GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.4

Based on 3.153 opinions finded in 4 websites

site_photo4

Nº 104 in 401 in Thurrock

Nº 10 of 27 Indian in Thurrock

CUSTOMERS TALK ABOUT DISHES WITH..currybeautifulvegetablemeatoilprawnspicychickengarlicfishprawnsricecookedtandoorilambonion

comment_iconOpinions

Great food, always hot. Great value and top quality food.

site_logo

Brent . 2024-11-24

MORE AT Just Eat

The service was brilliant very well presented people and very friendly staff, but unfortunately the food wasn’t there for me it was lacking a lot of flavour

site_logo

B . 2024-11-16

MORE AT Google

Brilliant …needed cheering up after a tricky week and this did just the job. Excellent food and an excellent service … thanks Desi.

site_logo

John . 2024-11-08

MORE AT Just Eat

Such a tidy restaurant with the yummiest food. The service was so good and Sunny our waiter was so attentive and a good laugh too. Thanks so much for your warm welcome! - Ray, Lucy and Vik

site_logo

Vee . 2024-10-30

MORE AT Google

Wow! What can I say? This restaurant is absolutely amazing! The food is very delicious! The staff are so friendly, warm and accommodating! They really make you feel at ease and they are very interactive! The atmosphere is second to none, especially on a Friday night. You can also bring your own alcohol, which is really good as well. It's very rare that I give an establishment a 5 star rating all round, but this restaurant definitely deserves it. Highly recommended!

site_logo

B V . 2024-10-30

MORE AT Google

A fantastic experience! The staff are very friendly and attentive and the food is amazing! We had a 4-course meal for only £15! Small touches made this experience exceptional such as the dry ice on the table when the mains arrived, the warm hand towel and the chocolate with the bill. Shout out to Sunny who was our waiter who went above and beyond to make our night what it was. We will be back for 'Curryoke' Friday! Highly recommend visiting this restaurant 👍🏼

site_logo

Christie . 2024-10-29

MORE AT Google

I love desi food. Their food is finger licking good. All the food taste is mindblowing. They made my day with their food & service. Best place I have visit ever visited. Thank you guys.

site_logo

Nazmul Rafi . 2024-10-28

MORE AT Google

love this restaurant but expensive

site_logo

Robert . 2024-10-27

MORE AT Just Eat

Food is very good - beautifully presented,good sized portions and very tasty! All staff are very friendly and attentive. Would definitely recommend if you like good food, music and a great night out!

site_logo

A J . 2024-10-26

MORE AT Google

Always order from Desi but tonight the quality was very poor. Food arrived luke warm, watery and tasteless. Very disappointed to say the least

site_logo

Mia . 2024-10-23

MORE AT Just Eat

Food was good service was amazing prices are fair would definitely recommend to go had the 4 course offer £1495 pp

site_logo

margaret johnson . 2024-10-23

MORE AT Google

Always a great time here with great food and a brilliant service

site_logo

Ian Divers . 2024-10-21

MORE AT Google

Very nice food highly recommended

site_logo

Christopher . 2024-10-20

MORE AT Just Eat

Great food and great service. Highly recommended!

site_logo

Lauren Page . 2024-10-18

MORE AT Google

Too good, excellent food, service from sunny was top noch. Best food I have had in a long time. Great value for money . Recommended to anyone. Very very satisfying. 10 is not a high enough score.

site_logo

Antony Kemp . 2024-10-17

MORE AT Google

We came here for a birthday and was served by Sunny. He was very attentive, accommodating, and attended to all our needs. The service is excellent, staff are very kind, friendly and welcoming. Food was amazing and faultless. We will definitely be coming more often!

site_logo

Pavneet Johal . 2024-10-16

MORE AT Google

Was my go to Indian. Last 2 orders have let me down. Last night king prawn main was over cooked, for £13 dish I expect better. Will be trying village India next time

site_logo

David . 2024-10-12

MORE AT Just Eat

Never do I have a more pleasant meal than when I’m at Desi! The team are so polite and helpful, going above and beyond to make us feel welcome. Thanks Adam, for the wonderful care given to us. Considering the fresh ingredients and flavorful dishes, you really get more than what you pay for. Highly recommended for those who want a quality meal without breaking the bank. ✅ Forever repeat customers!🍴

site_logo

emma w . 2024-10-09

MORE AT TripAdvisor

Can’t believe how expensive your chicken madras is!!! From £10.95 to £12.95!!!! Your curry is already expensive sir, n now it’s even more expensive, you don’t even pay that price in Mayfair!!! Everywhere else in grays Indian restaurants the madras is between £7.45 to £8.95!!!!! I’m sorry you really need to reduce your prices!!!! Not just on the madras. After 15years buying from you, I’ve gone somewhere else. I used to buy of you 2/3 times a week!!!! Now I buy from Agra n it’s as good as yours for £7.95!!!! I’ll comeback when you’ve reduced your prices on everything. Thank you so much. I just had to tell you, before you start losing customers 1 by 1!!! Thank you so much.

site_logo

Majed Rafiq . 2024-10-09

MORE AT Google

Excellent meal and excellent service, spot on time. Tried the Gunpowder Lamb tonight. Lovely meal. That’s one for the favourites list.

site_logo

John . 2024-09-29

MORE AT Just Eat

the delivery was late despite asking for it to be delivered at a specific time. food was cold, the paneer was where? so disappointed and led by reviews.

site_logo

Paula . 2024-09-27

MORE AT Just Eat

It was our first time dining in the Desi , we had previously only had takeaways. Wonderful ambience inside very friendly , happy staff particularly Abdul. The food was fantastic would definitely go back.

site_logo

Chris . 2024-09-22

MORE AT TripAdvisor

All good, apart from the biryani was lacking in flavor. Good service as always.

site_logo

Jayne . 2024-09-21

MORE AT Just Eat

Very enjoyable meal. Good service and price. Highly recommended

site_logo

Barbara . 2024-09-21

MORE AT Just Eat

Had to ring up and ask after thay said delivered but had no food .but sent it back out had to warm it all up in the microwave .but last week was perfect spent .75pd between 5 off us

site_logo

Dionne . 2024-09-14

MORE AT Just Eat

Excellent Vindaloo and Pistachio Chicken. Lovely meal to warm us up and round off the week.

site_logo

John . 2024-09-13

MORE AT Just Eat

Amazing food! So tasty, best Indian around

site_logo

Kayleigh G . 2024-09-08

MORE AT Google

always come for the north Indian garlic mixed grill thank you

site_logo

mark . 2024-09-07

MORE AT Just Eat

Really nice food will ordered again from you

site_logo

karen . 2024-09-06

MORE AT Just Eat

Had a lovely meal. Good food and an excellent service.

site_logo

John . 2024-09-06

MORE AT Just Eat

Excellent meal. Love the food at Desi Dining. Just the job for Sunday.

site_logo

John . 2024-09-01

MORE AT Just Eat

The food turned up cold considering the restaurant is only round the corner,the Kema nan had no meat what so ever,and both myself and partner have woken up with upset stomachs

site_logo

Rickie . 2024-09-01

MORE AT Just Eat

Little bit late, but 100% worth the wait! Absolutely gorgeous! Knocking it out the park, Desi!

site_logo

Sophie . 2024-08-31

MORE AT Just Eat

Outstanding food and outstanding service

site_logo

Yasmin Hussain . 2024-08-27

MORE AT Google

Great food, friendly staff, good atmosphere!

site_logo

shelley bower . 2024-08-25

MORE AT Google

I liked the chicken nuggets and they were super kind to me and my friends

site_logo

Claire H . 2024-08-25

MORE AT Google

The food is always high calibre and I have craved their cooking all week! I do not go to any other indian restauraunt than this place, it is always on point.

site_logo

mana . 2024-08-24

MORE AT Just Eat

Whilst the food was ok 2 of the dishes were very watery and the food on a whole was v oily and I had to pour some oil away.

site_logo

Dan . 2024-08-24

MORE AT Just Eat

The food is just too good, well worth the price and they take note of any specific requests, just amazing place!

site_logo

mana . 2024-08-24

MORE AT Just Eat

Save your money for a proper Indian, the food had no taste the sauce was watered down with no consistency whatsoever. This is by far the worst Indian I’ve ever tried, probably have more taste with a microwave meal from Icelands rather than a £76 meal that already had a 40% discount added. Please use a different restaurant!

site_logo

gary . 2024-08-23

MORE AT Just Eat

Been using Desi Indian Dining for a number of years and never disappointed. One of the very best Indian restaurants in the area and my first choice for a take-away. Excellent food and love the Onion Bhajis.

site_logo

John S . 2024-08-18

MORE AT TripAdvisor

Excellent food and excellent service. Always look forward to meals from Desi.

site_logo

John . 2024-08-06

MORE AT Just Eat

Food was fantastic, arrived piping hot and arrived early. I’ll be ordering from here next time

site_logo

Stuart . 2024-08-05

MORE AT Just Eat

absolutely fantastic! You cannot beat this place for a curry, absolutely love it!

site_logo

mana . 2024-08-02

MORE AT Just Eat

Best Indian I've ever had hands down!! Food was delicious, well prepared and well served, Drinks were lovely and the cocktail they gave me was tasty and extremely well presented. The service was exemplary aswell nothing was too much trouble. Would recommend this restaurant to anyone who enjoys a great dining experience!

site_logo

Nix Kemp . 2024-07-30

MORE AT Google

best food ever honestly been going to desi for months and everytime is a delight the service is great the food is to die for. Always hungry for more desi can never get enough

site_logo

Scarlett White . 2024-07-27

MORE AT Google

Indian Cuisine at its finest absolute superb highly recommended

site_logo

Christopher . 2024-07-27

MORE AT Just Eat

Great food and friendly atmosphere 👌

site_logo

Emma Thompson . 2024-07-26

MORE AT Google

Excellent food and customer service! Love this place 👍

site_logo

Ali . 2024-07-26

MORE AT Just Eat

Ordered yesterday, and today me and my husband both have food poisoning

site_logo

Jade Tucker . 2024-07-20

MORE AT Google

Needed a good feed having worked all day in the garden. This certainly did the trick. Excellent meal, just the job.

site_logo

John . 2024-07-14

MORE AT Just Eat

Excellent meal, as always. Was looking forward to it so nice it was early … hungry too :)

site_logo

John . 2024-07-05

MORE AT Just Eat

value for money, fabulous quality food. the chef is different class. the team are always nice and friendly, with a great sense of fun. Desi has definitely got their own unique sense of excellent customer service. A real point of difference compared to other Indian takeaways in the area. I can't recommend highly enough. well done and thanks. Great food, great team and great chef.

site_logo

Trevor . 2024-07-05

MORE AT Just Eat

Excellent meal, tried different things today - good to experiment as we can always rely on the quality of food from Desi. Lovely meal.

site_logo

John . 2024-06-28

MORE AT Just Eat

On a Nutracheck Protein Power diet challenge this week so tried a lamb dish. Excellent vindaloo. Lovely food … thank you.

site_logo

John . 2024-06-21

MORE AT Just Eat

Excellent food. Needed something to cheer us up after a rainy week. Lovey meal.

site_logo

John . 2024-06-15

MORE AT Just Eat

Excellent as always, food quality is amazing n taste is 100% authentic. Excellent place for excellent food.

site_logo

Majed . 2024-06-09

MORE AT Just Eat

Excellent meal again this evening and needed as picked up a rotten cough and cold this week, so this helped cheer us up… thankyou.

site_logo

John . 2024-06-07

MORE AT Just Eat

Yet again excellent food. Tasty and hot.

site_logo

Teresa . 2024-06-06

MORE AT Just Eat

Exactly on time, and an excellent meal. Just back from a short break away and looked forward to this evening’s meal, all the way home.

site_logo

John . 2024-06-02

MORE AT Just Eat

Sent me a cheese naan instead - so had to throw it away

site_logo

Gareth . 2024-06-01

MORE AT Just Eat

What on earth is this place the food isnt good at all i always hope for good food its up to you if you want to go there so many food place to go to its all up to you if you feel like you want to go there its really up to you i always look for good food sometimes mistake can happen on about flavour but its blend but again i tried twice i didnt like it everyone wants to look foward to good curry house i have been to Orpington their curry house are good i wouldnt tell you the name of restaurant you can look for it your self and i give you clue they do banquet night £15.95 per person anyways thank you i didnt like their food

site_logo

M Chowdhury . 2024-05-29

MORE AT Google

Rung up to ask where my food was and got told it would be 5 minutes. Turned up 20 mins late with no explanation. Food was luke warm

site_logo

Bradley . 2024-05-27

MORE AT Just Eat

Excellent Indian cuisine everything was delicious

site_logo

Christopher . 2024-05-26

MORE AT Just Eat

delivered to wrong address. Had to wait over hour and half. The problem was not with the restaurant it was just eat delivery driver. Can not fault Desi the restaurant as they redone my order

site_logo

Robert . 2024-05-26

MORE AT Just Eat

Excellent meal, as always. Feeling adventurous so tried two new dishes this evening and was well-worth it. Lovely food.

site_logo

John . 2024-05-25

MORE AT Just Eat

Food was phenomenal n a good deal. Thank you.

site_logo

Majed . 2024-05-19

MORE AT Just Eat

The food has arrived 2 hours after I placed the order. I needed to call the restaurant three times. The second time I called I was told that the food had leaked on the way and it was been resent. I would have appreciated and apology at the very least and it's disappointing that I needed to keep calling to find out what was happening.

site_logo

Darren . 2024-05-18

MORE AT Just Eat

Lovely meal again. We do look forward to these Sunday dinners, and another excellent one today.

site_logo

John . 2024-05-12

MORE AT Just Eat

At Desi you always eat super well. The atmosphere is very familiar and the service is unbeatable. Every time I go to Grays I try to stop by ❤️

site_logo

Umaima Ahmed . 2024-05-12

MORE AT Google

some of the food was burnt. Never eat food from this place,

site_logo

David . 2024-05-12

MORE AT Just Eat

Good quality of food tasty and big portions . Lovely staff .

site_logo

Karolina Ksit . 2024-05-09

MORE AT Google

Excellent service. I’ve said “delivered early”. I’d ordered for delivery asap. And it certainly was …Perfect. And as usual, an excellent meal, just the job after a long frustrating day. I do love their Onion Bhajis too. Thanks Desi.

site_logo

John . 2024-05-08

MORE AT Just Eat

beautiful food. by far the vest Indian food in the area.

site_logo

Trevor . 2024-05-06

MORE AT Just Eat

Yet again. Delicious food. Would order again

site_logo

Teresa . 2024-05-05

MORE AT Just Eat

Order was late, food was all cold and spilled all over bag so stained all the sides, sag paner was disgusting, everything else was tasteless and all the meals were dripping with excess oil and grease, one of the worse Indians I have had.

site_logo

David . 2024-05-04

MORE AT Just Eat

Great food, tastes great. my go to Indian restaurant never disappointed

site_logo

Lauren . 2024-04-17

MORE AT Just Eat

Excellent meal. Tried something new tonight, Chicken Murgh Masala, really enjoyed that. Time to venture onto a few other new things.

site_logo

John . 2024-04-16

MORE AT Just Eat

Food was really nice but it just got delivered 30 minutes late, could be because it was Eid, but yeah food was really nice 😊

site_logo

Stephanie . 2024-04-10

MORE AT Just Eat

Unreal experience at Desi with my partner. The service was great and the food was amazing. Will definitely be returning soon! Thank you so much for a fantastic evening

site_logo

29091995 . 2024-03-30

MORE AT TripAdvisor

Two excellent meals this evening, as always.

site_logo

John . 2024-03-26

MORE AT Just Eat

didn’t tell me they weren’t delivering until tomorrow until after i had paid!

site_logo

Laura . 2024-03-24

MORE AT Just Eat

There wasn’t much meat in the mixed grill, there was more vegetables

site_logo

Eamon . 2024-03-19

MORE AT Just Eat

Excellent meal. Excellent service. Love the food here… thanks Desi.

site_logo

John . 2024-03-19

MORE AT Just Eat

The best Indian restaurant the we went for the first time there and we ask to recommend something and they was very helpful and very patient with us and very friendly I recommend to everyone desi restaurant the best best best

site_logo

Attila Baricz . 2024-03-16

MORE AT Google

I’ve been coming ere for a few years now, I mainly go n pick my food up, sometimes I get it delivered, this is the second time the popadoms n the food was not fresh. I have left 5 star reviews for DESI before, being honest this 2nd time food was not fresh at all. Unfortunately I won’t be ordering again.

site_logo

Majed . 2024-03-10

MORE AT Just Eat

we dont go to no where else desi is the best around food is always 10/10 service is always 10/10 lovely and friendly people when eating in also

site_logo

Charlotte . 2024-03-03

MORE AT Just Eat

Really great atmosphere and service. Friendly staff and tasty food. Excellent all round and good value for money.

site_logo

Tunde Ojetola . 2024-03-01

MORE AT Google

Disappointing. Watery sag aloo..cold unstuffed stuffed paratha and very greasy sauces with the main. I imagine the 5* reviews are their friends or drunk eating in. Not too friendly when collecting either

site_logo

Simon Bones . 2024-02-18

MORE AT Google

My go to Indian place even after moving to London! There is so much choice in this restaurant, yet each dish tastes fresh and delicious! The service is always impeccable 👌🏼 Also, £14.95 for a 4 course meal is a bargain! Give this restaurant a try and I am sure you will not be disappointed 😊

site_logo

Ilona Wrzeszcz . 2024-02-18

MORE AT Google

Very friendly staff, amazing food, thank you

site_logo

Lukasz Chmielnicki . 2024-02-18

MORE AT Google

Very good atmosphere and lovely accommodating staff. Will definitely come back. We loved the smoke bomb and food was nice. Thank you.

site_logo

Danielle Lambert . 2024-02-11

MORE AT Google

Both curry’s were very runny and watery and the korma wasn’t coconut enough very disappointed …..

site_logo

Dionne . 2024-02-10

MORE AT Just Eat

Best restaurant in Grays by a mile, been doing it for years and they have it mastered. Lovely fresh tasty Indian food with fantastic service and a great Atmosphere

site_logo

Simon McLean . 2024-02-10

MORE AT Google

Delivered on time by a friendly delivery man. Food was hot and tasted very good

site_logo

Nichola . 2024-02-10

MORE AT Just Eat

Staff go above and beyond for all customers. The food is amazing and nothing is too much trouble. Service and attention to detail is impeccable. Would highly recommend. I have friends who live in various areas in the south east and whenever they visit, they’ll always come to Desi! They think it’s worth the journey up. For a quiet meal or a party vibe it’s all. Can’t praise both the Abzs and Adam but all staff are friendly, helpful and welcoming. 10/10!

site_logo

emma waterman . 2024-02-04

MORE AT Google

Great atmosphere great food huge portions, great cocktail selection too

site_logo

Tuhin Ahmed . 2024-02-03

MORE AT Google

We received Utmost satisfaction and exceptional service at your restaurant, specifically from Sunny and Minhaz. Thank you for maintaining such high standards of service at your restaurant. we look forward to returning soon.

site_logo

Maureen Ijeoma . 2024-02-02

MORE AT Google

Third class service as well as third class service I will never recommend this restaurant if you have extra money so you waste on them

site_logo

Waseem ullah . 2024-02-02

MORE AT Google

Lovely food, piping hot and delivered early just as we were getting hungry … perffect.

site_logo

John . 2024-02-01

MORE AT Just Eat

Similary restaurants in East of England

restaurant_img
4.4

1352 Opinions

location-icon53-55 Orsett Road
Indian
outdoor_seating_133092takeaway_133092delivery_133092

Food is ok but they always miss things off your order. So frustrating so won't be ordering again.

restaurant_img
4.3

265 Opinions

location-icon3 Lampits Hill
Indian
outdoor_seating_173120takeaway_173120delivery_173120

Went for a sunday buffet, food was bland and tasteless, wouldnt give clean plates so had to scrape unwanted food onto a plate in the middle of the table, ordered kids 3 cokes wich were poured from a bottle wich was flat, the kids didn't say anything so i only relised when i had a sip 2 large cokes £9.00, front of house man was rude when asked to remove cost of drinks....wont be going back anytime soon

restaurant_img
4.5

995 Opinions

location-icon29 Lodge Lane
Indian
outdoor_seating_133109takeaway_133109delivery_133109

Really welcoming, food lovely, staff friendly.

restaurant_img
4.5

337 Opinions

location-icon64 High Street
Indian
outdoor_seating_167157takeaway_167157delivery_167157

The food here is incredible, the staff are super friendly

restaurant_img
4.5

1154 Opinions

location-icon667-669 London Road
Indian
outdoor_seating_133051takeaway_133051delivery_133051

We have been happy customers of Shampaan for many years now. Having tried all of the rival establishments in the local area I can accurately say this is the best. The staff are courteous and attentive and the food is always fresh and flavourful. We alternate regularly between dine-in and takeaway for our weekly takeout treat.