GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 2.499 opinions finded in 5 websites

site_photo4

Nº 129 in 387 in Ashford

Nº 5 of 11 Asian in Ashford

CUSTOMERS TALK ABOUT DISHES WITH..paytandoorimustchickenbeautifullambcurrycookedfishprawnchillispicyricemeatonion

comment_iconOpinions

Really tasty food. Good price. Nice evening.

site_logo

Keith Spink . 2024-11-23

MORE AT Google

Waited over an hour and half for delivery food not hot and not up too usual standard. Will be looking elsewhere from now on.

site_logo

Owen Jones . 2024-11-16

MORE AT Google

They serve whatever you ask, even if it’s not in the menu, like biryani and masala chai

site_logo

Reyansh Gupta . 2024-11-16

MORE AT Google

Food was OK, service was a bit slow, £40/head was expensive for one course and 2 drinks each!

site_logo

Jamie Mckeen . 2024-10-29

MORE AT Google

It is annoying to give this place 1 star. Reason is simple every time I try order and pay online, my card is not accepted. The same card is accepted when paid on site after ordering over the phone. Every time I have voiced my concern to the representative who said this will be looked at - the problem repeat again and again. Are these customer reprentatives honestly mean it! My guess is they have deaf ears when come to listen and resolve issues. Everything is polite when to take my money - once I turn my back and leave the place after collection I am the forgotten one. Ignorant customer service representatives. They cannot honour their words. Hope this post render these customer service representatives more responsible.

site_logo

sunilduth boolauky . 2024-10-27

MORE AT Google

Diwali night was excellent fantastic food, brilliant entertainment lovely atmosphere what a fantastic evening we had on 23/10

site_logo

Tracey L . 2024-10-25

MORE AT TripAdvisor

We visit the Everest in a few times a month as we are local. The food here is absolutely amazing, the service is always really good. This is my favourite local restaurant. We recently had my son‘s birthday here with 30+ guests and as usual, they pulled out all the stops, looked after everyone. Food was amazing, Service brilliant keep up the good work and see you guys soon. We also regularly order the takeaway from here, the food taste just as good.

site_logo

Mandeep Bains . 2024-10-20

MORE AT TripAdvisor

Always have an amazing time, best food & lovely staff 😋

site_logo

Steff . 2024-10-20

MORE AT Google

This place has such a variety! The staff were so nice and understanding. Went with my family and we asked for less oil in our dishes, the restaurant did a great job at that! Some of the food was alright, the honey Siracha wings were the best I’m not going to lie! Though, we ordered a mixed grill that came sizzling in the pan onto the table, and plenty more. THEIR MOCKTAIL DRINKS WERE ABSOLUTELY AMAZING 😻 my mum and I couldn’t stop drinking them, if I remember their names, I’ll come back to edit. And the Tarka Dal I ate.. I wish I ordered another! That was the best Dal I’ve EVER had! The meat wasn’t that flavourful in my opinion but some of the people with me thought it was great, others weren’t that keen :( It was all so lovely, I’d definitely go againnn We even got mint chocolates in the end 🤭

site_logo

Ayomide G Kuteyi (Mimi) . 2024-10-19

MORE AT Google

This place is great. The food is fresh, tasty and super varied flavours and dishes. My new favourite was the fried okra. The atmosphere is great, it's clean & bright. Can't wait to visit again

site_logo

Keeksdeeks . 2024-10-15

MORE AT TripAdvisor

Food is really nice all be it more expensive then other's nearby but delivery is late every single time. Always have to call and get told 10 minutes which it never is so have to call again. Won't be using anymore as service is poor

site_logo

Bssdancer . 2024-10-12

MORE AT TripAdvisor

Had a really lovely meal here this evening

site_logo

Victoria berry . 2024-09-28

MORE AT Google

Very enjoyable meal. Our first here, but we will be back. I had the Thali.....a selection of about 8 dishes served on a tray. It was excellent and very good value. My wife had the goat curry, but found it a bit boney so we can't recommend it.

site_logo

marcovanbatty . 2024-09-27

MORE AT TripAdvisor

Had a lovely and tasty meal of Korma

site_logo

Stella Clapson . 2024-09-24

MORE AT Google

Fantastic dining experience at Everest Inn. The food was delicious and beautifully presented especially the Thali. Customer service was outstanding, I highly recommend this place!

site_logo

Johan M . 2024-09-11

MORE AT Google

I enjoyed my experience very thoroughly, from the outstanding customer service to the fine culinary prepared dishes. Beautiful presentation, I enjoyed the lamb jalfrazi with a side of garlic naan bread, complimenting each other perfectly. Highly recommended. Great customer service. Tasty food!

site_logo

Sage Beast . 2024-09-11

MORE AT Google

Omg amazing experience! I loved the momo so yummy!!!! I went with my friends and the food was great, staff were friendly and the vibes were chill. I also had the biryani which was super good. I would love to go again!

site_logo

Ayush P . 2024-09-11

MORE AT TripAdvisor

I highly recommend the Chicken lasuni timuri it was very tasty and had the perfect amount of spice. The atmosphere was very calming and the service was top tier, very friendly as well.

site_logo

Nelson Gurung . 2024-09-11

MORE AT Google

Everest Inn is my favourite go to restaurant for birthday celebrations. Seated at a table for four even though there were only two of us and then hot towels brought to the table. Never experienced this before the meal before. Drinks order taken and brought to our table before our food order was taken. Popadoms served first with sauces/pickles. The mango and mint were great but the onion/cucumber/veg was disappointing. We had chilli momos and samosa chaat to start and literally as soon as we had finished our main were being served. A little bit of time between courses would of been appreciated. The mains were beautifully presented and flavoursome. Excellent food as always but just felt we were being rushed.

site_logo

Steve B . 2024-09-08

MORE AT TripAdvisor

If you are looking for a really chilled atmosphere and high quality food look no farther than this. We came here for lunch for my brother's birthday and it did not disappoint. The staff were most helpful and polite and the food was outstanding. I could not recommend this place more.

site_logo

Julian Mathis . 2024-08-30

MORE AT Google

Excellent food and service, thoroughly recommend.

site_logo

Stuart Enviro Tablets . 2024-08-30

MORE AT Google

Foods tried: Butter Chicken, Garlic Naan, Momos

site_logo

Bharath Kumar . 2024-08-25

MORE AT Google

I was in Ashford for a court case and had about an hour to spare for lunch. Conveniently situated within a poppadom’s toss from the station it’s an airy welcoming space. From a set menu I chose as a starter aloo chani puri which featured a spicy chickpea and potato paste to be inserted into little bread circles. A chicken madras with pillar rice and a vegetable curry priced a satisfying main. A glass of wine was substituted for a pint of beer. Service was polite and efficient throughout.

site_logo

futtock21 . 2024-08-10

MORE AT TripAdvisor

Excellent service and wonderful food. Best in Kent if not further afield and one of the best sub continent food I've tasted

site_logo

Alan Brown . 2024-08-09

MORE AT TripAdvisor

It was quite noisy as a group of men appeared and drank beer some two meters from us. Otherwise it was pleasant.

site_logo

Ole Nielsen . 2024-08-06

MORE AT Google

Another great restaurant for our collection. I picked Everest partly for its location very close to Ashford International Station with easy parking but also because I fancied trying Nepalese cuisine. And we were certainly not disappointed! We shared our starters - the MoMo, chicken filled steamed dumpling with tomato chutney, being particularly tasty. We also had samosa chaat and prawn puri. For mains, one of us had the Thali Special, a very tasty mixed selection of dishes and two of us had the goat biryani cocked on the bone. The portions were generous and the flavours excellent. I would have preferred a little more of the delicious vegetable curry and perhaps a little more goat meat but those are minor wobbles that didn’t detract from a great meal. The service was efficient without being intrusive. The decor was clean and modern and was an improvement on the outside which is a little run down. All in all a great meal at a reasonable price. Highly recommended.

site_logo

Graham D . 2024-08-05

MORE AT TripAdvisor

Definitely not for Nepali people. The food has massively gone downhill since our last visit about a year ago. As you can see from the pictures, the 2 staples in any Nepali restaurant, momo and chowmein were disappointing. The momo wrapper felt as if they were left outside for hour before being steamed, dry and filling was bland. The chowmein was of a completely wrong textured noodle. No bite to it, just mushy texture. I don't think we're going back. Avoid.

site_logo

Sanjay Maharjan . 2024-07-28

MORE AT Google

I don't like to leave bad reviews espicaillyas this place has been very good before and they are polite. My Girlfriend ordered chitwane kukura.The chicken dish was pretty undercooked and we'd already eaten a bit before we saw the pink/red colour of the chicken. Will add a photo if I can. Think it just needed longer cooking and it would of been OK. Been a bit put off to be honest.

site_logo

Jamie Lee . 2024-07-23

MORE AT Google

Massive improvement to when we visited a year ago.. our meal a few days ago was amazing

site_logo

Carl Hufton . 2024-07-17

MORE AT Google

I can honestly say the food is simply jaw dropping amazing. Bit on the pricey side but the taste and flavour of the food is sheer pleasure. probably the best Indian food I've had yet.

site_logo

Phillip Whitlock . 2024-07-16

MORE AT Google

Ashford's largest Nepalese, Indian restaurant. The ambience is good and so is the food, although it's not the cheapest. I had the Thali which IMHO is a little overpriced at £21, but the taste was absolutely fine... I've had better, and I've had worse . The best deal here is clearly the Biryani although the veg curry sauce seems to change each visit. Easy parking outside. Also good to see that they still provide hand sanitiser. Update July 24 - excellent lunch today. Service was also excellent. Couldn't fault anything today and will certainly go back

site_logo

Shaun Maloney . 2024-07-12

MORE AT Google

Lovely food but a bit too spicy i did ask for milder bit didn't happen

site_logo

Sharon Perry . 2024-07-12

MORE AT Google

🇳🇵W☺️W!!🇳🇵 🌟🌟🌟🌟🌟+... ALL the way!! 'The Everest Inn' [Ashford Kent] is the BEST Restaurant one could wish for. IF you are considering where to go for a change, or to Celebrate with Family & Friends!🎉THIS is the Restaurant to choose:~it should be TOP of anyone's 'List'!🇳🇵! For my 70th Birthday,🥂 I wanted to share my luck, with everone; in reaching this 'Milestone'!😉! The most wonderful thing about Jeeb & his Core Staff is; that absolutely nothing was any trouble at all!😊 I was able to discuss the event & chose a planned Menu+Bubbly for everyone to enjoy;~ also ensuring that vegetarians were catered for...without any qualms! I was able to attend earlier in the evening, to 'Dress' the Tables(With🍾🥂)! Jeeb & his Staff were so attentive & ensured that everyone was happy☺️. The Chef🧑🏽‍🍳& his team did an excellent job~the quality of the dishes were outstanding & more than sufficient,& even offered us more if required! We ALL [15+1 child] had the BEST evening EVER🎉 & all my Family & Friends speak VERY highly of this lovely Restaurant & the BEST food they've ever experienced!! A WONDERFUL TEAM! Thank🙏🏽You Jeeb; Chef & ALL of the Team!! With huge Respect🫶🏽Rosie We definitely will be back again! AND I will be 'Singing your Praises' to all I meet! 🇳🇵🙏🏽🇳🇵

site_logo

Rosie Jambo . 2024-07-08

MORE AT Google

Ridiculously expensive. A meal for 4 came to over £210. Food was good but at that price I would expect a lot better quality.

site_logo

Kenneth D . 2024-07-08

MORE AT TripAdvisor

I ordered a Nepalese vegetarian noodle dish, it said it was mild, already asked for no chillies, which there wasn't one in sight. It certainly wasn't mild when I started eating the meal.

site_logo

Linda Sharp . 2024-06-21

MORE AT Google

Food is excellent. Really enjoyed the Mixed Grill.

site_logo

Tom Hester . 2024-06-11

MORE AT Google

Delicious food as always from Everest.

site_logo

Peter . 2024-06-04

MORE AT Just Eat

Great food, great service but you pay for this but that’s perfectly fine.

site_logo

Gareth Jones . 2024-06-03

MORE AT Google

EXCELLENT Indian food, must eat here!! Can tell the chefs really have talent. Delivery time very long, was fine as we weren't starving but definitely something that needs improvement.

site_logo

D N (Dave) . 2024-05-27

MORE AT Google

The food was absolutely delicious. I loved their momos, and the kids enjoyed their meals, which were perfectly tailored to their tastes. The Himalayan goat curry was the best goat curry I've had in the UK. 👌 The food here satisfied my Hyderabadi taste buds. My only recommendation would be to increase the portion sizes as i felt its less for the price.

site_logo

Aadya Thammineni . 2024-05-17

MORE AT Google

This is a Nepalese restaurant. The food is tasty and filling, the chef also can make alterations for dietary requirements. It is on the ground floor so easy access. The staff is a mixed experience, we had someone that was a great help, another one ok, and a third one not a good experience. So it depends on the waiter. For dietary restrictions they can do different type of curry with your requirements. You request the type of curry you want, with what, so it is fresh. I really appreciate that.

site_logo

Iva Reis . 2024-05-16

MORE AT Google

Rang on the day and the restaurant called me back and confirmed availability. Couldn’t find fault with anything. Fantastic meal, great service, lovely setting.

site_logo

Danielle A . 2024-05-07

MORE AT TripAdvisor

We had a drink while waiting for a takeaway. Great service and the food was excellent. We will be going back for a proper meal shortly.

site_logo

Sprinty Nige . 2024-05-05

MORE AT Google

Very tasty food & friendly service at wide atmosphere.

site_logo

alan pandey . 2024-04-29

MORE AT Google

The delivery guy was very kind and respectful. handled food very nicely.

site_logo

Elden . 2024-04-29

MORE AT Just Eat

Good food and excellent service. Highly recommend.

site_logo

Parag Thapa Chhetri . 2024-04-28

MORE AT Google

My go to place in Ashford Great food, great service, great atmosphere And they do takeaway too!

site_logo

Cyrus Keeka . 2024-04-12

MORE AT Google

Incredible food wonderful service and friendly staff. Thank you all for another fantastic evening

site_logo

Jennifer Webb . 2024-04-04

MORE AT Google

Lovely food, hot and well presented. Fabulous service from the moment we arrived. Really lovely evening, great atmosphere.

site_logo

Angela R . 2024-03-31

MORE AT TripAdvisor

Pleasant Nepalese restaurant five minutes walk from Ashford International station. Curries were ok, not especially inspiring, but service was extremely accommodating and helpful. The restaurant is far bigger inside than it might look from the outside, so you’ve a good chance of getting a table even if you haven’t booked. If you found my review or photos helpful please leave a quick thumbs up 👍 Thank you

site_logo

Sam Saltwell . 2024-03-29

MORE AT Google

Food was cold. Delivery came late.

site_logo

Begum . 2024-03-22

MORE AT Just Eat

Today 53 of us went to the Everest in for lunch. Everyone was praising up the food with some saying can we come back tomorrow.

site_logo

Clifford Austen . 2024-03-13

MORE AT TripAdvisor

I ordered lamb biryani and what I was sent was nothing like lamb. It was hard beef. Could not taste or smell the lamb. It was clearly beef and that’s is ridiculous for £17 bowl. Really disappointed to say the least not was my first order and I definately will not be ordering again

site_logo

Tunrayo . 2024-03-06

MORE AT Just Eat

Went to this place with office colleagues and being a vegetarian Indian, I can say for sure that this is not how vegetarian dishes are prepared. I ordered a chilli garlic naan, they served me the garlic cheese nan. I said I didn't order this, so pls replace. They took it in for a moment and got the same thing back saying they have replaced it. I got a A naan full of cheese again. The dal makhani was so below average. I have been here thrice and everything vegetarian I have ordered tastes the same. Do better!!!!!!!!!

site_logo

Komal Thakur . 2024-02-24

MORE AT Google

Simply the best food in ashford. Curry with a nepalese influence. Cannot recommend highly enough. Check out their meal deal during the week

site_logo

Adam R . 2024-02-06

MORE AT TripAdvisor

We used to love eating here. The food has always been good quality and reasonably priced. In the past year the quality of food decreased and prices went ridiculously high. £21 for a main Nepalese dish- special Thali, is far too much. The biryani had too much gee and it was mediocre. The most upsetting was the children’s menu which is far too overpriced and doesn’t include a drink or desert. We paid nearly £7 for chicken nuggets and chips. Both came from the freezer via some cheap cash and carry service. Unacceptable in a restaurant of this calibre. This place used to be the best place to eat for miles. Not anymore

site_logo

Clive T . 2024-01-29

MORE AT Google

We used to love eating here. The food has always been good quality and reasonably priced. In the past year the quality of food decreased and prices went ridiculously high. £21 for a main Nepalese dish- special Thali, is far too much. The biryani had too much gee and it was mediocre. The most upsetting was the children’s menu which is far too overpriced and doesn’t include a drink or desert. We paid nearly £7 for chicken nuggets and chips. Both came from the freezer via some cheap cash and carry service. Unacceptable in a restaurant of this calibre. This place used to be the best place to eat for miles. Not anymore

site_logo

Wanderer212201 . 2024-01-29

MORE AT TripAdvisor

Great venue, staff and food is fabulous. Highly recommend and have had 2 takeaways since. These were delivered quickly and still hot and delicious.

site_logo

Tina East . 2024-01-25

MORE AT Google

This was a very fun and enjoyable experience and I recommend visiting for anyone who stops by in ashford

site_logo

Fola A . 2024-01-20

MORE AT TripAdvisor

I would 100% recommend this restaurant. Amazing food, excellent service and welcoming atmosphere.

site_logo

Steve Oliver . 2024-01-20

MORE AT Google

This spot is more than fantastic for a casual night out, dinner or a professional gathering! Fantastic customer service! Even better food!

site_logo

Pioneer63376500182 . 2024-01-19

MORE AT TripAdvisor

All the food I had was excellent. Usual popadoms to start, garlic chilli king prawns starter and chicken malahabi for main (with egg fried rice & onion bhajis). These were washed down with a couple of bottles of Ghurka Nepalese beer. Service was superb. My only comment was that I've been here many times before (every time I'm in Ashford) and prices have shot up considerably (more so than in other places).

site_logo

fred146 . 2024-01-13

MORE AT TripAdvisor

The mixed grill, lamb kebab was off and the tikka chicken. Very disappointed, have had food from Everest inn before and everything was excellent tonight was a different story

site_logo

Helen . 2024-01-11

MORE AT Just Eat

Great food, great service, could do with screens to make it more personal. Parking free after.6pm which is good

site_logo

Terrence Green . 2024-01-06

MORE AT Google

Best curry I have had in Ashford, moved here a year ago and so glad I finally tried Everest, did not disappoint.Will call again soon

site_logo

HelenN1578 . 2023-12-28

MORE AT TripAdvisor

Best place to go for a curry in town! Very friendly service and great food. Awesome!

site_logo

Ryan Mills . 2023-12-13

MORE AT Google

Where to begin - restaurant spacious and tables well laid out, staff do not really know whats going on and waiting times between starters and main meal took an eternity, food ok nothing special, price wise expensive. My recommendations do not go use the Little Raj instead.

site_logo

RCDF123 . 2023-12-09

MORE AT TripAdvisor

Very good food, accommodating staff and reasonable pricing.

site_logo

ry figg . 2023-11-28

MORE AT Google

Lovely place staff are friendly and nothing is too much trouble food was lovely very balanced on flavour and spice would recommend

site_logo

james woodock . 2023-11-22

MORE AT Google

lived in ashford for many years but never been here to eat, we thought lets give it a go. Arrived no reservation and shown to a table, first thing we noted was the way the prices presented, no £ sign on menu listings, could been in yen or dollars for all we knew! To charge £1 per pompadom when the dishes are already premium priced as well as another £2 for just three small chutneys is not what we expected. There wasnt enough chutney for four of us so had to order more...Main courses were nice enough but not exceptional we felt,nor were portions generous. Rice and other extras are expensive compared to other restaurants we use in Ashford around £1-2 more each. The total bill came to far more than we used to..around £35 a head for a beer and the curry each.....10% service charge automatically added altho we were asked at the time of paying if that was ok....embassed to say no really....so paid and left, food was ok, surroundings ok, service hmm ok but not the best. Would we use them again? Prob not due to pricing mainly. So this place is not for us...

site_logo

rossoandy . 2023-11-13

MORE AT TripAdvisor

Delicious food - I visit Ashford twice a year from USA and never miss ordering take out from this restaurant. Consistent quality and have never been disappointed.

site_logo

Quest43973770390 . 2023-11-02

MORE AT TripAdvisor

Food was delicious as were the mocktails tried. We called with about 20 minutes notice for a table of 6 which was excellent indeed. Whilst our order was taken very quickly for drinks (and few minutes later for food orders in fact) they were relatively slow to come out, although somewhat forgiven given they appeared rather busy. This being said it was gone 9pm (over an hour and a half after the food order) that food arrived at the table. The waiting staff were very attentive though throughout keeping drinks topped up for all. Not my first visit, excellent every time, but could have been a little quicker.

site_logo

Thomas Gilbert . 2023-10-29

MORE AT Google

Arrived as closing but still accommodated us. Food was 1st class, my Indian friend raved about the cuisine, and decoration of the restaurant. We both selected a Thali

site_logo

Gerry Worthy . 2023-10-28

MORE AT Google

We had a delivery which did not live up to our previous experience, both deliveries and dining in, at this restaurant. With a cost of over £80, I don't like being asked if we wanted to add a tip at the end of the order! Secondly, we ordered the chicken tandoori, which had about as much resemblance to tandoori as a jam tart. The other dishes were OK. But the tandoori wasn't tandoori.

site_logo

Travelwise207 . 2023-10-08

MORE AT TripAdvisor

By far my favourite restaurant in Ashford and have eaten in several times. Takeaways have previously been very good and worth the extra cost- this last one was not the best. The madras had way too much tomato which hijacked the flavours. Seems to depend on the chef.

site_logo

Dave . 2023-09-30

MORE AT Just Eat

Visited on a Wednesday evening, group of five. Nice menu and selection of dishes. Standouts were the Chicken Gorlaki and the Goat curry. Both lamb and chicken biryanis were nice and had lots of meat. Basic curries are expensive at £14 not including rice. Also charging £1 for a poppadum is greedy, these should be free for the prices of the curry. Especially as 10% is automatically added for service for only five people.

site_logo

NomNomAyrshire . 2023-09-25

MORE AT TripAdvisor

First time customers. Really quick delivery and came clearly packaged. The flavours couldn't have been better, we loved every dish. Will definitely order again in the future.

site_logo

fernleighkent . 2023-09-16

MORE AT TripAdvisor

Really enjoyed the food here on our first night in Ashford. Great momos and the curries we’re also good. Lovely people working here, too.

site_logo

Eric Sheforgen . 2023-09-16

MORE AT Google

Good hospitality and nice tasty food, good variety of drinks

site_logo

abidoye olufemi . 2023-09-14

MORE AT Google

Fabulous food, great friendly service, very relaxing atmosphere

site_logo

Kalysha Howard-Smith . 2023-09-14

MORE AT Google

Great food. We were a big party and all food came together and still hot. Food with amazing flavour . I will definitely go back

site_logo

fortnite kings . 2023-09-10

MORE AT Google

Amazing food, very busy, so had a little wait for food. Great atmosphere

site_logo

Claire Rodriguez . 2023-09-10

MORE AT Google

Excellent food the service not as attentive as the Hythe resturant but then it is a vast resturant.

site_logo

Andy Mason . 2023-09-10

MORE AT Google

Great food overall apart from my prawns were undercooked. waitress had attitude problem and didn’t smile once which lets it down.

site_logo

shadi makhalfa . 2023-09-03

MORE AT Google

Average - could have been really nice but let down in important areas - lovely sauces with main curries but lacking in the actual amount of meat - similar with the starters - food tasty but protein element minimal and lacked presentation eg son had...

site_logo

40plusSouthEast . 2023-08-30

MORE AT TripAdvisor

So the food is still great but a lot has gone downhill. Chief complaint is that the main courses took AGES to arrive which was not great. The mocktails were tasty but either came in tiny glasses or the glasses were half full, you expect more for 8 quid. The service was not great, one waitress was good, the other seemed confused and slightly surly the whole time. Lastly the tandoori lamb chops seem to have disappeared from the menu, this was the chief attraction of this place.

site_logo

Quentin Hunt . 2023-08-28

MORE AT Google

4 of us had dinner here last night. We all had the king prawns to start and poppadoms. Prawns were huge and cooked to perfection. Followed by plently of beers, naan breads and fantastic curries. Would highly recommend. Excellent food and excellent service. Will 100%...

site_logo

Liam C . 2023-08-16

MORE AT TripAdvisor

Das Essen (Thali) war grandios gut. Das Lamm und Hähnchen waren so zart, dass sie auf der Zunge zergingen. Das Aloo sowie das Dal waren ebenfalls sehr gut. Dazu gab es Safranreis, Naan und ein Kartoffelplätzchen. Der Service war äußerst nett und zuvorkommend ohne aufdringlich zu sein. Die Teller waren extra vorgewärmt und es wurde in den klassischen indischen Schüsselchen serviert. Dazu passten die Stoffservietten und das kunst- & effektvoll angerichtete Handtuch, welches nach dem Essen gereicht wurde. Ambiente: modern mit traditionellen Anleihen ansprechend eingerichtet. Sehr gerne wieder!

site_logo

C. G. . 2023-08-15

MORE AT Google

This is head and shoulders above anything I tasted through Just Eat.

site_logo

Robert . 2023-08-11

MORE AT Just Eat

The food was absolutely amazing and delicious! Delivered in good quality tubs so the food was warm and didn’t spill! Great!

site_logo

Charlotte . 2023-08-08

MORE AT Just Eat

Excellent staff and lovely food. Everyone works so hard and always have a smile. Their Nepalese Thail is the best.

site_logo

648jagrutis . 2023-08-08

MORE AT TripAdvisor

Great delivery and food was amazing as always!!

site_logo

Julie . 2023-08-03

MORE AT Just Eat

We have just had a family meal. I must admit we got carried away ordering food. But we thoroughly enjoyed it. The food was delicious. The staff were so attentive and friendly. Would definitely recommend a visit. Also NHS staff get 10% off on week days

site_logo

Hazel Turner . 2023-08-02

MORE AT Google

Delicious food and great service. I was really happy to taste Nepalese food for the first time. It was great, not pricy for good quality food. Serene and quiet place too.

site_logo

flav_dl . 2023-07-31

MORE AT TripAdvisor

Did not receive my food even though the order was accepted by the restaurant and no update if it was cancelled either

site_logo

Ananta . 2023-07-23

MORE AT Just Eat

This spot is easily a 10/10 restaurant, the food was exceptionally delicious, and the customer service was amazing, the service was quick and the Staff was very kind.

site_logo

Joshua S . 2023-07-21

MORE AT TripAdvisor

This amazing restaurant served the best Indian and Nepali food I've ever tasted. Not only tasted but just the sight of the food made my mouth water. I especially recommend this place to come with family and friends. The service here was amazing and all...

site_logo

Henry A . 2023-07-21

MORE AT TripAdvisor

Came here a second time and recieved even better service than last time! If i could give it 6 stars I would! Today I ordered chili chicken masala and chicen momo, this was so tasty and will definitely order again, all of the waiters were...

site_logo

thomasb1233 . 2023-07-21

MORE AT TripAdvisor

Amazing food and service. One of the best restaurants in Ashford serving top notch Nepalese and Indian cuisine.

site_logo

aadarp . 2023-07-09

MORE AT Google

Went to the Everest the other evening for the 1st time. Food was decent. However the reason for my review being 4 stars is the food could have been hotter in temperature.

site_logo

HARRY WILLIAM DEBLING ADI . 2023-06-18

MORE AT Google

Similary restaurants in South East

restaurant_img
4.5

247 Opinions

location-icon1 Apsley Street
Asian
outdoor_seating_195632takeaway_195632delivery_195632

food is good, nearly popped guys

restaurant_img
4.5

385 Opinions

location-icon31 Bank Street
Asian
outdoor_seating_83459takeaway_83459delivery_83459

Lovely food. We had the lamb, fish, and veg thalis along with some dumplings.

restaurant_img
4.5

490 Opinions

location-icon2-4 High Street
Asian
outdoor_seating_83626takeaway_83626delivery_83626

Love love love, such a lovely ambience and so friendly. We had a gorgeous meal, there is a little bit of a wait in between courses, but it just shows the food is fresh and also gives you time to digest and enjoy. Really enjoyed, lovely staff…..full packed menu and nothing too much trouble. Looking forward to going again VERY soon. Keep up the good work 🥰

restaurant_img
4.3

294 Opinions

location-iconCharing Hill
Asian
outdoor_seating_83270takeaway_83270delivery_83270

Ordered a large takeaway for 16 people. The order was exactly right, the food was delicious and the price was very reasonable. Would definitely recommend this restaurant.

restaurant_img
4.3

596 Opinions

location-iconBiddenden Road
Asian
outdoor_seating_178608takeaway_178608delivery_178608

Got a takeaway. 3 dishes and other bits, It was nice but the dishes were only half full. Real lack of amount but the food was good. Won't come again as other places locally give more food. But it was good in itself.