GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.8

Based on 1.400 opinions finded in 2 websites

site_photo3

Nº 379 in 507 in Suffolk Coastal

Nº 107 of 152 British in Suffolk Coastal

CUSTOMERS TALK ABOUT DISHES WITH..roundfishcookedmeatsaladchillicheesychickenfriedcheesepizzagarliccalzoneburntlamb

comment_iconOpinions

It came nice and hot, as in very recently cooked and not cooled down much, and was bang on time. Almost the nicest Calzone I've had, made from proper dough and topped with cheese which was a nice touch, I've had these at other take aways and they've been done with pie crust rather than actual pizza dough?! The inside was just right, not soft and chewy or dripping liquid out of it, it was even cut up for me, the only ones I've had better are my own home made ones, because I can use fillings more specific to the things I like, whilst being a bit healthy. One thing that could have been better, there was no grease proof paper under it, so it had a soggy bottom, meaning I couldn't put the box down on the table like you normally would have, but a quick use of the plastic bag the sauce came in soon sorted it out, not a big deal, but I'm puzzled why it didn't have the paper in there to begin with. So on the whole, all things considered, probably an 8.5 out of 10, and I don't give high scores freely for anyone hat knows my food reviews. Lastly on a note, the driver didn't adhere to ANY covid regs, so because of that I've given the Service Score a minimum as there was no care for the customer in that regard.

site_logo

Fxt-Foodie . 2020-10-09

MORE AT TripAdvisor

So my child is allergic to fish and I ordered a half and half pineapple and the over side was Donna meat and it came with tuna My child ordered it with my permission and she did not say to add tuna And it was cold And never gonna order from here again

site_logo

Gemma H . 2020-07-31

MORE AT TripAdvisor

I thought I'd give this another try after so long, even though on tripadvisor a third of the reviews are poor, as were my last 2 deliveries, in one review the customer was even called a liar! So third time's a charm for me right? ABSOLUTELY NOT!! The first time an item was missing, they said they would include it free when I ordered again, a distinct lack of customer service, it's not like they made anyone go without, oh wait... The second time I reminded them, the food turned up and not only was it pretty poor, but there was no missing item that I'd previously paid for. This time it was 5 mins early, and the cold drink was in a separate bag than the food, which is always a good sign, sadly that's where it ended, the chips were very chewy and tasted like they'd spent an hour slowly baking under a hot light, inside there wasn't much left of them, the burgers were nice and juicy, but they were clearly cooked on a grill caked in burnt offerings, because I imagine this is what soot tastes like, they tasted disgustingly burnt, I gave them a good try but couldn't eat half of the burger so had to throw that away, how could you not see the smoke coming off the grill or smell how caked in burnt residue it was? The drink was nice and cold, and the pot of sauce was good, but that's as far as it went, a tenner for a can drink, a small pot of sauce and a few chips. Don't waste your money getting anything from here if your taste buds work. Why didn't I call them? because I'm not wasting my time on lies and disrespect again, I gave them a second and 3rd chance which is more than fair.

site_logo

Fxt-Foodie . 2020-06-24

MORE AT TripAdvisor

Good fish and chips. Combined with just eat app makes for a very quick and efficient service. Food is good quality.

site_logo

Shaunalan . 2020-03-07

MORE AT TripAdvisor

Top meal, excellent delivery service, thank you

site_logo

Mac . 2020-02-15

MORE AT Just Eat

2 Kebabs ok salad missing from Chicken one, forgot onion rings, so not great service really

site_logo

Mr . 2020-02-07

MORE AT Just Eat

2 Kebabs ok salad missing from Chicken one, forgot onion rings, so not great service really

site_logo

Mr . 2020-02-07

MORE AT Just Eat

Top meal, excellent delivery service, thank you

site_logo

Mac . 2020-02-07

MORE AT Just Eat

Delicious. Will definitely be ordering again. Thank you.

site_logo

Ade . 2020-02-06

MORE AT Just Eat

Delicious. Will definitely be ordering again. Thank you.

site_logo

Ade . 2020-02-05

MORE AT Just Eat

Worth the wait though. Really nice food

site_logo

Sasha . 2020-01-26

MORE AT Just Eat

Good quality food and the collection time was really fast. Would recommend

site_logo

Sam . 2020-01-26

MORE AT Just Eat

Service and food is always great, however i ordered extra items for my pizza and they didnt all come on it.

site_logo

Marcus . 2020-01-25

MORE AT Just Eat

Worth the wait though. Really nice food

site_logo

Sasha . 2020-01-25

MORE AT Just Eat

Food was cold and did not taste nice at all.

site_logo

Claire . 2020-01-24

MORE AT Just Eat

Food was cold and did not taste nice at all.

site_logo

Claire . 2020-01-23

MORE AT Just Eat

Good quality food and the collection time was really fast. Would recommend

site_logo

Sam . 2020-01-20

MORE AT Just Eat

Very friendly staff and service. Food is always done to perfection. Have been ordering from here since it opened and will continue to order from here.

site_logo

Matthew . 2020-01-12

MORE AT Just Eat

Very friendly staff and service. Food is always done to perfection. Have been ordering from here since it opened and will continue to order from here.

site_logo

Matthew . 2020-01-12

MORE AT Just Eat

Good food delivered early. Perfect.

site_logo

Robert . 2020-01-12

MORE AT Just Eat

Good food delivered early. Perfect.

site_logo

Robert . 2020-01-11

MORE AT Just Eat

Delivery was so fast! Very impressed and a great meal as always thanks

site_logo

Gemma . 2020-01-10

MORE AT Just Eat

Delivery was so fast! Very impressed and a great meal as always thanks

site_logo

Gemma . 2020-01-09

MORE AT Just Eat

Fish batter could have been crisper but nice food.

site_logo

Gwen . 2020-01-08

MORE AT Just Eat

This grill is just off the sea front but ideal for take away, not just fish and chips, pizza, kebabs, kiddies meals.

site_logo

W R . 2020-01-01

MORE AT TripAdvisor

I used this take away when i been to sea front it was fantastic food ,nice staff,lovely service and very good price .

site_logo

Yasin N . 2019-09-03

MORE AT TripAdvisor

2 Special Shish Kebabs arrived in soaking greasy paper and boxes. The meat was tasteless, fatty and chewy. The onions/peppers/mushrooms were tiny and burnt. There were no skewer marks on the meat or vegetables which suggests to me this was fried. When I called to complain this was confirmed by the manager who said they always cook this kebab that way. No gesture to put things right or offer of refund. Left feedback on just eat and was then called a liar. Terrible service, awful food. Will not be returning.

site_logo

JJ P . 2019-07-13

MORE AT TripAdvisor

We used to get our kebabs from another shop whom we considered the best in Felixstowe. However, we thought that we would give Felixstowe Grill a try. Their kebabs are so much better and the quarter pound cheeseburger was delicious. We will definitely eat here again.

site_logo

Ian G . 2019-01-06

MORE AT TripAdvisor

Typical take away keebab/chicken to burgers and pizzas - Staff appeared friendly and good prices....

site_logo

Darryl T . 2018-02-17

MORE AT TripAdvisor

Got my food delivered late and my partner's cod was cold and salty.our chips where 3 different types of cooked garbage.i had 3 different types of chips with various colours,all fried in oil so old I could swear it was diesel.then my rock eel was a disgrace.it was over cooked,partly burnt and everything was so salty I had a pint of coke just to get rid of the nasty.being a former chef if I served that I'd sack myself.2 fish died for us to eat and I died inside due to the state of the cooking.im embarrassed for them and disgusted by the food.wont bother next time.

site_logo

Shiva v . 2017-10-26

MORE AT TripAdvisor

calzone pizza was to die for first class thank you 👍

site_logo

Mac . 2017-10-23

MORE AT Just Eat

Message to say it was on its way at 20.10...did t arrive until 20.30...and we only live 5 minutes away. Wasn't as hot as usual so I guess it had been sat in the car whilst they delivered other orders.

site_logo

Sophie . 2017-10-19

MORE AT Just Eat

Best one so fare 100/100 will be back for more

site_logo

Micheala . 2017-10-14

MORE AT Just Eat

Quick service as usual! best Pizzas in Felixstowe

site_logo

Joseph . 2017-10-14

MORE AT Just Eat

It used to be very good when they first opened, this pizza was delivered half cooked, the topping was barley cooked, the bottom of the base was cooked, but you could see a line of raw dough above the bottom which was very chewy, I let it cool down and put it in the fridge for the next day, had to slow cook it with foil over the top so as not to waste it, Not exactly what I would call fast, convenient or properly cooked, I've not used them for a long time because I was round a friends a year or so ago,I raved about how good they were and we ordered, it was delivered half cooked and things were missing, we called them to tell them and they said we would get it next order, I was dead embarrassed they had proved me wrong for my friend, the order should have been corrected there and then by bringing the missing item\s out right away like other places do, for me this was the last time I will order from them

site_logo

Fxt-Foodie . 2017-10-04

MORE AT TripAdvisor

Best pizza i ever had thank you guys

site_logo

Micheala . 2017-09-28

MORE AT Just Eat

superb! quality place, food, people 👍👍

site_logo

Mac . 2017-09-23

MORE AT Just Eat

First day on holiday so used just eat and the best reviews was this place, although the delivery was on time the food wasn't edible. The cheese burgers where OK but the chips where like rubber\plastic as we're the chicken nuggets. The garlic cheese bread was so greesy it dripped when we picked it up and the grease had soaked through the pizza box. Overall a waste of money.

site_logo

Beccy . 2017-09-18

MORE AT Just Eat

Excellent, particularly the chicken wings

site_logo

Andrei . 2017-09-12

MORE AT Just Eat

cant fault these guys top food top service

site_logo

Mac . 2017-09-10

MORE AT Just Eat

Burger and chips were dry. Definitely seemed like they were left from lunch time service. Wouldn't order again but got a good size piece of cake.

site_logo

Lauren . 2017-08-25

MORE AT Just Eat

First time ordering from there and the chips where soggy and meat was chewy

site_logo

Emma . 2017-08-18

MORE AT Just Eat

Waste of money. The cream in the bursa had curdled and was swimming in orange oil. The chips were inedible as like rubber. Pizza was tasteless . Thru it all in the bin. Had to cook at home. £21 wasted. Never again.

site_logo

Karen . 2017-08-16

MORE AT Just Eat

Excellent as always can't fault nothing best in town!

site_logo

Harvey . 2017-08-05

MORE AT Just Eat

Food was greasy and no taste. No drink with order was offered cash or he would deliver later. I took cash. Will not order from here again.

site_logo

Nicholas . 2017-08-03

MORE AT Just Eat

Amazing staff, amazing food always a pleasure eating 🍕 from this place 👌

site_logo

Charlie . 2017-08-02

MORE AT Just Eat

Donner Kebab wrap was quite juicy and full, chips were dry and crispy and the chicken coating was too peppery and tasted more like a southern fried chicken flavour than a fried chicken flavour; coating was dry in places and crispy and oily in others. Might go here again on the off chance but definitely won't be ordering chips or chicken again.

site_logo

Miss . 2017-08-01

MORE AT Just Eat

Really good quality pizza and good quality dinner meat in wrap best in town ordering again tonight as I write review

site_logo

Harvey . 2017-07-30

MORE AT Just Eat

King size portions, excellent quality and also great staff.... HIGHLY RECOMMENDED!

site_logo

Michal . 2017-07-26

MORE AT Just Eat

Excellent food and service will definitely use again

site_logo

Shane . 2017-07-12

MORE AT Just Eat

excellent food excellent service

site_logo

Beckie . 2017-07-12

MORE AT Just Eat

Great taste, quick delivery. definitely our new favourite pizza/kebab takeaway.

site_logo

James . 2017-07-05

MORE AT Just Eat

What a takeaway!! We both said it was one of the best we've eaten!! So much good quality food for so little money!! Pizzas were delicious and the cheesy garlic bread and onion rings were cooked to perfection!! All food arrived on time and piping hot and a free bottle of coke also. Wouldn't hesitate to order again! 10 out of 10

site_logo

James . 2017-06-17

MORE AT Just Eat

Chicken shish not edible as smelt weird like it was going off - other food was fine tho so will avoid the chicken in the future!

site_logo

Dee . 2017-06-09

MORE AT Just Eat

Excellent food excellent service

site_logo

Beckie . 2017-05-31

MORE AT Just Eat

Excellent food excellent service

site_logo

Beckie . 2017-05-27

MORE AT Just Eat

Excellent food and excellent service

site_logo

Beckie . 2017-05-26

MORE AT Just Eat

treated myself to a giant burger last night..it was to die for, spot on. service first class and the guy who delivered is a top man.. cheers all at Felixstowe Grill

site_logo

Mac . 2017-05-16

MORE AT Just Eat

Food was cold chips were hardly cooked meat was greasy

site_logo

Christina . 2017-05-11

MORE AT Just Eat

Burger and chips was nice but the donner was really fatty and gristly

site_logo

George . 2017-05-06

MORE AT Just Eat

Donner is either amazing or awful and gristly depending on day

site_logo

George . 2017-05-03

MORE AT Just Eat

Superb! nice people, food and service exceptional. thank you

site_logo

Mac . 2017-05-02

MORE AT Just Eat

Best in town , always nice hot food and great service

site_logo

Charlene . 2017-05-01

MORE AT Just Eat

Best calzone and kebab I'very ever eaten.

site_logo

Rafal . 2017-05-01

MORE AT Just Eat

Worst food I have ever had came on time tho

site_logo

Joe . 2017-04-28

MORE AT Just Eat

Excellent food excellent service

site_logo

Beckie . 2017-04-27

MORE AT Just Eat

burger was lit, chicken was dead.

site_logo

Alex . 2017-04-21

MORE AT Just Eat

Excellent food excellent service

site_logo

Beckie . 2017-04-21

MORE AT Just Eat

Simply put.... the best kebab we've ever had. Salad was super fresh and the meat was to die for. My new spot for kebabs

site_logo

Raymond . 2017-04-20

MORE AT Just Eat

Excellent food excellent service the best takeaway in Felixstowe

site_logo

Beckie . 2017-04-19

MORE AT Just Eat

love the food, always hot on time and the guys are gr8, always get what i ask for, best kebab shop in felixstowe, i have tried nearly all the kebabs shop in felixstowe and this shop is by far the best, keep up the good work guys, kevin

site_logo

Kevin . 2017-04-10

MORE AT Just Eat

Can't fault these guys, food excellent and delivery service first class..

site_logo

Mac . 2017-04-06

MORE AT Just Eat

Very quick service. A lot meat great taste. Konrad

site_logo

Konrad . 2017-04-02

MORE AT Just Eat

Nice, polite service, super - tasty!

site_logo

Andrei . 2017-04-01

MORE AT Just Eat

Burger and chips were really nice but the chicken was a very dry

site_logo

Mark . 2017-04-01

MORE AT Just Eat

Amazing again won't go any where else

site_logo

Charlene . 2017-04-01

MORE AT Just Eat

Food is really good. Every time we order from them they always take over an hour to deliver. And they always phone to say the driver is late.

site_logo

Sammie . 2017-03-30

MORE AT Just Eat

Got what I asked for and food was gr8 and on time unlike others

site_logo

Kevin . 2017-03-30

MORE AT Just Eat

Great meal, really generous portions and a bottle of pop for free. You can't go wrong.

site_logo

Paula . 2017-03-26

MORE AT Just Eat

Had the calzone again! Amazing!! Definitely recommend 👍

site_logo

Jason . 2017-03-24

MORE AT Just Eat

They were recommended to us from a friend!! Guess they can not read as we had written special requirements to the order. Two kababs, three things completely wrong with them!! Not sure we will order from here again!

site_logo

Alan . 2017-03-20

MORE AT Just Eat

Better this time as it's was hot

site_logo

Amanda . 2017-03-17

MORE AT Just Eat

Excellent piece of cod best I have had in a long while, respect to you all.

site_logo

Kevin . 2017-03-14

MORE AT Just Eat

Pizza and chips stone cold this is the second time now so never going back

site_logo

Darren . 2017-02-25

MORE AT Just Eat

Didn't follow instruction was told different order times and chips was re heated then delivered bad service

site_logo

Simon . 2017-02-25

MORE AT Just Eat

Wasn't as hot as normal so wasn't as nice

site_logo

Amanda . 2017-02-24

MORE AT Just Eat

It was amazing loved every last bit of it :)

site_logo

Jordan . 2017-02-19

MORE AT Just Eat

Quick delivery and food was fantastic

site_logo

Jay . 2017-02-18

MORE AT Just Eat

Absolutely excellent once again.

site_logo

4 . 2017-02-17

MORE AT Just Eat

very good service, very tasty hot food, good first impression, cheers Guys

site_logo

Martin . 2017-02-11

MORE AT Just Eat

Excellent, excellent, excellent.

site_logo

Kevin . 2017-02-10

MORE AT Just Eat

Great Food, arrived 30mins early than set time however they phoned after delivery to apologise and offered me reorder for set time, excellent service and meal

site_logo

James . 2017-02-10

MORE AT Just Eat

Wonderful fresh crisp salad,large portions,freshly cooked delivered fast

site_logo

Mrs . 2017-02-07

MORE AT Just Eat

It was okay, a bit cold, with very soggy chips. Perhaps pretend you're a customer and see how your food arrives. It may help you?

site_logo

Tim . 2017-02-03

MORE AT Just Eat

Once again excellent thank you 😊

site_logo

Amanda . 2017-02-03

MORE AT Just Eat

Most excellent takeaway wouldn't go anywhere else, So come on then what are you people waiting for, Get ordering from Felixstowe grill you will love it. RESPECT.

site_logo

Kevin . 2017-02-03

MORE AT Just Eat

Kebab was ok but pizza and chicken was not so good and the chips were awful! Otsvthe end time we've ordered but we won't use them again. Sorry peeps.

site_logo

Julie . 2017-02-01

MORE AT Just Eat

Kids wanted a pizza party for a birthday treat. Kids had a fantastic pizza party!

site_logo

Matt . 2017-01-31

MORE AT Just Eat

Dave the drive is alway happy he can have a laugh nothing like getting a take away and having a happy driver and the food brilliant as always

site_logo

Cody . 2017-01-30

MORE AT Just Eat

Good food, good service, friendly can't fault the guys there.

site_logo

Mac . 2017-01-28

MORE AT Just Eat

Similary restaurants in East of England

restaurant_img
3.8

841 Opinions

location-icon137 High Street
British
outdoor_seating_175565takeaway_175565delivery_175565

I always come here when I visit Aldeburgh I had great quality cod and chips today.

restaurant_img
3.8

182 Opinions

location-iconChurch Lane
British
outdoor_seating_75863takeaway_75863delivery_75863

We went on a Wednesday lunchtime the pub was extremely busy but the service levels were very good and the staff were friendly and engaging. Our two dogs were made very welcome. The food was well prepared and presented. 3 of us had the fish and chips which was excellent and the vegetarian curry was also very good. If you have dogs this is a great place to stop after a walk along the river. Highly recommended.

restaurant_img
3.8

967 Opinions

location-iconMarket Cross Place
British
outdoor_seating_175567takeaway_175567delivery_175567

Good place to enjoy a pint in a traditional English pub near the sea. Good food.

restaurant_img
3.8

617 Opinions

location-icon33 Church Road
British
outdoor_seating_121175takeaway_121175delivery_121175

First time back in here since new management. It's safe to say The White Horse is back!! Fully stocked bar, good choice of beers, very welcoming host. It has only been back open a month, so they have started with a small menu to get started and it did not disappoint. Absolutely delicious food and served promptly. They have just taken on a second chef and are aiming to expand their menu shortly. Will definitely be back! Oh and their Christmas Dinner Menu looks delicious and very reasonabley priced.

restaurant_img
3.8

155 Opinions

location-iconThe St Woodbridge
British
outdoor_seating_162141takeaway_162141delivery_162141

Proper tasty home cooked food. Eaten here 3 times during our weeks stay in the area. The downside is the road from Debenham to Cretingham - it’s very narrow but nowt Yorkshire folk can’t handle. Although my hubby was a bit disgruntled that you only served Roast Pork as a roast on a Sunday lunch and no Yorkshire Puds - he’s a Beef and Yorkshire Pud chap!! the food has been exceptionally tasty and the staff amazingly friendly. Highly recommend a visit