice!

site_logo

Kal . 2025-01-04

MORE AT Google

This place is the truth. Great Food. Great People. Spicy Philly Cheese Steak and Lentil Soup please.

site_logo

Daniel Towers . 2025-01-04

MORE AT Google

Service was amazing and the food was delicious. The hummus was the best I’ve ever had! Definitely worth trying out. They gave good recommendations. Definitely coming back!

site_logo

Xio A . 2025-01-04

MORE AT Google

A group of 9 of us invaded this restaurant on Christmas Eve. The owners put several tables together to accommodate our group. The food was delivered to our table both hot and delicious! We ordered a wide variety of foods to sample the menu...all was excellent! Although the ambiance is bare bones, the enthusiasm and friendliness of the owner made the room beautiful! We will be returning to the Grill Shack for more "good eats".

site_logo

Gail Hallen . 2024-12-30

MORE AT Google

The Schwarma was fabulous! You have to go for the hummus - bar none the best.

site_logo

S Fesko . 2024-12-29

MORE AT Google

Food was pretty good, good portions and great customer service

site_logo

Tho Walrus . 2024-12-28

MORE AT Google

Food was exceptional, best falafel I've eaten. Came in with a large group and they nailed it. Food was fresh, hot, and prepared quickly. From out of town but will definitely be back!!

site_logo

Derrick Turner . 2024-12-27

MORE AT Google

Alhamdullilah! Best business in the area. The owner is a great brother. He’s very friendly and welcomes you with open arms as soon as you walk into his restaurant. May Allah (SWT) bless him, his family, and the restaurant. Ameen! Please go check out his restaurant.

site_logo

Maxwell Dodd (D.O.Double D) . 2024-12-25

MORE AT Google

Today I entered Restaurants near us and this Gem popped up. Great ratings. Wow were we pleasantly surprised. I had the Philly Steak sandwich combo. Beyond outstanding. Best sandwich around. And the French fries don’t get me started. My wife say I am nuts about good fry’s. These were the best I have had. Wingstop has great fry’s but not a sandwich like this. My wife had Hummus and shwarma. She remarked how nice the presentation was and delicious also. Definitely do again.

site_logo

Rick Falk . 2024-12-22

MORE AT Google

Excellent, amazing food, great service. Seriously one of the best places in Milwaukee.

site_logo

Jesse Martin . 2024-12-11

MORE AT Google

My husband and I stopped here for dinner after a trip to Home Depot and were amazed by the food and the service. The gyro plate with rice was divine, as were the stuffed grape leaves. They even gave us a few pieces of falafel to try for free: also delicious! The house-made tzatziki was incredible. Don't let the unassuming exterior fool you: this is some of the best Mediterranean I've had in the Milwaukee area.

site_logo

Caitlin Martin . 2024-12-11

MORE AT Google

I this is the best food I have EVER had!!!!! I was originally thinking about getting the hummus and chicken Shawarma but he suggested that I try the vegetarian combo plate the next time I come in. So I decided to try it now. It had a variety of things that I wanted to try. I feel like my mouth is in shock. He has the best hummus I’ve ever had in my life. It was so smooth and just perfect. The olive oil tastes like olives (what in God’s name have I been buying at the grocery store?). I didn’t know olive oil could taste that good and fresh. The grape leaf wraps were delicious. The pita bread was soft and perfect. It was all so fresh, light, and amazingly delicious. I wish I could eat it every day. My son got a gyro plate and he said that it was better than our go to Parthanon’s on State St in Madison. Unfortunately we live a little over an hour away but this will be our new spot. We will be switching from Madison to Milwaukee for our family fun nights. I don’t think I could give this restaurant a good enough review. I’m also honestly offended with what is sold at my local grocery stores.

site_logo

Justinia Schneider . 2024-12-10

MORE AT Google

I had an amazing experience at Grill Shack Mediterranean Restaurant with my wife and son! The food was absolutely delicious – the flavors were spot on, and everything tasted fresh and perfectly seasoned. The Philly Cheese wrap and Buffalo wrap were standout favorites – so flavorful and satisfying! The atmosphere was warm and welcoming, making it a perfect spot for a family meal. The staff were friendly and attentive, adding to the overall positive vibe. If you’re looking for fantastic Mediterranean food with a twist, Grill Shack is the place to go. We can’t wait to come back and try more of their menu!

site_logo

Feedback YouDeserve . 2024-12-07

MORE AT Google

Owner was super friendly. The Philly cheesesteak was awesome; a perfect steak, cheese, and veggies ratio. The fry seasoning is *chef’s kiss*. Definitely will be back, I need to try the hummus!

site_logo

devon matthias . 2024-12-04

MORE AT Google

The food was very fresh and tasty. Well seasoned and authentic is an understatement. The owner seemed very friendly and we joked around a bit. He promised that I would be back the next day! I ordered the shawarma wrap, cheesesteak and falafel. You guys need to try their food!💯 🔥

site_logo

Joaquin A . 2024-12-02

MORE AT Google

Very good place! Try the buffalo chicken wrap! Delicious!

site_logo

Mohammad A . 2024-11-28

MORE AT Google

The owner is a very friendly man and keeps his kitchen spotless! I had the hummus and beef shawarma and it was fantastic! I also had a side of the fried pickles which were as good as they get! Highly recommend. Will be back to try more things.

site_logo

Trysten Boyer . 2024-11-26

MORE AT Google

Incredible food! Very authentic tasting and great-friendly service!

site_logo

Kevin Boyle . 2024-11-17

MORE AT Google

Truly one of the best meals I've had in weeks. Don't let the strip mall vibe fool you, this isn't some sketchy taco stand. This is A1 food with an extremely friendly owner and staff, and a relaxing atmosphere. Will be recommending this place to everyone I know and will be dreaming about my lunch for the next few days.

site_logo

Alex Krupski . 2024-11-13

MORE AT Google

Food is amazing, never been done wrong. Owner is very personable, good to chat with. Expect a short wait, but that is because the food is fresh & made with care. Will be back weekly!!!

site_logo

Lewis Weich . 2024-11-07

MORE AT Google

Food is outstanding. Owner is super friendly. Can’t wait to return to try more!!

site_logo

Robin K . 2024-11-05

MORE AT Google

Food was flavorful and staff were friendly and attentive! Prices are VERY reasonable too, highly recommend!

site_logo

Ivan Gallegos . 2024-11-03

MORE AT Google

Stopped in quick with my love after kayachtic trip to Walmart. My 1st time my loves 2nd. Both had gyros and they were just delish. Owner friendly and service was fast. Great place to hit up.

site_logo

Andrew Kleinow . 2024-11-02

MORE AT Google

Clean restaurant wraps and sandwiches and burger all made well so delicious, i will definitely return always ❤️

site_logo

Ahmed Amine Ben Khalifa . 2024-11-01

MORE AT Google

It was by chance my husband and I came to Grill Shack and we’re so happy we did! This is a hidden gem! All the meat is HALAL which is a must for us. The food is just delicious! We will be coming back again and again! Thank you!

site_logo

Marie Skiff . 2024-11-01

MORE AT Google

My favorite burgers in Milwaukee. The place is a little small but the food is great and the employees are extremely friendly.

site_logo

Nada Jarad . 2024-10-29

MORE AT Google

The owners are very friendly. We had the shawarma and it was amazing. they gave us extra pita to go!

site_logo

Dan K . 2024-10-29

MORE AT Google

Great food! Highly recommended.

site_logo

Ben Clark . 2024-10-26

MORE AT Google

Always a great place for Mediterranean or Chicago style steak sandwiches. The Charburgers are out of this world.

site_logo

Sam Smith . 2024-10-21

MORE AT Google

Hands down the absolutely best Philly I have ever had.

site_logo

Krissy Rivard . 2024-10-15

MORE AT Google

Great food! Great owner! Highly recommend their philly cheese!

site_logo

Marcos Navarrete . 2024-10-14

MORE AT Google

Incredible!! Love it thank you!

site_logo

Crystal Salas . 2024-10-09

MORE AT Google

We got the Greek salad (full size), gyro wrap, and fries. The guy taking orders convinced me to try the gyro spicey. Well worth it. In fact, everything we got was great. Gyro wrap and Greek salad were generous sizes, especially for the pricing, and delicious. شكرا

site_logo

Holly G . 2024-10-08

MORE AT Google

Absolutely love this place. The food, service, and atmosphere is fantastic. The chicken tamook platter with rice and hummus is phenomenal. I also had the chicken nuggets and fries. Those did not disappoint either. Highly recommend! I will be stopping here with my wife soon.

site_logo

Cassie Pagac . 2024-10-06

MORE AT Google

The Owner who is also preparing food is great guy. Always smiling, remembering if you been there before. I recommend ordering the Mediterranean Chicago Burger. Fries and cheese fries are the best.

site_logo

Drophammer77 . 2024-10-05

MORE AT Google

Edit: I went back and had the Philly Cheese Steak and my husband had the gyros. This is my new favorite place to get a Philly. Very flavorful and the bread was slightly chewy on the outside (and fluffy on the inside- sandwich perfection. My husband really liked the gyros. This would be his new favorite place if they had saganaki. The guy loves saganaki and it is not easy to find. Grill Shack is definitely my favorite place for quick delicious food. Delicious, flavorful food. I ordered take out and the fries were in a small paper bag. Not only were the fries flavorful, but they stayed crispier longer because of the paper bag. The Shawarma wrap was very long and well prepared. The garlic sauce is intense- just the way I like it and the vegetables were crisp. I love the variety of the menu. My husband can get gyros and a Greek salad, I can get shawarma and then my kids have chicken and burger options. This is set up as a fast food restaurant, but the quality and flavor are better than I would expect from fast food. Definitely give this place a try.

site_logo

Elizabeth Stamatakos . 2024-10-01

MORE AT Google

First time had a Grilled Chicken Tawook platter and is bussin! The owner is really nice on top of that. Definitely will be back!

site_logo

Bwet Phaw . 2024-10-01

MORE AT Google

To say the least I am very impressed with every single thing I ate on my to go platter. I got the chicken kabob platter and my family had other dishes and we devoured our plates. The hummus is incredible and the side salad they include is the best side salad I’ve ever eaten in my entire life not even kidding. I’m so impressed food was hot fresh and ready. I was able to eat this platter with no issues because the chicken was so tender and delicious. The falafel is so flavorful and had the perfect amount of crunch. We also had the beef shawarma wrap and the wrap is a foot long of pure delight. Everything we had was a delicacy and I felt like I was at home. I also had the stuffed grape leaves for the first time and I’m so impressed by how flavorful it was. Cannot wait to go and continue trying new dishes. 1000000/10 cannot wait to go back !!!!!

site_logo

D San . 2024-10-01

MORE AT Google

Very friendly staff, Best chicken tawook ever i had highly recommended

site_logo

Mr.Z Electric . 2024-09-28

MORE AT Google

I had chicken tawook platter it was amazing, the chicken made a way i never tested before Highly recommend it

site_logo

Ziyad Omar . 2024-09-28

MORE AT Google

Ordered the Gyro Plate with fries and it was amazing! The fries were hot and flavorful. They gyro meat was shaved perfectly and seasoned well. The tzatziki was punchy and tangy and I loved it.

site_logo

Liz L . 2024-09-27

MORE AT Google

Love it, love it 1000% , fresh and delicious, price are very acceptable

site_logo

erika mora . 2024-09-24

MORE AT Google

Food was amazing. The atmosphere is extremely clean and well taken care of. The owner provides fantastic customer service. I will most certainly eat here again

site_logo

Soren Batwinski . 2024-09-20

MORE AT Google

Food was great! Abbas has great energy and I truly enjoyed it here. Highly recommend!!!

site_logo

Tamara Simmons . 2024-09-20

MORE AT Google

Just wow!! Great food, wonderful people.. I ordered gyro sandwich and fries plater and was not disappointed. Would highly recommend this place. The owner even came and greeted us and asked if we need more info on the menu items.. just a wonderful experience

site_logo

Mirela Sadzak . 2024-09-13

MORE AT Google

They make one hell of a chicken sandwich.

site_logo

Jon DeVita . 2024-09-12

MORE AT Google

We stopped in on our way through to pick up dinner and decided on the chicken schwarma and hummus. Hands down some of the best hummus and schwarma we’ve ever had. We will definitely be returning!

site_logo

Celeste Eby . 2024-09-05

MORE AT Google

Friendly staff, excellent food!

site_logo

Mary Fauble . 2024-09-04

MORE AT Google

This place was great. Food was delicious. I think it was the owner behind the register and he was really friendly. Great value for the price

site_logo

Noel Wilson . 2024-09-04

MORE AT Google

The best burger ever.You must try Chicago style burger

site_logo

muhammed sheeban . 2024-09-04

MORE AT Google

Great food for really good price!🤤the buffalo chicken wrap is soooo good!!’

site_logo

Raul . 2024-09-03

MORE AT Google

Halal. Simple and clean atmosphere. Great for takeout. Fun and engaging owner/operator. We ordered the Falafel Wrap, the Beef Swarma (served on a bed of hummus), and Chicked Tawook (served on a bed of saffron basmati rice with a side of hummus and a small salad). A-mazing. American foods that we also ordered were thr Buffalo Chicken and the Chicken Philly. Definitely recommend!

site_logo

Brandy DeRuiter . 2024-09-03

MORE AT Google

Brace yourself, this review may be a little lengthy! Grill Shack has amazing food and the owner is one of the nicest guys I have ever had the luxury of speaking with. He also enjoys conversation which is refreshing. I feel these days we have little interaction with restaurant staff when picking up Dinner. My wife and I stopped in after a random hummus and shawarma craving took hold of us. After combing the reviews we saw a lot about the hummus so it was a no brainer, we had to try it. We decided on the hummus with shawarma chicken, the chicken shawarma wrap, the beef shawarma wrap ( I swapped the tahini for garlic sauce, just my preference), a side of cheese fries (to appease the inner child in us) and lastly, had to try their rice. We ate in the restaurant so I could leave an honest review without any issues of food being cold/soggy and what have you. The hummus, silky yet fluffy. The flavor is incredible. The added shawarma chicken makes the hummus bowl an entire meal not an appetizer. The pita served with it is lightly steamed, highly recommend eating in the restaurant. The pita is perfectly warm and fluffy. We wanted some additional pitas to go and the owner gave them to us along with the best way to heat them at home. The wraps! (Sorry my chicken wrap photo is absolutely horrendous) Both the chicken and beef shawarma wraps were probably the best I've had around the Milwaukee area. The chicken is juicy and flavorful. Vegetables are super fresh and crunchy, but I would say my favorite part was the size and quality of the wrap itself. The wrap has to be at least a foot long and was perfectly rolled up and grilled. I cannot stand a sloppy wrap, this guy knows what he is doing! The beef was tender and I can happily say I didn't come across any sketchy bites of beef. The owner takes a lot of pride in the quality of his food and it shows in the meat especially. We also had a small spicy dipping sauce which took the beef shawarma to another level. The rice was tender, fluffy and very well seasoned. Goes very well with the hummus and chicken. I will be returning for the chicken tawook and the beef kabob plates because those dishes are served with the rice and looked amazing. Cheese fries are cheese fries, but they didn't skimp on the cheese which is always a good thing. My 5/5 is based on a lot of factors, but the service provided by the owner really put it over the top. This man makes all his dips and sauces in house and it makes the dishes shine. Go give Grill Shack a try, I hope your experience is as good as mine was.

site_logo

Duane Ochs . 2024-08-29

MORE AT Google

Excellent!!! The owner explained things on the menu. The hummus is the best ever! I bought some to take home. I highly recommend.

site_logo

Ellen Jante . 2024-08-25

MORE AT Google

Clean place, good service, great prices and amazing quality. The falafel wrap was delicious 🤤

site_logo

Mazia Sal . 2024-08-18

MORE AT Google

Very tasty Mediterranean food especially the humus and chicken skewers

site_logo

Mamoun Atari . 2024-08-15

MORE AT Google

Absolutely amazing food. This restaurant is a hidden gem. Owner was so kind 😊 Thank you for feeding us. It was a blessing.

site_logo

Michaele Hallisch . 2024-08-14

MORE AT Google

Great food!! Clean place! Very friendly staff! Would recommend. I’ll Be Back

site_logo

Brad Hall . 2024-08-14

MORE AT Google

Delicious food! Very friendly owner! Best hummus around!

site_logo

MK Brockman . 2024-08-14

MORE AT Google

Very good service, quick and easy! Great food!

site_logo

Omar Kalbouneh . 2024-08-12

MORE AT Google

Phenomenal chicken and hummus shawarma!

site_logo

Camille Pharr . 2024-08-11

MORE AT Google

I'm kind of a shawarma snob, as I've tried many different restaurants over the years to find the best. My favorite is now the Grill Shack. Fabulous flavor with the meat and hummus along with an awesome serving size and ample pitas. The falafel is absolutely superb (buy enough for the family)! The owner is super friendly and outgoing. This is the best place for Mediterranean food with great service.

site_logo

JonnyRando . 2024-08-10

MORE AT Google

Great gyro! Very kind and friendly

site_logo

Cole Wiedenbeck . 2024-08-10

MORE AT Google

This is the place to go. They’re very clean and the quality of the food is top of the line.

site_logo

mahmoud khaled . 2024-08-09

MORE AT Google

Food is outstanding. The chicken tawook platter is great, I usually don’t like hummus, but the hummus here is great. The owner and staff are extremely friendly, and the prices are reasonable.

site_logo

Max Herubin . 2024-08-09

MORE AT Google

"I recently had the pleasure of dining at the Grilled Shack, and I must say it was an exceptional experience! From the moment I walked in, I was greeted with a warm and inviting atmosphere. The smell of sizzling meats on the grill filled the air, creating an irresistible anticipation for the meal ahead. The menu offered a wide variety of grilled dishes, from juicy burgers to tender steaks and flavorful skewers. Everything was cooked to perfection and bursting with flavor. The quality of the ingredients was evident in every bite, and the portions were generous. The service was top-notch, with friendly and attentive staff members who went above and beyond to ensure that my dining experience was enjoyable. The ambiance was cozy and relaxed, making it the perfect spot to unwind and savor a delicious meal. Overall, the Grilled Shack exceeded my expectations in every way. I highly recommend this restaurant to anyone looking for a memorable dining experience centered around delicious grilled fare. I can't wait to return and try more of their mouthwatering dishes!"

site_logo

Faisal Farooqui . 2024-08-09

MORE AT Google

Great food and customer service

site_logo

Sarah Jones . 2024-08-07

MORE AT Google

Excellent hummus. Really love the chicken shawarma. Burgers are huge. Thank you for a great lunch!

site_logo

E. H. . 2024-08-03

MORE AT Google

Great Philly cheesesteak and great service!!

site_logo

S S . 2024-07-31

MORE AT Google

Delicious and very friendly. Will definitely visit again if I'm in the Milwaukee.

site_logo

Shanny Marie . 2024-07-30

MORE AT Google

This food was amazing. I ASKED to make something not on the menu. A gyro philly. It was amazing. We were treated like family here. I have 4 kids under 4. They even loved the food. Big servings very fairly priced. The service was top notch. We live 35 min away and were here only by chance taking the kids to a near by park. We will make a point to be back. Thanks Abas for making the experience special.

site_logo

Robbie Hearan . 2024-07-28

MORE AT Google

Had the Hummus and Beef Shawarma and a side of falafel. Just delicious. Exactly what I was looking for. If you’re in the area, try them out for some great food. The owner is really great and friendly too. I very much recommend.

site_logo

Christopher Bullis . 2024-07-28

MORE AT Google

My family just moved here from Louisville and was looking for a Mediterranean place near our neighborhood and Grill Shack came up so we gave it a try. My measure of a Mediterranean restaurant is its hummus. I love hummus. To me, good hummus is creamy and smooth, not with the grainy texture of blended chickpeas. My go-to place in Louisville had the best hummus I had ever had... until the Grill Shack. I was a little nervous to try it bc I expected to be disappointed. The pita bread was warm and fluffy -- a good start. It was a generous portion of hummus topped with roasted garlic, olive oil, sumac, and another spice -- really nice presentation. I tore off a piece of pita and dipped it... moment of truth. OMG. It was the best hummus I've ever eaten - measurably better than my go-to place in Louisville. That sentiment was shared unanimously at our table. The owner Abbas served us himself. He was friendly and very kind. The Grill Shack is my new go-to place and I didn't have to try anywhere else. Highly recommend!!

site_logo

Monica Wendel . 2024-07-27

MORE AT Google

The food here is topnotch. The hummus is smooth, fluffy, and full of flavor. It's drizzled with a fine olive oil and sprinkled with sumac. Excellent balance of lemon, garlic, and tahini. The tawook is moist and flavorful, and the rice has a dusting of cinnamon, which adds depth to the flavor profile without any sweetness. The staff was super friendly and very helpful. Stop by and check out this authentic cuisine!

site_logo

Marshelle Beebe . 2024-07-26

MORE AT Google

Absolutely delicious food! Especially the hummus and chicken shwarama. The owner, Abbas, is always so welcoming and happy to see you. Highly recommend!

site_logo

Shelby Krueger . 2024-07-23

MORE AT Google

Amazing service and delicious fresh food!

site_logo

Kylie McAllister . 2024-07-16

MORE AT Google

I just came from New York and had the best cheeseburger of my life. I'm genuinely speechless. The smoky flavor and juiciness are out of this world. Milwaukee folks, you have to try this spot!

site_logo

ammar Nagi . 2024-07-14

MORE AT Google

Amazing food and service. I'm so glad my wife and I found this place!

site_logo

T.J. Clementi . 2024-07-14

MORE AT Google

Similary restaurants in South West

restaurant_img
4.5

8835 Opinions

location-icon24 Madeira Road
Other international cuisines
outdoor_seating_94018takeaway_94018delivery_94018

Aaron and izzy are fantastic great service verry attentive

restaurant_img
4.9

1449 Opinions

location-icon12 The Triangle
Other international cuisines
outdoor_seating_210376takeaway_210376delivery_210376

I like the breaded camembert and the chicken curry. I love that the mains have protein, sometimes at vegan restaurants you don’t get that. I absolutely loved this place the first time we visited a year ago but I felt that this time the quality got a bit worse. The menu hadn’t changed much, I do prefer more seasonal plates. The food took ages to arrive which I understand when you make it from scratch but some of it was cold. Got the creme brûlée which was very nice but the sugar on top needed to be hardened more. The area is quite bad and there were some dodgy people sitting outside who were not customers. I think the menu could be improved with more seasonal dishes, would love a gluten free burger, and that it’d be a better dining experience if the area was nicer.

restaurant_img
4.5

239 Opinions

location-icon2 Drury Road
Other international cuisines
outdoor_seating_101401takeaway_101401delivery_101401

Run by mother and son! Very homely and very clean and comfortable rooms. Teresa a very good hostess and Zak a good cook.

restaurant_img
4.0

2385 Opinions

location-icon17 Hinton Rd
Other international cuisines
outdoor_seating_93904takeaway_93904delivery_93904

We popped in for some quick lunch and didn’t want to leave! We had the inferno pizza…be warned it’s very spicy but perfect for us! Very tasty indeed! We enjoyed a great non-rushed vibe, watching the world go by listening to the great music. Would highly recommend!

restaurant_img
3.8

5675 Opinions

location-iconPier Approach
Other international cuisines
outdoor_seating_92745takeaway_92745delivery_92745

Ryan was an absolute delight. What a fab cocktail experience. Highly recommended - if you want to have a fun experience and start the night off in a friendly fun atmosphere visit Aruba. Thank you Ryan we will be back x