GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.4

Based on 2.227 opinions finded in 2 websites

site_photo4

Nº 1087 in 2913 in Edinburgh, City of

Nº 28 of 106 American in Edinburgh, City of

CUSTOMERS TALK ABOUT DISHES WITH..saladcookedbeautifulsirloincheesepaysteakladyfilletcevichesteaksribeyechickentendermeatrib

comment_iconOpinions

great staff , super friendly , amazing food

site_logo

Livi Tooze . 2025-05-24

MORE AT Google

Firstly the young lady who greeted us at the door was very professional, showing us to our table and giving us a warm welcome. The waiter we was assigned (Andreas I believe) was charming, funny and a pleasure to be around. The general manager (we didn't catch her name as she was very busy) was also very friendly when we asked for recommendations on the night life in Edinburgh. But my goodness the food 100% exceptional, from the starters to the mains. We would of tried the desserts but we was all satisfyingly full. Everyone of our party couldn't of praised it more. The scallops (which I had) were exceptional, compliments to the Chef. Also a wonderful atmosphere, fast service and clean. If you're visiting Edinburgh I highly recommend Gaucho. When we visit Edinburgh again we are certainly coming back.

site_logo

Sarah Heath-Sullivan . 2025-05-24

MORE AT Google

Great food and excellent staff.

site_logo

Simon Wallace . 2025-05-24

MORE AT Google

It's really quite disappointing as we've been a few times before & now the standard has dropped considerably. Food was average. Price was higher, but service was gd .would we be back, maybe not as there are other restaurants that are better .

site_logo

margaret higgins . 2025-05-22

MORE AT Google

Loved everything about the experience of dining at Gaucho. Service was attentive but not overbearing, very friendly and welcoming and went the extra mile for us. Loved it and will be back again.

site_logo

laura meikle . 2025-05-22

MORE AT Google

Really enjoyed our dinner! Leah looked after us well

site_logo

Farhana Shaan Apon Dinca . 2025-05-21

MORE AT Google

Basement restaurant. The burgers are good. Impeccable service. Average price. €125 for two with an aperitif and dessert. The steaks, however, are quite expensive.

site_logo

Yannick LE SCIELLOUR . 2025-05-19

MORE AT Google

Great meat place with high quality cuts of meat. Service was impressive and the venue has a cosy and private feeling to it. Extensive wine list with a good variety from South America (Argentina). Would highly recommend the Chateaubriand medium rare with a nice red wine.

site_logo

Felipe Baez . 2025-05-18

MORE AT Google

Extraordinary service and delicious meat!

site_logo

Anders Hamborg . 2025-05-13

MORE AT Google

Booked the private room for our wedding dinner. The service was wonderful from start to end. Our server made sure our glasses were always full and went through the steak selection in great detail. The food was great and couldn't fault it

site_logo

Jasmine Robson . 2025-05-13

MORE AT Google

The whole team is very competent from the desk to table service, Gray seems to me to have been our service was fantastic, he was able to advise us very well and the Italian guy also followed us every moment, in short, excellent team and excellent food. Exceptional.

site_logo

Antonella Anello . 2025-05-05

MORE AT Google

Thanks to Andrea who served us throughout the meal. His extreme kindness and wise advice ensured that we had a great time. The meat was obviously excellent and we highly recommend it. Considering the quality, the price is justified.

site_logo

Zoé GRAEFF . 2025-04-29

MORE AT Google

Really really kind and welcoming staff. Mango miso sour was so unique and delicious. Steaks were perfect. Get the mash potatoes!! Also the candle in the front of house was the best smelling candle ever omg.

site_logo

annie enbom . 2025-04-20

MORE AT Google

I went with my family and my dog while we were in Edinburgh, and we enjoyed the restaurant for a couple of nights. The food was lovely, tasty and incredible cocktails. I highly recommend the place! I normally go to Gaucho in London so I knew it was a good deal and I was right. Customer service and being able to have a nice meal with our dog is priceless. Thank you!

site_logo

Rachel M . 2025-04-17

MORE AT Google

What an excellent find in edinburgh staff where so helpful and amazing and helped with describing the steak options and even brought samples. Would highly recommend and will visit again. Wonderful.

site_logo

Graham . 2025-04-16

MORE AT Google

Went with a work group and honestly had one of the best steaks I’ve ever eaten.

site_logo

Daniel . 2025-04-14

MORE AT Google

£13 cocktails with those massive ice cubes and very small amount of drinkCloudy bay wine £90 - £32 bottle. Excessive mark up. Don’t visit the restrooms/nip outside for a cigarette you’ll get accused of a dine and dash/runner without paying! Mortified have the phone call assuming I’d ran! The steak was lovely, as were the sides. However lacklustre value and service overall. Shall not return

site_logo

David Hume . 2025-04-12

MORE AT Google

If you like steak, this is a great choice. Really good meat choices, and outstanding service. Highly recommended.

site_logo

Peter Black . 2025-04-02

MORE AT Google

Amazing experience, and amazing food. Some of the best steaks we've had. Appetizers and wine were great. Alessio took amazing care of us, was very knowledgeable, and shared some good suggestions with us. Best restaurant experience we had in Edinburgh. My partner was very happy with his birthday dinner!

site_logo

Danielle T . 2025-04-01

MORE AT Google

Terrible value for money.steak was nothing special and there's nothing Argentinian about it. The portion of Chips were full of salt and had loads of tiny sized chips,which seemed like a rip off. Sirloin 300g I had loads of fat that wasn't rendered down properly,so couldn't eat that. 12.5 percent service charge which is ridiculous. The staff were nice but thats Bout it. I wouldn't return or recommend it to anyone, unless you are too lazy to cook steak or have little to no knowledge in cooking at all.

site_logo

Mike S . 2025-03-31

MORE AT Google

Went for the Eat out Edinburgh offer. Service was friendly. Food was delicious.

site_logo

lizz R . 2025-03-26

MORE AT Google

The restaurant atmosphere is very nice, lovely small tables for couples and larger booths and tables for families. Staff were friendly and attentive, service was timed well. Our starters (burrata and beef empanadas) and mains (sirloin and beef burger) were tasty, but the dessert (brownie) was ok. The brownie was dry, and the white chocolate ice cream didn't really go well with the brownie.

site_logo

SSB M . 2025-03-09

MORE AT Google

What a lovely and posh spot! Been there first time and so happy with the food and service. Wonderful and cozy space. Big choice of wine , and cocktails. Nice set means for lunch 3 course for 25 pounds included a steak ! 🥩 Highly recommend and for sure will be back soon. Thank you

site_logo

Grzegorz Szczepanski . 2025-03-04

MORE AT Google

I tried this restaurant with two of my friends for lunch. We managed to find a table without a reservation. The location is very nice, a little dark, the food is good and the service is excellent.

site_logo

Beatrice Anderlini . 2025-03-02

MORE AT Google

Fabulous steaks, cooked exactly as requested, friendly and helpful service

site_logo

neil mackie . 2025-02-28

MORE AT Google

Gaucho Edinburgh, located on St Andrew’s Square, offers a stylish yet somewhat inconsistent dining experience. Bookable via the fork and opentable. The bar on the top floor sets the scene for pre-dinner drinks, while the lower ground floor houses the main restaurant. The dark interior, featuring wood-like tree effects, semi-circular booths, and plenty of mirrors, creates a moody, intimate setting. However, some details—like crumbs on the moleskin-style seats and the noticeable jolt when a neighboring table moves—detract from the polished atmosphere. On a Wednesday evening at 7:30 pm, the restaurant was fairly busy, with a lively atmosphere amplified by dance music and the general hum of conversation. The low lighting, mainly from candles, adds to the ambiance, though it may not be ideal for those who prefer a brighter setting. The food was a mixed bag. The 225g rump steak, ordered rare, leaned more toward medium rare. The chimichurri sauce was underwhelming, more of an oily dressing with little depth. On the other hand, the chips were excellent, though the mashed potatoes were forgettable. As for drinks, the strawberry negroni missed the mark—it lacked the signature bitterness and balance of a classic negroni. Wine prices were steep, with a threefold markup even on the cheapest bottles. Service was acceptable, though nothing particularly stood out. A 12.5% service charge is automatically added to the bill. Overall, Gaucho Edinburgh delivers on atmosphere and presentation but falls short in execution, especially given the premium pricing. While some dishes shine, others don’t quite meet expectations, making it a decent but not exceptional choice for steak lovers.

site_logo

Travelling Doc . 2025-02-27

MORE AT Google

A last minute booking with friends. Good and drink excellent. Great comfort and warm friendly atmosphere. Service exceptional. They just got it right .

site_logo

Wendy Busby . 2025-02-27

MORE AT Google

Visited to celebrate my friends 40th birthday. The staff here really make the experience! They were all so attentive, knowledgeable and kind. Our waiter Andrea was just excellent. He was funny & looked after us well. Steak tartare was lovely, a really nice firecracker sauce with it that had a lovely zing. We had fillet & rib eye. They were cooked perfectly with a really nice sear on the outside. I needed to add salt so for me it was a tad under seasoned but that could just be my preference. Sides were great but again need a touch more salt. I will definitely visit again, thank you for a great night Gaucho!

site_logo

Rachel Allison . 2025-02-23

MORE AT Google

Had a great first experience at Gaucho. Food was superb and the service was even better. Special mention to our Server, Ibra. He was incredibly friendly and went above and beyond to give us a 5 star service.

site_logo

Neil Dougal . 2025-02-22

MORE AT Google

The best steak! Everything from start to finish was perfect - food, drinks and service all 10/10 and the staff really make you feel special no matter the occasion. We had bread and fizz to start (the Argentinian fizz was delicious) and between our group we had a selection of starters: ceviche, wagyu empanadas (to die for!) and the salmon tacos were highlights. We had a mix of Sunday roasts and steaks but my lomo fillet was undoubtedly the best steak I’ve ever had, and the peppercorn sauce - SO good! Plenty of steak choices and sizes depending on your price range, plus they all come with a side and chimichurri sauce. We had some cocktails too that were all really good and shared a couple of dulce de leche cheesecakes which just finished the meal off perfectly. Not too heavy but equally delicious as the rest of the meal! Special shout out to our server, Craig, who really made the experience for us all. Already planning our next visit!

site_logo

Rosie Rees . 2025-02-16

MORE AT Google

The staff and service were amazing here. The food was unreal, had the wagyu empanada which was so flavourful. For main the Ribeye is literally the best steak I've had! The dessert and drinks both also top notch. Couldn't recommend it more.

site_logo

Samuel Marshall . 2025-02-16

MORE AT Google

Our server Liya was lovely!! Came for Valentine’s Day and she made our night such a kind waitress!

site_logo

Emily . 2025-02-15

MORE AT Google

Booked for the pre-theatre menu at 5.30pm as we were seeing a show at the playhouse at 7.30pm. Service was very slow. Starters took 45 minutes to be served, with very little explanation as to why there was a significant wait and then took ages to clear. Main meals were served at 6.40pm and we needed to leave at 7pm. As they cleared the mains we asked to cancel the desserts we had ordered as we had to leave due to needing to be at the theatre. We were offered a takeaway but this was obviously not an option and asked for the bill. They then tried to charge us for the desserts we had not eaten and added a 12.5% service charge for an extremely poor service. We asked for this to be rectified which then took an age and offered absolutely no apology. Food was very nice but the poor service massively let down our evening.

site_logo

Rachel Harris-Mcnee . 2025-02-15

MORE AT Google

1 x beef wellington, 1 x steak, 1 x curry and a couple of sides and a cost of £310, Definitely not worth it,

site_logo

f00d equip . 2025-02-06

MORE AT Google

As someone who travels frequently and has had the opportunity to experience a wide variety of cuisines, I was thoroughly disappointed with my visit to Gaucho in Edinburgh. My visit was unplanned, and I stumbled upon the restaurant while walking through the city center. The sign outside advertised two- and three-course meal offers, but upon entering, I was informed that these menus were unavailable, leaving only the main menu—something that felt misleading from the start. The food itself was an absolute letdown. The portions were meager, and the dishes lacked any sides what is wird.  My sea bass was oversalted to the point of being inedible, and  a bizarre, fried salad that did not complement the dish at all. Additionally, the chicken wings we ordered were burnt, making them unpleasant to eat. What made matters worse was the price. For two main courses and a couple of drinks, the bill came to an outrageous £120. Given the quality and portion sizes, this felt like a complete rip-off. I regret not taking photos of dishes before the bill arrived because this experience was truly one of the worst dining experiences I’ve had in a long time. Apart from the restaurant’s extravagant and pompous decor, there is nothing here worth the money. Gaucho Edinburgh is, in my opinion, an overpriced tourist trap that I would strongly advise others to avoid.

site_logo

Kseniia Redkina . 2025-02-03

MORE AT Google

Perfect night, great food! Words can not describe how wonderful it was.

site_logo

Sander De Rick . 2025-02-02

MORE AT Google

I came here for the second time last Saturday with 11 other people for a staff night out in the private room. We had the best time, the food was delicious, the atmosphere was great and most importantly the service was amazing. Ibrahim looked after us and explained all the options as well as recommending lovely wine and helping me choose a dessert, he was excellent. I’ll be back and would recommend Gaucho Edinburgh to anyone. Thanks again

site_logo

Nicole Sangster . 2025-01-29

MORE AT Google

Excellent dinner and wonderful staff! And ideal for someone in a wheelchair.

site_logo

Multik Mott . 2025-01-28

MORE AT Google

First time I came here, was served by Craig, one of the best experiences Ive had in a restaurant with the food but especially the service by Craig, he is an asset to the company

site_logo

Tanveer Ahmed . 2025-01-27

MORE AT Google

Great service by craig he was very helpful and friendly and the food was great

site_logo

M Bilal Majid . 2025-01-24

MORE AT Google

Took my dad here for his birthday and it was fantastic. Thank you too our server Monika for providing excellent service.

site_logo

Cameron Finlay . 2025-01-23

MORE AT Google

Excellent service, and very delicious food

site_logo

José Bertoa . 2025-01-20

MORE AT Google

I was there last night, January 18, 2025, with my wife for dinner after 9 pm (something difficult in Edinburgh) and we had a great time. It is my fourth experience at Gaucho in Edinburgh and I always manage to leave very satisfied. Sara, a Spanish woman from "Mar y Tierra" attended to us. She is a mix of Tenerife and Cádiz. He was exceptional at responding to requests for recommendations for wines and cuts of meat. Gaucho is worth what you pay for and that is why I always recommend it to my clients (I work in tourism in Scotland). So if you are looking for quality, attention and great atmosphere, this is the place. The other thing is to go to a Macdonald.

site_logo

JUAN CARLOS LOAIZA DIAZ . 2025-01-19

MORE AT Google

Amazing food and drinks. We were served by Craig who was absolutely fantastic and made the experience 10/10. Will definitely be back!!

site_logo

Kayla Smith (EqKayla) . 2025-01-15

MORE AT Google

Beautiful restaurant with attentive staff and great tasting steak.

site_logo

Layla Bell . 2025-01-15

MORE AT Google

Everything was fabulous, will come back again soon 🌮

site_logo

melike celasun . 2025-01-15

MORE AT Google

Went here for my 23rd birthday dinner and I could not fault it! Greeted at the door and shown to our table, and Craig our waiter was so attentive and friendly and made our experience a 10/10! We ordered the burgers (classic and wagyu) and the mac and cheese, and I can safely say they were the best burgers we have ever had. Absolutely delicious, the drinks were lovely and the chocolate torte for dessert was so so tasty, I would go back in a heartbeat! Very happy with the overall experience.

site_logo

Patricia Lemos . 2025-01-14

MORE AT Google

Good Vibe with a good selection on the menu.

site_logo

Mark Milne . 2025-01-07

MORE AT Google

We had a very pleasant evening except for how dark the place is. A little more light would be appreciated. Service of a very good level, the same as the food, the quality and care in its preparation could be seen, although at a somewhat excessive price.

site_logo

Victor Muñoz Martinez . 2025-01-03

MORE AT Google

The ambiance and service at this restaurant were impeccable. I have nothing negative to say about the staff—the server was incredibly kind, attentive, and very helpful. However, we opted for the Christmas menu, and the food was disappointing. For starters, we had carpaccio, which was decent. For the main course, I had the turkey, which I found quite unappetizing. My boyfriend chose the chorizo steak, but he found it bland and poorly marinated. The dessert was the biggest letdown for us. I had a brownie, and I must say, it was the most unappealing brownie I’ve ever tasted. To make matters worse, the price was very, very expensive. We paid around €220, including wine, which felt completely unjustified for the quality of the food.

site_logo

Fleur Squelette . 2025-01-02

MORE AT Google

- Given the night of new year I got seated closed to a table with two dogs which given the circumstances and price I did not find it adequate - On the dessert menu part there was a dessert that was not available - I ordered a seabass that was not cleaned given that presented multiple fish bones all over creating a bad eating experience - Service was nice, the waiter was helpful and friendly (only positive note)

site_logo

Luca Montelisciani . 2025-01-02

MORE AT Google

I was very happy with the food at Gaucho. I had the Sirloin and it was very tasty. Our server, Andrea, was fantastic. He was very attentive and made dining at Gaucho a very pleasant experience.

site_logo

Stacy Manton . 2025-01-02

MORE AT Google

When we arrived, the person at reception didn't want to be there, without a smile and spread out on his chair. BUT once you get down all the servers were adorable and nice. Beautiful decoration. The food was excellent, the price was very reasonable for the meat served as well as the wines.

site_logo

Sara Lam . 2024-12-30

MORE AT Google

Came for Christmas lunch, loved their set menu. Great wine & the whisky was good and cheap! Hope to come back for their proper menu.

site_logo

Leticia Emma . 2024-12-28

MORE AT Google

Fantastic food and atmosphere.great service,good selection of cocktails and excellent steak with firecracker sauce

site_logo

Madhav Bewoor . 2024-12-24

MORE AT Google

Incredible experience from start to finish. Most definitely one if the best steaks I’ve had to date. Craig was a delight, made the whole experience so so special. We were celebrating a graduation and he went above and beyond to make us feel special. Wonderful atmosphere and worth the money spent for sure!

site_logo

Olivia Keohane . 2024-12-16

MORE AT Google

Not bad, but the Glasgow one is much better. Either the food, atmosphere and service. The food was good but not great... The atmosphere was very noisy, the tables are very close one of the other and that made me not feel privacy at all during the dinner, at the same time everyone was talking very loudly because the music, apart from not being appropriate for a restaurant, was turned up too loud... I won't be back again... Thanks

site_logo

Raúl Solís Fuentes . 2024-12-14

MORE AT Google

Sadly no idea if the food is good or not- we had high hopes for this place for my daughters 21st. Having been largely ignored we were kept waiting for well over half an hour past the booking time with no real explanation. We left. Nobody cared. We were also promised a glass of bubbles as a good will gesture that we didn't get.

site_logo

Tracey Scriven . 2024-12-14

MORE AT Google

Excellent restaurant food service drinks fab. Cool venue

site_logo

Marie Fraser . 2024-12-09

MORE AT Google

We’ve been to Gaucho London and now in Edinburgh as always fantastic experience, great place and the staff are amazing. We’re well looked after by Monica.

site_logo

Maria Adrias . 2024-12-07

MORE AT Google

Dinner at Gaucho, famous for their steak and the protein was well seared and cooked to my expectations (medium rare), this was better than the steak at Tollhouse, very flavourful. Starters were better too, with delicious and crunchy prawn. The place is suitable for couple/dating, dark and cosy setting with a good glass of mocktails. However, service at Tollhouse was much better, more intimate and friendly.

site_logo

Simon Lew . 2024-12-05

MORE AT Google

Came for my 21st birthday dinner with family and it was amazing!! The staff were all amazing, especially our server. The atmosphere is very nice and cozy. There are a decent amount of food options and the portion sizes are good too. It is a little more on pricey side but matches the vibe of the restaurant.

site_logo

Julia L . 2024-12-04

MORE AT Google

A Stellar Dining Experience This place delivers an exceptional dining experience, especially for steak lovers. We sampled four different cuts, and every single one was cooked to perfection—juicy, tender, and bursting with flavor. The quality and care put into their preparation were evident in every bite. The classic burger was equally outstanding—succulent and packed with flavor, it easily stands among the best in the city. The wine selection and cocktails were equally impressive, complementing the meal beautifully and elevating the overall experience. The service was top-notch; our waiter Andrea was attentive, friendly, and knowledgeable and added to the enjoyment of the evening. Combined with the restaurant’s stylish interior and lively yet comfortable atmosphere, this is a fantastic venue for any occasion. They have a glass walled private dining room too. We visited as a family of 5. Highly recommended if you’re looking to enjoy world-class steaks, excellent drinks, and great hospitality. We’ll certainly be returning!

site_logo

John McCormick . 2024-12-03

MORE AT Google

Literally the best experience in Edinburgh for fine & dine! Right in the centre with great ambience and service. Alessio was amazing, he knew the menu very well, recommended the best dishes and cocktails. Omg, I have never had such great cocktails tbh! Will definitely recommend this restaurant to my mutuals! ✨❤️

site_logo

Tanaya Vaidya . 2024-12-02

MORE AT Google

Absolutely fantastic steak, I haven't been to Gaucho for a long time and I had forgotten how good it is. Very attentive service too. What a treat.

site_logo

Bertie Johnstone . 2024-11-28

MORE AT Google

Stunning restaurant. Drinks were delicious and food also lovely. Staff friendly and we were well looked after

site_logo

Jessica Nicol . 2024-11-24

MORE AT Google

Steak and cheese balls are to die for. Staff have excellent knowledge about all the types of steak you can choose from. If you don’t fancy steak plenty of other choices! Wine menu is excellent and something for every pallet. Atmosphere is really nice too as you are one level below on the basement.

site_logo

R A . 2024-11-21

MORE AT Google

Nice staff, but the food was really average and the state of the place is pretty shabby - ripped carpets, scuffed walls. For steak or meat-heavy places, Edinburgh has far better options. For the price, this was a huge let down.

site_logo

Joe Peach . 2024-11-19

MORE AT Google

Food was perfect and delicious, but the care from our waitress Monica was just magnificent. She was just a delight, extremely worried about my allergies, and always communicating with me and the chef, who would modify something to fit my needs. Although it's a steak house and I'm not a steak fan, I decided to have 3 starters for dinner. (Best decision ever). Had the seabass ceviche to start, and the steak tartare + provoleta as main course. Everything was superb. The only downsides were the tiny bit too loud party music in the background l and the "nightclub-like" toilet, with strong urine scent on the corridors.

site_logo

Mayui Coelho . 2024-11-09

MORE AT Google

Great food and service, our waiter was perfect (I think his name was Ibra?)

site_logo

J A . 2024-11-04

MORE AT Google

Went for dinner food was really good, however, was told we had to be out by 8:45 due to a private function, we booked our table at 7:15 but weren’t sat until 7:30. We ordered our food and starters came quickly but didn’t receive our mains until 8:30 giving us only 15 minutes to eat our mains meaning we couldn’t finish our own meal as they cleared our table before we finished. We also couldn’t have a look at the desert menu due to us being rushed out. We also had to pay while we were eating our mains.

site_logo

natalie beveridge . 2024-10-27

MORE AT Google

11/10 and what fabulous staff!!!

site_logo

Fiona Shaw . 2024-10-27

MORE AT Google

Perfect date night! Great food and amazing service! Definitely gonna have to come back for the kiwi gimlet 🥰

site_logo

Sarah Phillips . 2024-10-26

MORE AT Google

Had a great meal at Gaucho with some friends! Service was excellent, going to be back for some more of those kiwi Gimlets 😍

site_logo

Emma . 2024-10-26

MORE AT Google

Excellent food, particularly enjoyed the steak tartare. Fantastic service as well!

site_logo

Ross Little . 2024-10-26

MORE AT Google

We booked the steaks and cocktail with mates deal at £65 per head No one to greet us coming in and put to the most awkward table in a corner and asked to be moved Waiting staff lovely We had a very nice starter full of flavours with a lovely cocktail but then the meal went downhill The sharing steak platter was not bad enough to send back but cold, chewy and very gristly The cocktails were awful and we left them The toilets weren’t clean and no toilet paper The bill was wrong and had to be amended There was no atmosphere and none of the food or cocktails were explained. Definitely would not return

site_logo

Leza Buchanan . 2024-10-25

MORE AT Google

Het was een zeer rustige avond en toch moesten we erg lang wachten voordat we ons eten konden bestellen. Ook kwam de rondlopende bediening erg gehaast over (bij ons aan tafel was dat iets minder gelukkig, maar echt welkom voelden we ons er niet door). De prijzen zijn hier hoog maar dat weet je van tevoren. De hoeveelheid die je hiervoor krijgt is echter teleurstellend. Ik zou hier niet naartoe terug gaan en het ook niet aanraden, alleen als je geld teveel hebt want de smaak is dan wel weer prima.

site_logo

Jansen . 2024-10-24

MORE AT TripAdvisor

Beautiful restaurant we really enjoyed it to celebrate our anniversary, they gave us a lovely card which we really appreciated, Ibram our server was exceptional and incredibly knowledgeable he made our time there really special.

site_logo

Maria Pietscher . 2024-10-13

MORE AT Google

Delicious food and great service from all the staff I interacted with, especially Andrea my server who made some excellent recommendations for my meal :)

site_logo

Alex Macfarlane Smith . 2024-10-12

MORE AT Google

The steaks were cooked perfectly, full of flavour, and the staff were friendly.Great spot for a special meal – I’ll definitely be back!

site_logo

James Osborne . 2024-10-07

MORE AT Google

Beautiful meal with my daughter while visiting Edinburgh. Excellent waiter , attention to detail , dropped my napkin , he discreetly picked it up and replaced it with a fresh one. He didn’t notice - that I noticed. Service was 10/10. Meal was incredible. Definitely be back ❤️

site_logo

Fiona Filler . 2024-10-05

MORE AT Google

Me and my wife are regulars at this branch in Edinburgh. I couldn’t fault it even if I tried. Thank you guys

site_logo

ahid iqbal . 2024-10-04

MORE AT Google

We went to Gaucho for a birthday meal & were really let down. The steak was very tough, overcooked, and more grey than pink. There was no flavour to it whatsoever, & it was really bland. The sides were equally disappointing. The mash was hard & lumpy, & the chips tasted like they had been sitting around for a while. The drinks were also a letdown; we got a Kiwi Breeze, which is probably the worst drink I’ve ever tasted. To top it off, our server then shoved the card machine in our face without saying a word whilst we were still eating our dessert. Very unprofessional & rude. I wouldn’t recommend this place to anyone; there’s far better options out there.

site_logo

Esha Ali . 2024-09-22

MORE AT Google

Andrea top quality server made the night 10/10

site_logo

Matthew Levack . 2024-09-14

MORE AT Google

Now this is a place I can recommend, excellent service, food in a high class and fairly affordable.

site_logo

Trygve Kollberg . 2024-09-12

MORE AT Google

Such a lovely restaurant. The steak was cooked to perfection. The service from Andrea was spot on. Highly recommend! Kiwi Gimlet is one of the nicest cocktails I’ve ever tried.

site_logo

Niamh Mcmullan . 2024-09-10

MORE AT Google

really upmarket nice place, food was great but very expensive, tipped waiting staff during meal, he was great, only to find surcharge which at the time of paying we did not notice, ended up a £125 tip, bill for over £1000 on a Saturday afternoon, really nice place but did not expect the prices and surcharge, sorry wont be back till we win the lottery

site_logo

Andrew C . 2024-09-02

MORE AT TripAdvisor

Best steaks in Edinburgh - super culinary experience and extremely knowledgeable staff.

site_logo

Moira Brown . 2024-09-02

MORE AT Google

Restraunt is located one floor lower, food good, service excellent, bill high 😎

site_logo

R2Di2 . 2024-08-28

MORE AT Google

Everything we ordered is out of this world. Salmon tartare tacos and the Chargrilled baby gem Caesar are amazing. The way they prepared the steak, Churrasco De Lomo, is now my favorite. Our waiter is exceptional. Only wished the restaurant wasn’t so hot. I could not enjoy my overall dining experience because I was sweating so much.

site_logo

Kathy Glass . 2024-08-27

MORE AT Google

Expensive and not worth the money. SEK 3950 for 4 main courses and a bottle of red.

site_logo

Magnus Andersson . 2024-08-25

MORE AT Google

Very good experience, waiters and service. The food and wine was excellent. Got very good advice from a friendly waitress. Music too loud.

site_logo

Jan U . 2024-08-24

MORE AT TripAdvisor

Came here to celebrate my birthday and everything was just wonderful! Every member of staff was super kind and polite, and our server Andrea delivered the best service we could ask for. Food was amazing, and I can't wait to come here for another special occasion to have more chateaubriand 👌🏻

site_logo

Mara Mazzoni . 2024-08-22

MORE AT Google

Select location, very nicely appointed room, excellent cuisine with original and refined recipes. But quite expensive and quite frustrating to have to pay £6.50 for a mini portion of green salad to accompany the salmon.

site_logo

Sabrina Lefebvre . 2024-08-18

MORE AT Google

A very exclusive restaurant with great dishes. Everything was very tasty. Great service. We felt very comfortable.

site_logo

Ute Flohrer . 2024-08-17

MORE AT Google

Had an amazing night in this beautiful restaurant. The service was outstanding by our table host Ibrahim. Thank you for a lovely birthday treat.

site_logo

Rich J . 2024-08-17

MORE AT TripAdvisor

Pros: seated quickly, appetizers (scallops, tacos and olives) were sensational, strawberry hanky panky was tasty, atmosphere is loud and hip. Cons: room was too warm,music too loud, drinks took 30 minutes + to get, we never got a salad we ordered, several drinks were sold out, food service took 45 minutes +, main course of steak had nothing but meat on the plate and tasted very ordinary, main course of fish also too simple in presentation and flavor, bill took a very long time to receive.

site_logo

sandra fleming . 2024-08-10

MORE AT Google

Absolutely fabulous dining experience, very warm welcome. A equally fantastic atmosphere, food was excellent. Staff are very welcoming and tentative . Will not hesitate to book this wonderful restaurant again. We'll done to all you guys.

site_logo

Stuart Carmoodie . 2024-08-03

MORE AT Google

Good food but pricey. They specialise in steak which is good quality but it is expensive

site_logo

Andrew Sneddon . 2024-07-31

MORE AT Google

Had best service from our waiter. Great steak.

site_logo

Shawn Webster . 2024-07-27

MORE AT Google

Similary restaurants in Edinburgh and Lothian

restaurant_img
4.4

1830 Opinions

location-icon121 Princes Street
American
outdoor_seating_325735takeaway_325735delivery_325735

Amazing Staff and Food to Die for

restaurant_img
4.4

506 Opinions

location-icon2 Dundas Street, Edinburgh EH3 6HZ Scotland
American
outdoor_seating_259607takeaway_259607delivery_259607

La comida era buena y el servicio también. El restaurante estaba siendo renovado por lo que debería ser aún mejor a estas alturas. Los precios eran muy razonables.

restaurant_img
4.5

816 Opinions

location-icon47A Thistle Street, Edinburgh EH2 1DY Scotland
American
outdoor_seating_248808takeaway_248808delivery_248808

Nice place, excellent food and fair price. I had a delicious eggplant parmigiana.

restaurant_img
4.3

5227 Opinions

location-iconCramond Brig
American
outdoor_seating_93662takeaway_93662delivery_93662

Max service made the experience enjoyable 🙏🏻

restaurant_img
4.5

10877 Opinions

location-icon90-92 Lothian Road
American
outdoor_seating_205951takeaway_205951delivery_205951

Best of service. I am coeliac and so impressed with the gf options and mocktails to go with, thanks guys 👏