GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 1.205 opinions finded in 2 websites

site_photo4

Nº 402 in 1604 in Newcastle upon Tyne

Nº 11 of 54 Indian in Newcastle upon Tyne

CUSTOMERS TALK ABOUT DISHES WITH..meatbeautifulcoconutcookedcurrycoffeechickenspicyprawnfishgingerricelambmustchilliroundcauliflowermango

comment_iconOpinions

Amazing food, lovely friendly staff

site_logo

Linda O'dell . 2025-03-18

MORE AT Google

Delicious South Indian cuisine, takes me back to Happy days in kerela and goa. Crispy dosas, aromatic curries, stuffed paratha, mango lassi. Fantastic. Very friendly service too. I would definitely return and recommend.

site_logo

Andy Turnbull . 2025-03-11

MORE AT Google

It was my first time in the UK and this place made me feel like home.. the staff was really warm.. thank you so much for the service.. i would highly suggest this restaurant for whoever is coming to the UK..

site_logo

Sakshi gavendra . 2025-03-01

MORE AT Google

We went as part an after meeting do. There were quite a lot of us. Saying that the service was absolutely spot on. The food was preordered was really tasty and the Dosas to die for. Really yum. The area we were sitting in was a little dated but can't comment on the rest of the restaurant. Would really recommend this place especially if going with a group of friends.

site_logo

Kamal al-naimi . 2025-02-13

MORE AT Google

Have only been on a Sunday for the sapaad menu. Great for gluten free, dairy free, vegan etc. Would go more often but it’s pricey.

site_logo

R Peacock . 2025-01-30

MORE AT Google

Excellent food, genuine South Indian quality and taste, good service. Been a regular part of every visit to Newcastle.

site_logo

madankumar narayanan . 2025-01-22

MORE AT Google

I love the warm food. We always come on Sunday to get sappad. We look forward to to come on Sunday. You must try the food it's the best South indian food in UK!!!

site_logo

Vibha Hetu . 2025-01-20

MORE AT Google

Dosa Kitchen offers a fantastic dining experience with authentic South Indian flavors. The service is quick and friendly, making it a great spot for anyone craving a delicious and satisfying meal. Highly recommended!

site_logo

Vidhi Tejwani . 2025-01-18

MORE AT Google

Nice food and great service, would recommend but was slightly too cold in the restaurant but a nice meal overall

site_logo

Tom Brewer . 2025-01-15

MORE AT Google

Food is good. I will recommend not go when you hungry. Even though place is empty. They will take ages to cook.

site_logo

Suma C . 2025-01-14

MORE AT Google

Authentic and sumptuous South Indian food served by equally fantastic staff. Thank you!

site_logo

Karthik Gellia . 2025-01-12

MORE AT Google

Fantastic place, this was our second visit. Great food with lots of choice. Gluten free options were available and service were excellent- friendly and efficient. Lovely atmosphere too.

site_logo

Ady Langford . 2025-01-12

MORE AT Google

The Sunday thali was absolutely delicious, offering a perfect balance of flavors. Vishnu Priya’s and naimisha attentive and warm service made the dining experience even more enjoyable.

site_logo

Adhavan 0927 . 2025-01-05

MORE AT Google

I recently dined at Dosa Kitchen in Newcastle upon Tyne and had a delightful experience. The non-vegetarian thali was a highlight, offering a variety of flavorful dishes that showcased authentic South Indian cuisine. The chicken curry and prawn curry were particularly noteworthy, each cooked to perfection with rich, aromatic spices.  The service was exceptional, thanks to our waitress, Naimisha and Vishnu Priya. They were attentive, friendly, and knowledgeable about the menu, providing excellent recommendations that enhanced our dining experience. I highly recommend Dosa Kitchen for anyone seeking delicious South Indian fare accompanied by top-notch service.

site_logo

Manisha Manesh . 2025-01-05

MORE AT Google

One of the best Indian meals we’ve had in over 6yrs in UK. Totally gluten-free friendly. They actually use spice imaginatively and skillfully. The dosas have no wheat in them and the chutneys boast real flavour. We tried the chilli paste special; perfectly crispy, a little sour and a little chewy. The curries aren’t formulaic “choose your protein, then your sauce” ‘curry secret’ nonsense. Bold flavours, excellent technique and real spice mastery. The cocktails are both reasonably priced and delicious. Servers were lovely, caring and helpful. Absolutely restored our faith in the sorry state of Indian restaurants in the UK. No bland, unseasoned food here. We were one of the few guest white couples. Deffo returning with family.

site_logo

Gary Wise . 2025-01-03

MORE AT Google

The dosa’s we were served were very crispy, beautiful ambience and friendly staff😊 One down side is that the pudi in the dosa has a very mild flavour without making a difference. I’d opt for the plain dosa instead! But will definitely keep coming back

site_logo

Sharan Vinayak . 2024-12-14

MORE AT Google

Fantastic meal - beautiful service and a wonderful menu. Can’t wait to come back ! Definitely GET THE DOSA! 😍😍

site_logo

Lara Hollingworth . 2024-12-12

MORE AT Google

Great food, lovely staff and will be going back again.

site_logo

Kesh Bard . 2024-12-08

MORE AT Google

Great authentic Indian dosa, worth a visit. Really enjoyed the food and the service was good as well.

site_logo

Fatema rangwalla . 2024-12-06

MORE AT Google

Great South Indian in Newcastle. We were lucky to stay nearby and had a good dinner. Kids enjoyed the food and was one of the best.

site_logo

vadivelan natarajan . 2024-12-05

MORE AT Google

Excellent service and food is great

site_logo

Matthew Thoburn . 2024-12-03

MORE AT Google

Super Sunday Sapaadu! Really delicious filling meal. Staff very helpful with describing menu. I feel like I had a quick holiday to the south of India. Definitely recommend & will return soon.

site_logo

Neil Madden . 2024-12-01

MORE AT Google

Had the DK Special Dosa (again) - the one with 2 runny eggs - and a small plate of onion ragi pakora (fried onions) that was crunchy and a little sweet. Also had the mango lassi (not in picture). Perfect combination. Never let me down.

site_logo

Daniel Simandjuntak . 2024-12-01

MORE AT Google

Absolutely fantastic!!! The food is amazing, 10/10 Dosa. And to top it off, they are the showed the greatest kindness sending me back a precious necklace I lost on the premise. A testament to their good service ❤️

site_logo

Freya Logan . 2024-11-28

MORE AT Google

My favourite Indian restaurant.. very affordable and tasty food.. good service by staff members

site_logo

Malavika Sunilkumar . 2024-11-20

MORE AT Google

Absolutely amazing meal! Fresh and the flavors just blew our mind! The girl was serving us was not only very polite and patient with our several questions she was extremely knowledgeable about the menu! Overall just qm amazing experience! Highly recommended and great value for money

site_logo

Katerina Saridi . 2024-11-14

MORE AT Google

The food service are amazing. I love the food and the service. Looking forward to dine again!!!

site_logo

karan mandaliya . 2024-11-14

MORE AT Google

Amazing food! Excellent service! The warm bounty chocolate brownie is just spectacular 😋

site_logo

Mamta Rajani . 2024-11-14

MORE AT Google

Chicken 65 is crispy and spicy, while Mushroom and Chicken Manchurian are savory and tangy. Masala Dosa and Paneer Dosa offer crispy crepes filled with flavorful potato or paneer stuffing. Puri is fluffy and deep-fried, perfect with rich curries. Malabar Parotta is flaky and layered, pairing excellently with creamy Chicken Curry or spicy Paneer Curry.

site_logo

Pavan Sai Venkata Durga Prashanth Korapati . 2024-11-14

MORE AT Google

La comida india era fantástica. Disfrutamos comiendo los biryanis. El relleno dentro de uno de los alimentos, estaba hecho de puré de papas y estaba delicioso. El servicio fue excelente.

site_logo

Therese H . 2024-11-07

MORE AT TripAdvisor

Quite a regular to this place. The Sunday Saapadu (thaali) is excellent and worth every penny ! This place can get packed during dinner time, especially on weekends, so reserving is better. Their kotthu parotta (tuk-tuk parotta) is kind of meh, but their dosas, utthapam and other foods are excellent! The staff are friendly, but can sometimes be distracted by all the other tables. Their pricing is nominal and quantity is okay. Just be warned when ordering over Uber eats as the taste and quantity can vary drastically !

site_logo

Insect Guy . 2024-11-06

MORE AT Google

The dosa was delicious and the service was excellent.

site_logo

Buddhika Perera . 2024-11-03

MORE AT Google

Absolutely my go-to restaurant in Newcastle! The food is so authentic according to my husband from South India. I enjoy our meals there every time we go. Great place to eat with friends as well. The vibe is very relaxing and comfortable. Staff are amazing as they are so kind to us whenever we go there. I can truly feel that they genuinely try everything they can to bring the most authentic and delicious food from South India to people here. They really care about food and people. This is why I love going there so much.

site_logo

Brook . 2024-11-02

MORE AT Google

Food was very good here, really crispy dosa, fantastic chicken curry. Prices quite reasonable as well. The Sunday 'sapaad' (like a thaali) is worth trying to get a sample of many different dishes.

site_logo

Dinusha Chandratilleke . 2024-10-30

MORE AT Google

Probably the best South Indian good in UK. Must try Sunday Sapaad if you are in Newcastle.

site_logo

Vibhav Chauhan . 2024-10-27

MORE AT Google

First visit, very impressed. Tasty and filling mixture of dishes, either meat plus fish or vegetarian. List of the dishes in the set menus left on the table so you could tell exactly what you are eating.

site_logo

Nigel Morton . 2024-10-27

MORE AT Google

Went for an early meal with the family - everyone loved the food, including paratha, masala dosa, curries and uttapam. Friendly staff, a good variety of drinks and overall great service.

site_logo

Louise Southern . 2024-10-25

MORE AT Google

The restaurant is upstairs, but there is a lovely astroturfed courtyard where my wife and I sat with a patio heater on as she couldn't climb the stairs. Great service. The food was magnificent, well balanced spices, great Dosa and paratha to "tear and share".

site_logo

Simon Durrant . 2024-10-23

MORE AT Google

A lovely place with a warm welcome and delicious, subtle food at very fair prices. I was by myself, being on a work visit to Newcastle, and having walked up to Jesmond 'for old times' sake' (lived here 40 years ago!) came to the Dosa Kitchen on the strength of reviews here. I was made very comfortable -- not the case everywhere for solo diners -- and for less than £25 enjoyed a delicious 2-course meal with a pint of their own specially-brewed beer. And even on a Tuesday evening there was a good atmosphere; I was not rattling around the place :-) I thoroughly recommend this restaurant.

site_logo

Michael Gardiner . 2024-10-22

MORE AT Google

Great food and service at a reasonable price.

site_logo

Jerome Dominic . 2024-10-22

MORE AT Google

Amazing flavourful and reasonably priced food, fantastic service, gorgeous setting!

site_logo

Fran Walker . 2024-10-19

MORE AT Google

Los restaurantes del sur de la India son bastante raros en el Reino Unido, así que nos encantó encontrar este durante nuestra corta estancia en Newcastle upon Tyne. Como era de esperar, la bienvenida fue cálida y amable, en verdadero estilo indio. La comida en los restaurantes del sur de la India es completamente diferente de la que se encuentra en nuestros restaurantes tradicionales del norte, o Bangladesh, y es realmente increíble. Mi esposa y yo pedimos una Dosa por recomendación mía. Se trata de delgadas tortitas crujientes con una selección de diferentes rellenos en el interior. Elegí la Dosa Masala y mi esposa tenía la Dosa Paneer. Eran tan deliciosos como esperaba, y me aseguraré de visitar de nuevo en cualquier viaje futuro.

site_logo

William R . 2024-10-18

MORE AT TripAdvisor

Great little find. Very relaxed, no frills venue with fantastic authentic south Indian food and inventive cocktails. The sambar Vadha was especially good! Like a savoury doughnut. Pictured is their Dosa. The paneer dosa was great.

site_logo

Delilah Ash . 2024-10-12

MORE AT Google

One of the most authentic South Indian food I ever had in the UK. It felt like having homemade food. The taste, how the menu was designed, ambience and the interiors, told a lot about this place. Good creative work. I would definitely come back to this place whenever I visit Newcastle.

site_logo

Arungandhi IC . 2024-10-10

MORE AT Google

Very friendly service, bustling atmosphere. Beautiful crispy Dosa and well flavoured curry. Delicious!

site_logo

Yuriko . 2024-10-05

MORE AT Google

Solo dining this evening but this hidden gem in Jesmond did not disappoint.

site_logo

Yvonne Griffiths . 2024-10-05

MORE AT Google

The most delicious food and gorgeous service from Naimasha

site_logo

Anna Mennell . 2024-10-04

MORE AT Google

Good South India food. Kongu cuisine available here. Fairly priced and good portions. Staffs provide good service. Has enough parking onsite. Walking distance from Jesmond metro. Good choice for a family eat out.

site_logo

Visakh Murukesan . 2024-10-04

MORE AT Google

South Indian food is very nice... Mango drink was awesome, One of the very few restaurant where you can get tawa chapati...

site_logo

Nitin Gupta . 2024-09-28

MORE AT Google

Authentic South Indian restaurant. Very tasty Dosas and curries. Will go again if I am in New Castle

site_logo

Lourdes Waugh . 2024-09-26

MORE AT Google

Best food. LOVELY STAFF AND GOOD SERVICE.

site_logo

TARLOCHAN SINGH . 2024-09-22

MORE AT Google

Most authentic Indian food in Newcastle

site_logo

Leo b-g . 2024-09-21

MORE AT Google

Fantastic all round. Particularly for Vegans, as there's plenty of choice. The extensive menu makes it difficult to choose, as it's all so good. Mango lassi was best I've ever had!

site_logo

Sue . 2024-09-18

MORE AT Google

We just had yet another fantastic meal at Dosa Kitchen, this time the special feast celebrating Onam (the harvest festival held in Kerala). The feast included a wide range of amazing, authentic vegetarian dishes, and the staff were attentive and quick to bring refills of our favourites.

site_logo

Jamie Weston . 2024-09-15

MORE AT Google

Very good South Indian restaurant at Jesmond

site_logo

Subbu Swaminathan . 2024-09-14

MORE AT Google

Vinimos aquí por nuestros amigos 30 cumpleaños. Este lugar es fantástico, la comida era brillante y nos hicieron sentir muy bienvenidos. Gracias por un gran día.

site_logo

Curious593058 . 2024-09-10

MORE AT TripAdvisor

Estuve en Dosa Kitchen muchas veces ahora, cada vez ha sido de primera clase! No podía conseguir mejor comida y personal más amable. Lo recomendaría.

site_logo

Ben R . 2024-09-10

MORE AT TripAdvisor

Dosa kitchen is in a bit of a rush to close up shop! I'm not sure if the management is aware of this. Whenever you place an order, they often say the kitchen will be closing in just 10 minutes. I have to say, the masal dosa deserves a solid 5 out of 5! However, it seems like the staff isn't really helping to boost the business.

site_logo

reby pk . 2024-09-09

MORE AT Google

Online it states the restaurant is open until 8:30pm. I arrived at 7:15pm to be told by the staff that the kitchen was closed and we could not be served any food. This is the second time this has happened. Change time online if the kitchen is going to close over an hour before closing time

site_logo

Anu Sidhiq . 2024-09-09

MORE AT Google

Best Indian restaurant in Newcastle. Extremely good south Indian food, with kind staff and good service. Excellent value for money as well

site_logo

Matthew Johnson . 2024-09-08

MORE AT Google

The best Desi dine out place in Newcastle. Food was awesome, great ambience and top notch service. I would strongly recommend...

site_logo

Suneej k.t . 2024-09-05

MORE AT Google

This has to be my favourite Indian in the UK. The quality and taste of the food is unbelievable! I cannot sing praises high enough. The dosas and thalis are incredible! If you like very delicious food, Dosa Kitchen is the place to come. They also have a food stall at markets, which is worth a try too! Oh and the dosas are naturally gluten-free, which is also a bonus.

site_logo

Em . 2024-08-31

MORE AT Google

We love coming to Dosa Kitchen. The food is always fantastic and I recommend to everyone I know. Masala dosa is our favourite!

site_logo

Ethan Gray . 2024-08-29

MORE AT Google

Superb Taste. Zero waiting timea for food. My order was faster than mac'd 😂. Fresh. Hot and Yummy

site_logo

chathura madubashana . 2024-08-28

MORE AT Google

Fantastic staff, amazing food, best service. Recommend this restaurant to anyone wanting authentic southern Indian food. Me and my husband loved it and will def go again

site_logo

Amica Puri . 2024-08-22

MORE AT Google

Its a hidden gem for people from outside Newcastle.I really recommend for people craving for Masala Dosa and filter coffee. Reallyyy loved it

site_logo

neenumerin thomas . 2024-08-20

MORE AT Google

Fuimos a la fiesta del domingo, que era delicioso. La dosis fue genial. Me encantó la variedad de los currys, entrantes, chutneys y postre y todos estaban muy sabrosos. La camarera era muy servicial y amable y nos explicó todo ya que era nuestra primera vez. El lassi también era encantador. Definitivamente volveré!

site_logo

Sarah C . 2024-08-18

MORE AT TripAdvisor

Food is good,but a little expensive.

site_logo

Thomas Ninan . 2024-08-15

MORE AT Google

Very good South Indian restaurant serving authentic prepared South Indian food. Service from staff is excellent and owner is a friendly chap happy to have a conversation about restaurant and Newcastle. Will look forward to eating here again in my next visit.

site_logo

David Chong . 2024-08-09

MORE AT Google

Been visiting this place since it started in small shared kitchen in Beacon west gate road. Fresh ingredients and food is always fresh without overdoing of spices or Masala’s. Sunday Sapad is excellent with good choice of selections. Having free seconds refill is good if you want to try more. Wife is Vegan she love the place too as good Vegan alternative available. Customer service is good with very courteous staff.

site_logo

Vinny Kondragunta . 2024-08-04

MORE AT Google

We ordered take away dosas but while waiting enjoyed a drink and then noticed the pizza truck …..WOW! Amazing! So tasty. The staff are so friendly and one of the owners was very attentive . The food was authentic and absolutely delicious. thank you . Would 100% recommend!

site_logo

Nicky C . 2024-08-03

MORE AT TripAdvisor

Without a doubt the best Indian food in Newcastle. Fabulous service, interesting menu and seriously tasty.

site_logo

Matthew Bowker . 2024-08-03

MORE AT Google

Amazing food arrived quickly fantastic value for money unique dishes can not recommend this place enough. The dosa is on another level will be back very soon. OUTSTANDING!!!

site_logo

Stephen Hunt . 2024-07-31

MORE AT Google

Quite enjoyed the food here. There’s some parking outside. You get 90 mins at the table and I’d recommend reserving a table as it gets busy. - Paneer dosa with potato masala: absolute star of the show. Very tasty. - Chilli chicken: had a good kick. Really liked it. - Chettinadu Kola Urandai (lamb kofta): alright - Lamb nilgiri kuruma: tender meat. Curry was average flavour wise and not very spicy. - Pondy meen curry: fine - Kai Kai kuruma: probably my favourite of all the curries taste wise. They do chapatti and parota but no naan. Pretty well priced. Need to try their 2 Rowdy Pizza next.

site_logo

Dollar Reviews . 2024-07-28

MORE AT Google

Authentic Tamil food. Loved it.

site_logo

Shankar Chandran Swayamprabha . 2024-07-21

MORE AT Google

Outstanding food, possibly the best indian cuisine I've had, really different selection of dishes, and we ordered it to our door! Thanks 😊

site_logo

Lola O . 2024-07-21

MORE AT Google

Fabulous. The potato masala in the dosa was so tasty. As was the lamb nilgiri but special mention for the chickpea curry, amazing flavour

site_logo

Bill Comer . 2024-07-21

MORE AT Google

Great South Indian food - sweet lime soda reminds me of goa

site_logo

danny nash . 2024-07-14

MORE AT Google

Tasty food and friendly service.. Totally enjoyed!!!

site_logo

Preethi Dev . 2024-07-09

MORE AT Google

Very nice south Indian restaurant. I tasted south Indian food after 1 month and all the dishes tasted exactly how it will be in Tamil Nadu. Good atmosphere as well thanks !

site_logo

Hari Haran . 2024-07-08

MORE AT Google

We went for Sunday Sapad (Platter) at Dosa Kitchen Newcastle. Loved their food and ambience. NON-VEGETARIAN SAPAAD 1 x Meat Starter, 1 x Fish Starter 1 x Muttai (Egg) Masala (main side) 1 x Meat/Chicken Kozhambu (main side) 1 x Fish Side Dish (main side) Accompanied by Dosa (X1), Sambhar, Chutney, Rice, Rasam, Pickles, Yoghurt, Paapad, Sweet Dosa Kitchen❤️ Halal ✅ PS: Their chilli ginger cooler is amazing, definitely try it. Plus Mango Lassi is 10/10

site_logo

Haider Ali . 2024-07-03

MORE AT Google

Best Dosa place is Newcastle, I highly recommend everyone to visit and try once. I am a regular customer and go there almost once in two weeks.

site_logo

Varun Goyal . 2024-07-03

MORE AT Google

Amazing place that we stumbled upon by accident - you can easily miss it from the main/Osborne Road as you need to go around to the rear of the building. It is well worth it! Best South Indian food I’ve ever had. Lovely staff. So good we went back the following night. All round great.

site_logo

Andrea Joseph . 2024-06-30

MORE AT Google

Some really good south Indian food!

site_logo

Mark Playford . 2024-06-24

MORE AT Google

One of the most authentic Indian restaurants I’ve been too. Service was impeccable and the food was just awesomely delicious!!!

site_logo

Gareth Baxendale . 2024-06-19

MORE AT Google

Fantastic Indian food in New Castle.

site_logo

Methunarajan Arul . 2024-06-14

MORE AT Google

I came here with a friend whilst visiting her at uni - this was FANTASTIC! I can't recommend more! They even made sure to accommodate my coconut allergy and I had such a good meal.

site_logo

Sophie Brodie . 2024-06-13

MORE AT Google

Best Dosa in Newcastle! Everything on the menu is amazing and very reasonably priced

site_logo

Ashika Srivastava . 2024-05-31

MORE AT Google

The Dosa for starters was lovely couldn’t fault. However I had got the prawn curry. I’m currently on day 4 of not being able to eat or keep anything down. This has resulted in me having to go to hospital to get IV medication due to severe dehydration and fatigue. The prawn curry came out cold and felt rushed. An hour after I had the curry I was never off the toilet and sadly 4 days after I’m still not. My friends had chicken dishes and have been fine, the only thing different we ate was the prawn curry. Currently the hospital are testing for two different types of food poisoning which are campylobacter and gastroenteritis caused by food poisoning. It is a real shame as, staff and atmosphere were fantastic!

site_logo

Antonia R . 2024-05-27

MORE AT TripAdvisor

Extremely quick and friendly service, fantastic food and very reasonably priced. The dosas were amazing.

site_logo

Jordan Sach . 2024-05-25

MORE AT Google

We’ve been twice now and each time the service and the food has been superb. Looking forward to our next visit and would highly recommend.

site_logo

pipjones04 . 2024-05-19

MORE AT TripAdvisor

One of our favourite restaurants in Newcastle. Best dosa we've had outside Sri Lanka. Excellent value. Good beers available. Sunday sapaad brilliant alternative to Sunday lunch. Very fast service so great if with kids.

site_logo

Faye Hall . 2024-05-16

MORE AT Google

A nice and authentic South Indian restaurant in Newcastle

site_logo

ranjith Dinakaran . 2024-05-15

MORE AT Google

Probably the best place in and around Newcastle and Durham area if you're looking for authentic South Indian delicacies.

site_logo

Aditya Srinivas . 2024-05-15

MORE AT Google

Best Dosa in town. Some of their dishes such as Methu vada and Chilli chicken are fantastic. I wonder why Sambar is not given with vada. This is standard practice in South Inda. Young staff are friendly. Little tweaks are necessary; such as ambiance and car parking. One very important point. NOT DISABLED friendly. No lift or escalator. Restaurant is upstairs.

site_logo

Mohan George . 2024-05-13

MORE AT Google

Good food Good service yes i would recommend 100%

site_logo

weird hooman . 2024-05-12

MORE AT Google

Really good. Would recommend to all of them craving for South Indian food.

site_logo

Anshu George . 2024-05-11

MORE AT Google

Food was absolutely brilliant, so tasty if I wasn't full from the generous portion size, I would have gone in for seconds. Lovely little place with friendly staff.

site_logo

Katrina Moffat . 2024-05-09

MORE AT Google

A nice place for Dosas and Parotta. A must visit place for indian food. A bit pricy, still worth it.

site_logo

Narenthira Prasath D . 2024-05-04

MORE AT Google

Attentive service and food served piping hot. Water served nicely too.

site_logo

David Stevenson . 2024-05-03

MORE AT Google

Similary restaurants in North East

restaurant_img
4.5

714 Opinions

location-iconArchbold Terrace, Old Jesmond Station,
Indian
outdoor_seating_85326takeaway_85326delivery_85326

Good table, efficient service even though they were very busy. We had a range of food dishes, all were very good with flavour and just about the right level of spice and heat. Quantities easily enough for 1 person per dish. Pleasant friendly busy atmosphere.

restaurant_img
4.5

437 Opinions

location-icon199-201 Two Ball Lonnen
Indian
outdoor_seating_227245takeaway_227245delivery_227245

Muy bonito pequeño restaurante íntimo y excelente comida, servicio y relación calidad-precio. Toma tu propio alcohol también. Gracias.

restaurant_img
4.5

437 Opinions

location-icon232 High Street
Indian
outdoor_seating_87819takeaway_87819delivery_87819

It's nice. It is up there. I highly recommend. Can't fault it. Lovely staff. Lovely food. Through no fault of their own I have to mark it down 1 because there's a few others within a few miles and their all on par with each other. None stand out massively.

restaurant_img
4.5

814 Opinions

location-icon27 Sandhill
Indian
outdoor_seating_226848takeaway_226848delivery_226848

Genuinely disappointing. I'm a big fan of Asian food and I can honestly say this was pretty poor. The poppadoms came over cooked and just tasted of burnt vegetable oil. I had the mixed kebab starter which had one lamb chop one piece of chicken tikka and one onion bhaji (not really a mixed kebab). I like my curries fairly hot, so I had chicken tikka madras. The chicken didn't look like it was tikka but I was told it definitely was. The sauce was like soup and there were only 5 pieces of chicken in the whole dish. The chapattis were the only saving grace, fresh warm and pretty nice. Other than that very poor as a whole.

restaurant_img
4.5

504 Opinions

location-icon17 Grey Street
Indian
outdoor_seating_325529takeaway_325529delivery_325529

Just had a fantastic meal at Ayla. Great food, great service and a friendly atmosphere. We shall return