GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 626 opinions finded in 1 websites

site_photo3

Nº 904 in 1596 in Wiltshire

Nº 177 of 366 British in Wiltshire

CUSTOMERS TALK ABOUT DISHES WITH..ladysaladhamvegetablescoffeepuddingporkroundroastcheesecookedcakesteakpaychickenmeatfishlambbeautiful
Score
OpinionsNoteTripAdvisor6264.0

comment_iconOpinions

Went here as a start of a celebratory weekend in the area and chose it for its good menu options for my wife who is Coeliac. However, despite the NGC claim on the menu they actually didn't have much choice at all. To be fair, the food that the non Coeliacs had was pretty decent (apart from not much meat on the ribs), However, the service was appalling. It wasn't busy but we waited over an hour for our food. The place felt like it needed a good clean, especially the carpets. Suspect it lives off its location. Fortunately it didn't spoil our weekend, although we were a bit late starting, but would not go back

site_logo

David B . 2024-07-29

MORE AT TripAdvisor

We had a very poor Sunday Lunch. Roast potatoes were like bullets, the carrots were mushy and probably the worst cauliflower cheese I have ever been served in a restaurant. Deep fried Yorkshire Pudding which desolved when cut. Everything seemed reheated. Won't be back in a hurry.

site_logo

iownher . 2018-07-01

MORE AT TripAdvisor

Unfortunately for the boat house we visited on a night when the visa was down across Europe, but we had cash. There were a few tables reserved, but these were not full. People had already left due to the visa system being down. However, they would not accept any more food orders, they really weren’t busy. I’d suggest that they get better kitchen staff who can cope with a tiny bit of pressure. Poor service all round. Unfortunately for them more people have just left and they have also lost our business. Take away it is!!

site_logo

Charlotte R . 2018-06-01

MORE AT TripAdvisor

Very expensive local beer which can be obtained not to far away for 50p a pint cheaper . Staff not very attentive to customers and not trained very well . I saw a couple wait in a almost empty pub for quite a while before someone appeared . The music is ok if you like boy bands quite loud .

site_logo

Harry W . 2018-01-08

MORE AT TripAdvisor

Whilst visiting the area for a family wedding, we decided to dine here as it was close to our hotel. The worst mistake we have made since leaving Australia 3 weeks ago.On arrival we were informed there would be a 45 minute wait for food and that was fine. After an hour the bar staff informed us that the chef had told her not to keep asking if we could order, and he had now decided he was not going to cook anymore. When the manager eventually came to talk to us (20 in our party) we were told lies that seemed to change continually.The very busy chef and staff had time to stand and stare at us through the glass door rather than cook though ? The manager basically told us she was looking after the function upstairs and could not do both, and admitted she Didn't have a clue what was going on in her restaurant. We were getting nowhere and decided to taxi back into town. When waiting in the car park the very rude manager came out and said "you won't find anywhere else to eat at this time of the night; we could make some nibbles" We did find a restaurant that accommodated us all, and I'm sure were very happy with the amount of money we happily spent.Please don't waste your time or money at this venue, the owner obviously doesn't need the patronage.

site_logo

Steve H . 2017-07-14

MORE AT TripAdvisor

Shocked at the lack of service.We called the Boathouse at 14.15 to ask if they are still serving food & would take a table of two, they gladly agreed. We entered & sat down to find no other customers or staff. We waited around 10 minutes still no staff, we called the bell on the bar, still no one.18 minutes later a member of staff walked through the bar, itching his bum the whole time! Ewwww! He looked at us but still no service. Then a chef walked to the toilet also spotting us, but not a word was spoken. Thanks for nothing! Ps we are loads of your mine pies of the bar.

site_logo

Lanaa ッ P . 2016-12-07

MORE AT TripAdvisor

I have always loved this place, the young staff are friendly and attentive, the beers well kept and the atmosphere is great.

site_logo

SetonSteele . 2016-11-06

MORE AT TripAdvisor

Last minute decision for a Sunday outing but we were happily accommodated. Liam was fabulous as our host, the food was excellent. Generous portions cooked to absolute perfection

site_logo

Kim G . 2016-10-30

MORE AT TripAdvisor

Hemos vivido en el son de 5 años y esta es la mejor comida de salida que hemos tenido. Reservar una mesa el domingo para 4 personas me dijeron que tenía un nuevo menú sólo empezó ese día. ¡FUE INCREÍBLE! ! La comida era deliciosa todos nuestros asados eran perfectos (especialmente la carne). Las verduras eran preciosas. Los aperitivos estaban muy bien proporcionada y sabroso. Estábamos tan completo desde los primeros 2 campos no deben tener desierto pero lo hicimos. Y gracias a Dios que lo hicimos. El jengibre tarta era increíble y las dos tortas igual de bien.

site_logo

Tom M . 2016-10-24

MORE AT TripAdvisor

We sat there for quite a long time. Eventually I went to the bar to enquire, only to be told that no more orders would be taken for 50 minutes! Certainly not impressed! We walked out and went elsewhere.

site_logo

Nigel H . 2016-10-11

MORE AT TripAdvisor

Twelve of us visited The Boathouse on a Friday lunchtime to celebrate a 70th birthday. We had booked so they were aware there would be a large order . We had a look at the menu and after about 15 minutes our order was taken. We all order main meal and no starters. After about 45 minutes wait with no apology for the delay our meals arrived. I ordered the bubble and squeak and was disappointed as the outside of the bubble and squeak was soggy instead of crispy. One person had fish and chips and the batter had little fish content. Two people had stir fry which was very small and cold.The prices were average.A lovely setting over looking the marina but food not anything special.

site_logo

14290602 . 2016-10-09

MORE AT TripAdvisor

The Boathouse is a pleasant stroll away from where I live and every now and again I will drop in for a bite to eat. The members of staff are friendly, the beers well kept and the food always very tasty indeed. great for a casual meal or an occasion and a lovely view in the summer.

site_logo

Scott M . 2016-09-12

MORE AT TripAdvisor

Great service, great food and the barman was sooo dreamy! Terrible shirt though. Would definitely recommend!

site_logo

Baya C . 2016-09-06

MORE AT TripAdvisor

Where do I start, a few of the managers from my company decided to meet after a business gathering between all the ceo's. We decided on the boathouse (worst decision ever, you might aswell burn your money) The service was slow and oretty much non existant, the waitresses were beyond useless the we spoke a couple of times to a woman called Jo? ...... well a bulldog chewing a brick comes to mind, what a misrable lady. Right lets get down to the food, It was reheated from days ago, well thats what it tasted like, it was cold and very poorly cooked. I wish i had not wasted my money worst place i have ever eaten. Go there at your own peril but i recommend staying well clear!!

site_logo

Mr M . 2016-01-16

MORE AT TripAdvisor

We came here with a group of friends for a meal before Christmas. Good things first. Nice venue. Nice table. Very helpful to be able to pay individually for our meals. Now the bad. Our waitress was so rude I couldn't actually believe she was allowed to work there. There was no niceties, she looked like she would rather be anywhere else than serving us (new job perhaps? ) and when she 'served' us our food it nearly ended up in all of our laps as she threw it down into the table. One of our party knew the nice chap behind the bar and asked him to have a word. Things got mildly better. One of our party didn't know until the last minute if she could come. We phone an hour before we arrived to order her food. This was fine. She ordered a burger, not once did anyone ask her how she would like it cooked. It came out pretty raw in the middle. She could not eat it. We sent it back even though we were told that it would be at least 20 minutes before it would be cooked again. She said not to bother. Then 10 minutes later a sheepish waiter bought a burger back. Half the thickness, still red but she was hungry so ate it. The waiter said she didn't have to pay for it so all fine. He then went on to say the chef said that is due to the type of beef and that the type he uses never loses the red in the inside even if cooked well done. Well I'm no chef but that Is total rubbish! Then the puddings came out. A few of us had ordered the chocolate torte. One of us had this, the rest of us received a chocolate mousse type thing which clearly had been knocked up by the chef at the last minute. When questioned the surly waitress admitted they looked different and even she mentioned it to the chef who replied well that's what they are getting. We wouldn't mind normally, but apart from the burger, we had all pre booked our meals including pudding. Clearly the chef had run out and sent out this poor substitute. Not good running of a kitchen. I have been here a few times to eat with small and big parties and it has never been like this. It will make me think twice about returning, suffice to say the week before Christmas when it's restaurants busiest time and it was only half full, speaks volumes. Sort out your waitress and take the chef down a peg or two before is to late!

site_logo

Katy G . 2015-12-30

MORE AT TripAdvisor

Terrible weather so stayed somewhere close to boatyard. Food was very good, the service was excellent and as a result a really good place to go. In the summer it must be delightful to sit and drink and look at the boats.

site_logo

Reemanclark . 2015-12-22

MORE AT TripAdvisor

Visited relatives for the day who treated us to lunch at the Boathouse.What a terrific setting, we were provided with a window seat overlooking the marina.Although there were several large groups of people enjoying Christmas lunch bookings the staff although a little stretched at times coped well.The meals are well presented - we had the pulled pork, lamb steak and burgers. All arrived together and were good sized portions.To summarise a very nice venue to have a terrific meal on a wet afternoon.We will definitely return should we be in the area again.

site_logo

DiggoryLondon . 2015-12-16

MORE AT TripAdvisor

Very handy for canal barge trip. Welcoming and allow dogs (friends had hound). Good food and service.

site_logo

Evansabove1982 . 2015-12-02

MORE AT TripAdvisor

Beautiful place, food was gorgeous. Lovely atmosphere highly recommended. Looking forward to our next visit.

site_logo

cawheeler490 . 2015-11-11

MORE AT TripAdvisor

Just a quick stop with the family on our way home from Wiltshire to Devon. We caught up with the local news and met up again with our father-in-law.

site_logo

nasp . 2015-11-01

MORE AT TripAdvisor

A lovely evening had, food was great, good portion size and well cooked. Staff were very polite, cheerful and attentive without being OTT. Extremely generous portion of Pate for the starter and the mushroom starter was REALLY good too. Duck, particularly the leg, and Pulled Pork mains - absolutely gorgeous! Too full up for puddings.

site_logo

Kim G . 2015-10-24

MORE AT TripAdvisor

A quick walk from our lovely B & B at Widbrook Barns B & B. Very relaxing atmosphere, good food and drink. Very friendly staff.

site_logo

e v . 2015-10-19

MORE AT TripAdvisor

Four of us were at The Boathouse for lunch today and really enjoyed the experience.we had a window seat overlooking the fantastic Marina.The staff were extremely pleasant and helpful.We all decided to have the"catch of the day"for lunch..it was a very good plateful,cooked beautifully and well presented.We all had desserts..all delicious too.we will recommend the venue to all our friends and family and certainly will return again soon !PL

site_logo

PatsyAnn2013 . 2015-10-13

MORE AT TripAdvisor

Came here the other night with my husband. The staff were friendly and helpful, however the food wasn't up to scratch. Not a lot of options when it came to food, very expensive and interesting choices. But service was quick and all in all it was a good night.

site_logo

Bethany M . 2015-10-12

MORE AT TripAdvisor

Just stopped here for drinks, this a cavernous pub, with little character. A function pub basically. Has a good selection of beers, but not much use if you have to drink them in a place with little ambience.

site_logo

Toolbag . 2015-09-15

MORE AT TripAdvisor

We had excellent food, with alternatives offered to avoid cream.Food was fresh and cooked correctly.Service was quite exceptional, friendly and very quick.Will be back again soon.

site_logo

Diana P . 2015-09-11

MORE AT TripAdvisor

Fresh fish daily from Brixham, Devon superbly cooked with delicious home made chips. Doesn't get any better. Superb lunch.

site_logo

skibereencork . 2015-09-09

MORE AT TripAdvisor

£11.50 for plate of cold cardboard ment to be a pork roast. Had to wait ages for a poor selection of veg. Not one member of staff was polite nor bothered. Very very poor and rude.

site_logo

Benjamin C . 2015-09-06

MORE AT TripAdvisor

We visited for an evening meal. Good menu, reasonably priced and nice pub/ decor. Friendly staff although service was a tad slow to say it wasn't busy. Pork dish was very tasty by my husband had the burger and said it was slightly over cooked/ dry and the chips weren't nice. Desserts were nice. Would not hesitate to re visit if in the area.

site_logo

hayleyroth . 2015-09-03

MORE AT TripAdvisor

Great location, some nice beers, but don't expect to turn up un announced! As canal boaters we turned up for a plate of fish and chips and were turned away as they were 'fully booked'. There were no tables occupied apart from in the 'Restaurant'! Other boaters had their Domino's delivery made to The Boathouse car park while they had a beer, madness to turn away boaters who just want some food! It's in a Marina, which makes a great setting, but they clearly don't encourage casual trade on the doorstep. Good for a beer?

site_logo

Mike S . 2015-09-02

MORE AT TripAdvisor

Firstly lets start off with the positives, food amazing, young staff brilliant and setting lovely.. It was my elderly mothers birthday, so as I have used before and enjoyed I booked us in. In total a table of seven, there was one other large table but very quiet for a Saturday. We purchased our drinks at the bar and took our table. After being seated for a while, we went and asked someone to take our order. Time went on a round of drinks and a bottle of bubbly drank, still no food. We asked how much longer the food would be it had been ONE HOUR and we also asked to speak to the manager. The food came out in drips and drabs , first two, wait, another two came out, then, one ,wait, one, wait ,one . My daughter who is autistic always notes times and it was one hour from ordering to us having our food. The manager never came out, so I asked the older lady waiting if she was the manager. She was the manager, so we asked why she had not informed us of this, as we had asked to speak to the manager. The conversation went rapidly down hill, we were called liars and she was so argumentative that my father spoke up, which is something he never does. All we wanted was an apology, it turned out they were a chef down and only had one on the pass. The manager forgot to mention this, it was other staff that informed us. She also said she had the ticket with time on, so we again were lying. All I know is from when at our table we gave our order, to us all receiving our food was an hour. To say it spoilt what was meant to be a happy occasion , I have never been spoken to like that in my life. Shame on you.!!!!

site_logo

purdon72 . 2015-09-01

MORE AT TripAdvisor

Pleasant bank holiday lunch. Great, freshly cooked food. Puddings were really tasty. Service was good but could've been a little more sincere.

site_logo

Marshtastic . 2015-09-01

MORE AT TripAdvisor

This is a jewel situated next to a narrow boat marina the food was to die for all freshly produced and cooked no frozen on this menu it was so hard to choose service very good price not bad for the quality a must visit

site_logo

muzzie105 . 2015-08-30

MORE AT TripAdvisor

I had a the crayfish tart and crab linguine and both were delicious. My partner had the course pate and the pulled pork shoulder and thoroughly enjoyed both. Only criticism is the pate portion was much too large for a starter. There are definitely worse criticisms!!!! The staff were lovely and attentive. I was dissappointed that I did not have enough room to try the rice pudding, which sounded scrumptious, so will have to do another visit!

site_logo

Jodie545 . 2015-08-23

MORE AT TripAdvisor

The food is good but I feel it is over priced for what it is. There are no vegetables served with the meal but have to be purchased as extra. The surroundings are very pleasant but feel that some people may be put off with what you get with the meals. The sweets are very nice and a good helping but again overpriced for what they are. This could be a gold mine if they got it right.

site_logo

Jane M . 2015-08-17

MORE AT TripAdvisor

Just had lunch here with the inlaws. Good selection of mains & deserts. Also plenty of smaller dishes available. My pulled pork was very tender & tasty. Sea bass was highly recommend by mother inlaw. Great place for a family dinner.

site_logo

Carl B . 2015-08-13

MORE AT TripAdvisor

Best meal I've had in ages! Sea bass & samphire to die for. Followed by rice pudding, which was a revelation. Never had rice pudding served like this. Utterly delicious. :-)

site_logo

BOAEats . 2015-08-10

MORE AT TripAdvisor

We arrived at 8.45pm, pub was half full, asked bar staff if we could eat, to be told, "I'll just check with the chef". She then returned and said no as the chef has lots of 'checks on' and is only paid until 9pm so she could not take another order.This turned out to be the best thing for us as we went somewhere else FAR nicer and for the following night too!

site_logo

Rachel B . 2015-08-09

MORE AT TripAdvisor

We've dined on Sunday lunch a couple of times - the first time being on Father's Day (12.30pm) - lovely meal, all hot & service was good - hence the 3 stars.Second time was last Sunday (1.45pm sitting) what was going on?! Service was incredibly slow, we were served by no less than 4 members of waiting staff - there seemed to be a lot of staff front of house but none of them doing a lot! We opted to go straight for the main course - which took an absolute age to come out & when it did some of the dishes were only luke warm (I'm not sure about the braised beef as a roast option but that's another story) - but as this was 2.30pm by this time we just ate it. We did find it very odd that the roast meals came out from the kitchen covered in gravy though. Portions are of a very generous size though. We were asked if we wanted to see the dessert menu - yes please. Waitress disappeared into the kitchen with our plates & took 10 mins to come back with the menus!! We ordered dessert. Lovely as the flavours were again it took ages, my sticky toffee pudding was barely warm. One of the children's sticky toffee pudding came out with cream instead of ice-cream - this took ages to rectify.In all honesty had this been our first visit to the establishment we wouldn't be returning. Fortunately, we had dined before and it was good so we will give the benefit of the doubt. It did look very much like there were far too many front of house staff (not doing a lot & faffing around in the bar) & not enough in the kitchen. No one seemed to be managing the staff & boy did it show today. Get your act together Boathouse - it's a competitive world, if you don't you'll lose returning business to the competitors.

site_logo

TheWarnes . 2015-08-03

MORE AT TripAdvisor

Went here for my parents 50th wedding anniversary and it was a wonderful evening. There was 22 of us and the service was excellent. The waitress and waiters were friendly and helpful the food was superb. We took decoration up in the afternoon and they decorated the table for us. Kim who sorted the meal for us was great she went above and beyond for my family. The setting is very picturesque and the food very reasonable. With all best going back

site_logo

Vericlair . 2015-07-29

MORE AT TripAdvisor

Beer was good with good selection of real ales. Quality of food not so good. Don't have mushy peas. Way to much pepper in them couldn't taste the pas. Fish watery and lacking flavour. Waitress didn't even know there was meant to be veg with the pork chop even though I asked. She brought it out five minutes later. We could hear staff swearing at each other behind the counter. All in all not a pleasant experience.

site_logo

Paul T . 2015-07-22

MORE AT TripAdvisor

We crossed the road from our bed & breakfast and the traffic was horrifying! Meal was good, but there was the crossing the street after a few beers to deal with!

site_logo

Jo-Ann L . 2015-07-18

MORE AT TripAdvisor

We visited with family and phoned ahead as we had to check that our pup was welcome. We were told we could sit inside on the slate area or outside. The pub is very smart inside with cool colours and contemporary decor(apart from the odd blue loo seat)! I thought the menu was varied,, interesting and well priced the service was pleasant and Piers was very happy to put up a brolly for us as it was a hot day. The food was tasty, well cooked and ample- not keen on the thick sandwich bread. Service was prompt and pleasant. The only criticism I would make is the outdated shoddy outdoor furniture. Two members of our party are elderly but luckily they managed to get their legs over the benches!!!!!!!!! Think they need to smarten up the outside and new furniture wahoo ups be a priority!! We would recommend this pub for lunch especially as we were able too stroll along the canal after lunch with the dog.

site_logo

Judith200 . 2015-07-10

MORE AT TripAdvisor

Together with my wife and grand-son we arrived for a lunch time meal not having booked in advance and had plenty of choice of tables choosing one overlooking the Marina. Service was prompt and courteous, drinks arriving in a short space of time. The main courses took quite a while to arrive, but they did arrive together. The Sea Bass was nicely cooked and presented, but the bed of greenery was excessive and half the amount supplemented with a helping of rice would have improved the meal considerably. Quantity of all meals was adequate, well cooked, and were of high quality. Total cost including 3 soft drinks came to £40.00 We left feeling well satisfied. One observation to note....noise levels vary considerably as there is nothing to absorb noise in the form of soft furnishings....a full house would be difficult for anyone with a hearing problem.

site_logo

Leonard W . 2015-07-08

MORE AT TripAdvisor

Plenty of free parking & readily accessible. This is a fairly large establishment with lots of room. Choice of beer is excellent with 3 good quality, local, cask ales. Staff are friendly & really helpful. Menu is pretty decent & varied. Cost is pretty reasonable, neither expensive or cheap. We had Guinea Fowl one night & it was excellent. As we stayed in an adjacent hotel ( Widbrook Barns) for 4 nights we ate here 3 times & still had plenty of choice. Specials vary every evening & were really good value. Sweets were brilliant & really quite different from the norm. All in all a really pleasant & surprisingly reasonable ( from a cost perspective ) dining experience.

site_logo

Richard S . 2015-07-08

MORE AT TripAdvisor

Sunday lunchtime with friends. All very hungry but we all opted to straight to main courses: 2 steak burgers, 1 roast port & 1 veg quiche. Waiting staff all friendly & seemed well organised, able to move from one area to another whenever they were needed - bar, to restaurant & back again ensuring smooth, prompt service in all areas. Food arrived promptly & we all raved about our own dishes. Sadly we could only manage 2 desserts which were just sublime & not to be missed. Moved to the soft seating area for our coffee as it was full so we thought it would allow them to reseat our table (which they did very quickly). Cost for 4 mains, 2 desserts, 2 coffee, 1 bottle wine, 2 pints beer & 2 soft drinks = £83 - Bargain!!Premises is modern & delightfully apportioned while using all the space fantastically well - lots of windows making it light & to overlook the canal marina with all the barges moored in full view. Lovely with outside seating when the weather permits, upstairs function room with balcony, sofa area if you just want to enjoy drinks, they also do full afternoon tea which looks really inviting.Recommend you book at peak times

site_logo

Su-Mart . 2015-07-07

MORE AT TripAdvisor

Booked at short notice on 2nd with Kim a lovely table looking at canal boat marina i personally would not be able to order a starter as portions were huge for example my father had 2 slabs of the pate very very tasty would recommend it if u could manage this coupled with a huge portion for your main meal all very tasty though would recommend the fish and chips and the gammon we tried several dishes the 2 evenings we were there and they were all very tasty the service can be a little hit and miss but attentive when u get served a nice touch was a waitress gave me some crackling with apple sauce as i had mentioned that i loved crackling and hadn't had it in ages overall excellent food very reasonably priced huge portion good wine selection £15.00-£26.00 and a view to die for.average price for 4 including 4 aperitifs4 starters and mains and deserts 3 coffees and 1 drambuie £134.00 ps i would not order the coffee very weak but i'm sure if i'd have mentioned it they would have fixed that i look forward to returning

site_logo

Mark L . 2015-07-05

MORE AT TripAdvisor

False advertising: there was no fish special. Long wait for food and it arrived in several parts so the tuna steak went cold while i waited for rest of meal, General presentation was lacking. My friends' steak was cold and fatty. Such a shame such a beautiful location with no atmosphere and staff who appeared tired of apologising

site_logo

Dawn T . 2015-07-03

MORE AT TripAdvisor

Lovely food, super surroundings and fresh produce. Eaten here 4 times now and cannot fault it. Staff are friendly and wine menu is also very good.

site_logo

Isoult T . 2015-06-30

MORE AT TripAdvisor

Three of us called in mud-afternoon for a late lunch. The food was excellent and very well presented. The staff were very friendly and nothing was too much trouble. Will certainly make a return visit

site_logo

AnnG1951 . 2015-06-25

MORE AT TripAdvisor

Had a lovely lunch here on a sunny day and food was delicious, cheese plough mans served with lovely cheese and quality bread, will definitely return to try others as they looked fab when delivered to tables. Male barman was a little dull compared to the females who were very attentive and professional. whilst sitting outside by the marina the window was open to the kitchen and let's just say the guys in the kitchens choice of language was a little rich and the air turned a little blue, it didn't offend me but it may others.

site_logo

Maybe-Harsh-But-True . 2015-06-22

MORE AT TripAdvisor

I've been to the Boathouse a few times since it opened, and until now I wasn't bothered either way by it. We decided to go along yesterday for a late Sunday lunch - they managed to fit us in at 2.30pm and the place was really busy. We ordered a range of different mains all of which met with approval. The service was good and it was decent value for money.The only things that stopped me giving it 5 out of 5 are: loads of dirty glasses stacked up on the bar (although to be fair it was the end of a busy lunchtime); the dessert menu didn't have any 'light' options; there was no biscuit served with the coffee.Overall though an enjoyable experience and we will be returning soon.

site_logo

Ben C . 2015-06-15

MORE AT TripAdvisor

As locals we had noticed the refurbishment of The boathouse but hadn't tried it until last night. What a lovely find. The décor is smart and modern and the setting beautiful. It was very busy and very lively. The staff were friendly, professional and attentive from the minute we arrived. We had a table overlooking the water and were delighted with the added bonus of sightings of a sparrowhawk, a heron and other wildlife whilst we were dining.The food was well presented and delicious. The flavours of the Lamb Rump dish were just heavenly and the raspberry cheesecake was light, fluffy and melt in the mouth gorgeous. The menu and wine list is comprehensive enough to have us wanting to go back and try more.We had a very pleasant evening - thank you. I have only one minor niggle (and its one you share with many other establishments) and that was that the table was wobbly!!!!!We will definitely return and would have no hesitation in recommending you to others.

site_logo

Katykaye . 2015-06-06

MORE AT TripAdvisor

Dropped in with family for a drink last weekend and sat outside as we brought the dog. This visit was the first time I’ve eaten here since the refurbishment, which I think is very nicely done. We popped in on the way home from my daughters and were greeted by the pleasant barman who got me my drinks and was happy to put them on a tab as I said we’d be eating. We were first in (about 5pm) and sat in a sunny area overlooking the marina, cutlery and new looking menus arrived immediately. Our order was taken by a very pleasant (Mexican?) waitress and I also asked for a dish of spicy peanuts from the varied selection of snacks on the bar, only £1 a go. I’d had the smokey nuts previously which were scrummy, but give the spicy ones a miss – greasy, not spicy and stained my fingers yellow.The food arrived in good time and was nicely presented, I had guinea fowl (because I’d not tried it before) & my wife had the pulled pork. The portions were good and we had no complaints, then we got a surprise ‘would you like your complimentary desert now?’. Seems that on Wednesdays you get a selected free pud with your main meal – I had treacle tart, obviously streight from a packet but nicely served with a portion of cream, my wife had fruit pavlova. Lovely touch, I’ll be sure to pop back if we’re passing on another Wednesday.

site_logo

cga00 . 2015-06-05

MORE AT TripAdvisor

I live just along the road from this pub but rarely visit, as my first experience not long after it had opened was awful. The food was terrible and it did put me off. However, the sunny garden enticed us there yesterday and i'm glad that we gave it another chance, as the food this time around was delicious! The staff were friendly and helpful and even prompted us to order a free dessert after our main courses - an offer we hadn't even realised was there. The only niggle that I have, is the refusal to run a 'tab' for customers who are sat in the garden. I understand the principal of why this happens but it is the only pub I know of in the area that doesn't allow this even with the offer of a bank card and driving licence etc. Still, we had a lovely evening and will definitely go back.

site_logo

MrsM291 . 2015-06-04

MORE AT TripAdvisor

Popular venue with locals and visitors. Food was really good, although service was a little slow. However, watching the boats on the water was really enjoyable as the sun went down. Definitely worth a return visit.

site_logo

Melanie K . 2015-06-04

MORE AT TripAdvisor

My family enjoyed a superb meal on our first visit to this pub. I agree with another review its more as a restaurant than a pub. It has a relaxed feel, pleasing decor and plenty of space. The food was 'very good'. Between the four of us we sampled a good cross section of the menu and couldn't fault a thing. Well done. We will be back!

site_logo

Ralphi669 . 2015-05-31

MORE AT TripAdvisor

Not even worthy of one star review tonight. Beautiful setting and nicely decorated, waitresses lovely and helpful but food a total let down! Table of 15, last orders so not even a busy period. 1 lamb under cooked, 2 steaks asked to be medium came out still running with blood, gammon under cooked, admittedly all went back but after a nearly hour wait for all meals shouldn't happen. 3 pork tenderloins ordered 2 of which very dry and Luke warm the other perfect. But none came with vegetables?!? Why don't meals come with veg and if you want veg you pay and extra £2.50 on top of £15 ish per meal! I ordered a salad due to diet restrictions and waitress offered plain chicken breast to make it more of a meal... Perfect. but than charged £6.50 for lettuce, carrots and chicken! Yes these complaints were passed on to the staff at the bar but was told "I don't sort the prices" and then was blankly stared at. Shall not be returning. Ever. Totally Down hill since change of owners and a complete waste of money.

site_logo

K16SCJ . 2015-05-31

MORE AT TripAdvisor

A group of six went to the Boat house for a meal & a few drinks this week & we all had a lovely time.We had booked a table in advance that was ready for us on arrival.We waited a while for a waitress to take our order (it was busy)but when our food arrived that was soon forgotten.Every body enjoyed the starters/mains & desserts , the waitresses were lovely & friendly & we will certainly return.The decor is lovely & all very clean.Keep up the good work team.

site_logo

Dawn N . 2015-05-30

MORE AT TripAdvisor

Such a lovely setting. But the food was horrendous. We walked in to a very warm welcome from the staff. It was quite busy. Which we took for a positive. I had the ploughmans lunch. Which involves no skill whatsoever. The bread was stale, the brea was off, the salad was old and limp. We also had the crab linguine, which tasted liked it was cooked days ago. Not to mention the shell that was in it. Such a disappointment. On a positive note. The manageress was very professional. Apologised and didn't charge us for the food. ( which we didn't eat). Good customer service. But unfortunately we won't return.

site_logo

Samantha M . 2015-05-30

MORE AT TripAdvisor

We had dinner at the Boathouse. It’s just outside the town, and as this was our first visit, we walked out during the afternoon – a pleasant 20 or 30-minute walk mainly alongside the canal, depending on whereabouts in BonA you start from – to drop in for a drink and do a reconnaissance. We liked the look of it, so booked to come back to eat in the evening.It’s in a great location, on the very edge of a canal marina, and we had our pre-dinner drinks at a table outside. When we moved inside for our meal, we were still only feet from the waterside, and as the restaurant has floor-to-ceiling plate glass windows we could continue watching the narrowboats and the activities of this year’s ducklings. All of the staff that we encountered (4 or 5) were exceptionally friendly and helpful; I still had some of my drink left when we asked for the bill, and there was absolutely no sense of being hassled to move on. The food was good, my wife’s tuna steak especially so, and the menu is fairly broad.There is a large carpark, and a separate fenced play area for children.

site_logo

E-EMCEE2 . 2015-05-26

MORE AT TripAdvisor

More a restaurant then a pub as a lot are these days, however does decent ale none the less. Food was excellent, had the lambs kidneys starter & lamb rump main. Cooked to perfection in my opinion. Also a good place to sit with a coffee & cake overlooking the marina bonus I can see our narrow boat from the bar! Frequently drop in for a pint.

site_logo

lookinglost . 2015-05-25

MORE AT TripAdvisor

On our first trip here today, we found the Boat House good to the eye,smart and clean and great views of the Marina.Perfect for a Lazy sunny day.Menu seemed fine lots to choice from.If you stayed to snacks and sandwiches it was reasonable,but hit the main menu and we found it quite pricey.Pot of shredded pork with a few greens and a potato plus apple sauce £13.50,looked lost on the plate,a 10oz gammon came out to be only 5oz if we hadn't mentioned the portion nobody would have,not good behaviour.At roughly £13.50 to £ 19.00 for mains I think all extras should be included not extra.Would we go again,certainly ,if they get the portions right and price

site_logo

triggy11 . 2015-05-23

MORE AT TripAdvisor

We had a nice lunch in this attractive pub. The kids enjoyed playing outside, the staff were friendly and the food was good and reasonably priced.

site_logo

Samara F . 2015-05-23

MORE AT TripAdvisor

Myself my husband and family go there on a regular basis for drinks and to enjoy the relaxing atmosphere(Good,safe little play area for our grandson),the staff have always been pleasant and polite,We have eaten there on a few occasions before and the food and service where exceptional,so much so we have booked to go there for lunch this Sunday.In my opinion you can't always please all of the people all of the time,but for us this a great local establishment with great staff,great service and great food.

site_logo

ameliad101 . 2015-05-22

MORE AT TripAdvisor

The Boathouse Restaurant is located in a good position on the outskirts of Bradford-on-Avon adjacent to the Marina on the canal. The accommodation is spacious and has a pleasant atmosphere, but the furnishing could be improved by making it less formal and generally a little softer.Wednesday maybe a quiet day when the menu offers a free desert if you order a main course and when we were there the service was excellent. The staff are very friendly and engaging.The starters and the deserts were very good. The mains we had comprised lamb and pork dishes. The meat was very good, but a big disappointment was the lack of fresh vegetables to accompany the meals. Fortunately, I requested chips with the lamb dish which made it look more like a meal than a snack. However, the chips were white, not golden brown as you might expect. The pureed vegetables, which I describe as baby food, really took the edge off what could have been very nice main course. One of the staff agreed with my views about vegetables.Generally, The Boathouse offers very good value for money and with relatively minor improvements would be highly recommended.

site_logo

Maurice G . 2015-05-21

MORE AT TripAdvisor

I found this pub/restaurant on the internet after searching for somewhere to take my husband for his birthday, along with 2 friends. The men approved of the beer on tap and we had a very nice table by the window overlooking the marina. There was so much choice on the menu that we took a while to decide. The starters arrived after a suitable amount of time. Everything was delicious. The main course was fantastic, although we had to ask for extra vegetables as the puree didn't quite cut it with the men! These duly arrived. Desserts were massive and filling. The only negative was the staff definitely need more training, especially when serving wine. The young lady poured 2 full glasses, without asking if we wanted to try it. My husband then advised her how to do it, including the twist of the bottle after pouring! We shall return in the future to see if she remembered her lesson!

site_logo

ELEANOR T . 2015-05-14

MORE AT TripAdvisor

Ate here for the first time since it has been refurbished by the new owners and was surprised by the quality of the food. The service needs a little work as it can be a touch disorganised (we were served by 3 members of staff over the evening and at one point were asked by 2 different ones if we wanted dessert).My food took a little longer to come out than my friends but this was explained by the staff as "the chef wasn't happy with your dish so he cooked it again", which shows some attention to quality.Positives:Good quality fish coursesNice beers on tap (including Gem and Tribute)Negatives:Staff a bit green (more training)Music, it's not intrusive but Robbie Williams on a loop isn't my tasteThe menus need simplifying - you need to wade through breakfast and lunch options before you can find the dinner menu

site_logo

Nigel M . 2015-05-10

MORE AT TripAdvisor

I can thoroughly recommend the scones. Served on a tiered cake stand - two warm scones, generous helpings of butter, devon cream, jam and fresh strawberries for £3.50!

site_logo

Silbury . 2015-05-10

MORE AT TripAdvisor

We have had the most enjoyable experience this evening, we were greated by the barman, he was very welcoming. We had fabulous food, excellent service and all round great experience. We were served by Corey, he was superb. Polley & Emily were very attentive too. Excellent service and a good knowledge of the menu. We will be back....

site_logo

Godfrey A . 2015-05-04

MORE AT TripAdvisor

I came here for a birthday meal with my partners family as it was his mum's birthday. Upon arrival it was lovely they seemed polite and asked us for drinks etc then it got worse. I had ordered a special dietary meal which I had ordered days in advance, about an HOUR after everyone else had eventually had theirs after me and others asking for things they forgot like steak sauces and chips, I still want sat there with nothing! I had only ordered a salad! I had asked 3 times by now and about 20 minutes later it came. Not once did they update us on any of the food as it was delayed or say sorry. No one asked us if everything was okay like I would presume you would. We had to complain to the manager and the birthday atmosphere was totally ruined by this anger that we had to wait so long for the meals to arrive. Some of the food was small portions for what they had ordered, granted others said it was lovely food but I am not complaining about the food as such just that I am just angry and stressed out about how long I had to wait, We ordered about 1.45 and I didn't get mine until 3.10! it was brown rice, veg and prawns... I will not be going back.

site_logo

Charlottes L . 2015-05-02

MORE AT TripAdvisor

Well, where do I start. I'm not racist but the staff couldn't even speak English, not a good start. The beer was so flat I shouldn't have even ordered food. Food looked nice to be fair, but it had a hair on top of my chips. It wasn't a head hair either, and it looked like it was placed there so god knows how the so called chef and other staff didn't notice it. Attention to detail. Obviously not. I returned to the bar as the staff didn't come round to ask how the food was, and asked for a refund (baring in mind we don't pay for meals at the start) so he gave me a cash refund there and then. I assumed he was new as he was apologetic and was still going to charge our table at the end as he couldn't remove the meal from the order. Upon settling up, some strange little waiter accused me of stealing. It's not my fault you are incapable of processing orders correctly little boy so please excuse me if your head falls off.

site_logo

nohairyfoodplease . 2015-05-02

MORE AT TripAdvisor

Called into the Boathouse on the way home from the London area. We didn't appreciate just how popular this place is and when asked about eating we were told they may not have a place available. To their credit we were seated and then served a very nice meal. The Boathouse is set in a small marina area and can imagine it being very busy in the nicer weather especially on the outside terrace overlooking the marina. All in all a nice visit and would recommend.

site_logo

phil1962Newport . 2015-04-28

MORE AT TripAdvisor

Its been 9 months since we last called in. So quick phone call 24 hrs before arrival, fixed time and even prefered table - and we arrived! No complaint over service or food. Slightly over-enthusiastic wine waiter unscrewed wine bottle, poured 2 full glasses, handed them over and asked 'do you want to try it? Bit of training needed but hey, screw top £16 - not exactly vintage sampling/quaffing!! Saturday night busy but food served well, hot and tasty. Again, it aint fine dining but they deliver a menu with flair and variety. Young staff are to be complimented on their 'can do' attitude and service. We will be back - again!

site_logo

ComposerMFC . 2015-04-28

MORE AT TripAdvisor

Eight 'senior' canal boaters met at this pub prior to picking up our craft. Eight arriving at any time is not easy for a restaurant, but they coped well enough and menus were soon brought after the initial drinks were purchased. Meals arrived a little haphazardly but the content and presentation was good and the lunches enjoyed by all. Some items on the menu were 'off' but this was explained and caused no difficulty. Last time we were in this area the Boathouse was closed for refurbishment, and now decorated in modern pastel shades it is a pleasant and convenient place for a group to meet. Some past reviews are not so hot, but we found the staff and general atmosphere of the restaurant pleasant, and would visit again.

site_logo

Peter F . 2015-04-26

MORE AT TripAdvisor

This is not the first time to visit here, and yet again have been disappointed, long time in between all aspects and lack of staff coverage.Although the service was acceptable, improvements can be made. A very comprehensive menu with fancy food, but a few traditionally recognisable main meals would not go a miss. Not the place to come for a quiet meal with drinks! Background music at times can be quite over powering.

site_logo

BobL55 . 2015-04-22

MORE AT TripAdvisor

We've driven past this place so many times and said we'd call in, finally got round to doing so on a Friday night. The place was empty apart from 2 other couples although virtually all the tables apart from one at the front had reserved signs on them, no one actually came and used those tables the whole time we were there (90 minutes), one of the already occupied tables was vacated, cleaned, then re-used.The menu is extensive, perhaps a little too crowded. My partner ordered the seabass, I ordered what I believed to be the pulled pork however the pork tenderloin arrived. I gave it a go and whilst both dishes were very good we were both still hungry after finishing them :( There was no veg to speak off with my dish apart from a small sweet potato and leek gratin underneath, it needed more veg with this dish to finish it off completely. As we were still hungry we opted for a dessert. It was a nice touch that the young waitress brought us the menu's open at the right page for us (as it is so extensive). I decided to break with my usual pudding tradition and tried the boathouse sundae (cookies & cream ice cream, blueberry compote, maple syrup, toasted pecans,mini marshmallows, fudge) which was basically a fudge, fudge and more fudge dessert! The ice cream (single scoop) at the top was delicious, however the huge pieces of fudge throughout the dessert really spoilt this for me there was just too much of it. Also the mini marshmallows and pecan nuts were right at the bottom of the dish as opposed to being sprinkled on top as I expected. My partner had the cheescake, the way this was presented was simply stunning and I was rather jealous I hadn't chosen it myself. The cheescake itself was delicious however there was no need for the sorbet added on the side in the basket, it was too much and took away from the amazing cheescake. All this said, we are prepared to come and visit to give it a second chance as there were other options we would like to try.The only other comment I would make is that it took rather a while for the food to arrive considering it was virtually empty and that as they turned the lights down for the evening they really should have come and lit the candles on the tables to create more of an atmosphere which was sadly lacking

site_logo

linda c . 2015-04-21

MORE AT TripAdvisor

I'm lucky enough to be staying in the Widbrook Grange hotel opposite for a few weeks whilst on business and sometimes have dinner at the pub. Every meal has been great, and the staff have all been very friendly as well. Great views over the Bradford-on-Avon marina out the back, and a great find. Look forward to some return visits over the next few weeks! Thank you.

site_logo

HampshireGinger . 2015-04-20

MORE AT TripAdvisor

Decided to return for dinner once again and wasn't disappointed. Sat over looking the canalFor me the menu was a little over crowded with quirky titles instead of traditional starters, mains and desserts. However, didn't detract from tasty good foodStarter. 1x Beetroot cured salmon, more like a deconstructed salmon sandwich1 x Scollop and Salmon balls looked and tasted very goodMain1 x Tuna steak, sweet and sour red cabbage delicious well cooked Tuna1 x Crab linguini, cherry tomatoes again very niceDesserts2 x Raspberry cheese cake Raspberry sorbet refreshing and lightAll added up too a very good night

site_logo

Ge0rdiestu . 2015-04-19

MORE AT TripAdvisor

One of the best lunches I've had for a long time! Good friendly service. Being coeliac I'm always a bit wary at calling in for food when I haven't rung in advance but staff and the chef very knowledgeable. Pulled pork with crackling and apple sauce was to die for!! Thank you the Boathouse!

site_logo

Polypeptide . 2015-04-18

MORE AT TripAdvisor

I have eaten here a few times over the years and have never been impressed, this is the first time I've eaten here since the change of name & revamp, the staff are very friendly and helpful, the decor is contemporary in a good way and the food is excellent and very well presented, the word has gotten around as it was very busy (Sunday lunchtime) I am already planning another visit.

site_logo

Jon C . 2015-04-13

MORE AT TripAdvisor

We have visited the Boathouse today for my sisters birthday, did n't know where to go so looked on the internet this seemed to offer all we were looking for. When we arrived there was plenty of parking, only a few steps from the door. When we walked in we were greeted by very friendly staff who quickly got us seated overlooking the canal boats, lovely ! Took a while to choose our food, as the menu offered some mouthwatering choices. When it arrived we were delighted, it was delicious and perfectly presented, we glanced over to the next table as they were served their desserts, they looked gorgeous, so it would of been rude not to have one! We had the cheesecake and the chocolate brownie, absolutely scrumptious.Definitely will be going back so we can try some of the other choices on the menu. 10/10

site_logo

Elaine C . 2015-04-09

MORE AT TripAdvisor

First visit here since the refit, and whilst first impressions were good, in the end we couldn't get out of there fast enough.On the occasion of my mothers birthday we thought we'd try the Boathouse, something a little more central for the group to meet at. Arrived on time @12:30 on a bank holiday Friday, not to many others guests and all seemed well.We were warmly greeted by the staff and quickly seated and attended to with drinks and menu's. Orders were taken and shortly thereafter we received our starters. Mushrooms got the thumbs up, so did the lambs kidney's. The duck tart was a little lacking in the duck department and what there was was a little dry, other than that the first course was well received by all.That's where it started getting noticeable, the noise that is. The place was filling up quickly and so was the noise level. If you're hoping for a comfortable lunch then perhaps you may like to think about another venue, when the place fills up, you're not left with much room between tables, so you'd better get on with your neighbours. Can't quite work out why there is more space available in the lounge area than there is in the dining area, when after all this place is touting itself as a restaurant more so than a pub. One or two fewer tables would be better to make more room for your guests - just a thought.By the end of the main course, a couple of pulled porks, a couple of gammons and a fish and chips the restaurant was 70% full and 100% volume, we couldn't hear ourselves think let alone hear what the party members were saying. Main's finished and enjoyed we were in two minds whether to pay up and leave, although seeing as we had a sweet tooth in the party and it was their birthday we stayed for a round of cheesecakes, meringues and coffee. All of which like the other courses were very nice.Again though we couldn't wait to get out, so quickly settled and left.In summary, nice decor, friendly staff, good food, but horrendous noise levels.Would return, but not on a bank holiday or weekend.

site_logo

l_wilson . 2015-04-06

MORE AT TripAdvisor

A party of 9 adults plus 4 children turned up on a Saturday lunchtime unannounced (we thought a relative who lives nearby had booked for us). Fortunately because it was early, the place was not very full but it did soon fill up. The very friendly staff quickly arranged tables and we were soon seated.The food was generally very good and came within a reasonable time. And they had one of my favourite beers, Sharps Doombar on tap! We have been here before when it was previously "The Beef and Barge" and the refurbishment has been carried out to a high standard and has vastly improved the place. The new type of credit card machine was also "very high tech" and is bluetoothed, but apparently doesn't work very well by the tables, so hence the reason you have to go up to the bar to pay. We will certainly return again.

site_logo

Tommy129 . 2015-03-30

MORE AT TripAdvisor

I have been to the Boathouse quite a few times for food with family, my husband, and friends (with our children). Every time has been a pleasure, the food is consistently delicious, the service from staff has been consistently good, and (who I think is) the manager, has fantastic customer service skills. The decor is lovely, inviting and relaxing. The outdoor park is just right for younger children to play with in the nice weather, and it also has a catch, high enough up so little ones can not wander off.The food tastes just as good as it sounds on the menu, and the children's menu is well thought out for what most children's favourite dishes are.As my family and I live in Bradford on Avon, we will definitely be visiting this lovely, welcoming establishment again.

site_logo

Natalie M . 2015-03-30

MORE AT TripAdvisor

Despite being only half a mile from my home, the previous incarnations of this pub were absolutely dreadful, and I rarely went there. The new Boathouse proprieters have totally transformed it, making it light and airy, with comfy areas and plenty of light and space. When we first visited, they had not quite cracked the issue of service (I suspect they had no idea how many customers they would have!). We've been back four or five times since, and these issues are well consigned to the the past: young staff are confident and helpful, without being oily. The vast all-day menu (cleverly sectioned and categorised) covers just about everything, with one or two interesting flavour and texture combinations which you would find in much more prestigious (and pretentious) places. The atmosphere is bright, spacious and informal. yet the food is diverse, well-cooked and tasty.

site_logo

Andrew B . 2015-03-25

MORE AT TripAdvisor

Views of canal boats from the restaurant added to the charm. The food was really delicious, served piping hot and not too much waiting. Staff were friendly and efficient. Booking, especially at weekends, is strongly recommended.

site_logo

PaulFabia . 2015-03-24

MORE AT TripAdvisor

I vistited the boathouse last week, for the first time since it's big make over, after being recommended by a friend and we were not disappointed! We were greeted and seen to a table by a lovely waitress and presented with a tempting array of options. I had the pork tenderloin and my partner had the steak. Everything from the presentation of the food and the combination of flavours was nothing short of exceptional! After our mains we decided to indulge and have one of the desserts. We both went for the warm ginger cake which was delicious and worth visiting again just for that! Over all the whole experience was wonderful and we will certainly be returning!

site_logo

Laura R . 2015-03-20

MORE AT TripAdvisor

Went back to try again, waitress stood on my bag, dropped food on me whilst collecting plates and felt service very poor.The starter was good but felt main course poor, meat well cooked but sauces terrible especially with the lamb, spoiled the lamb and vegetables. I ate the meat but was unable to eat the rest.Also polenta and goats cheese cold and tasteless. Such a shame as good venue and clean and well refurbished.Will not be coming back in a long time.

site_logo

annmarie2102 . 2015-03-14

MORE AT TripAdvisor

Family occasion , walked in and was wowed ! Very clean and well maintained place :) very nice On the eye , ordered 2 haddock and chips , mine and my partners was okay nothing to special ! Let down tbh ! Most of our chips were over cooked ! And the end of my fish was overcooked too , dessert was okay but too salty ! Service was efficient just the food was average and it appeared on the bill as hake not haddock ?! And the bread was very over priced at 2,50 just appeared to be kings mill ,

site_logo

lovegoodbad . 2015-03-13

MORE AT TripAdvisor

We visited the Boathouse in a party of 12 for lunch. The setting was very nice overlooking the marina. Our orders were taken on time but we had to wait 40 minutes or so for the food to arrive and one lady was waiting quite a while for her Lamb Shank. The food was hot and to a high standard and everyone seemed pleased with it and would come again.The staff tend to congregate around the corner of the bar and seem to be distracted away from the customers. After the meal we expected to get our bills but they never arrived so we went ot the bar to pay. This procedure needs to be clarified to customers.

site_logo

Peter C . 2015-02-25

MORE AT TripAdvisor

Me and Carole have just arrived for a two night break in Bradford on Avon near Bath. We set out looking for somewhere to eat, more difficult than you would imagine on a Monday night in B o A. We accidentally walked to the Boathouse. It is about a mile out of town but well worth the travelling.It was quiet (not normally a good sign) but the staff were very welcoming and gave us a table overlooking the marina. We had a pleasant reasonably priced bottle of rose and ordered pork tenderloin and lamb shank.We were in no rush so was pleasantly surprised when we were given complimentary home made tortilla chips and salsa as the meal was taking longer than expected to prepare. They were delicious, as were both mains. Really couldn't fault a single thing and would definitely return and recommend.

site_logo

PhiljLichfield . 2015-02-23

MORE AT TripAdvisor

One of the best meals I have ever had. Imaginative and tasty, well prepared and attractively presented.In addition the staff were excellent. Attentive but not overly so.Very good value.

site_logo

Oriana100 . 2015-02-17

MORE AT TripAdvisor

This is a nice place with good food (high standard pub food nature). The service was excellent and the ambience and view makes a trip worthwhile. They are dog friendly which is always a major plus.

site_logo

RichieandLa . 2015-01-25

MORE AT TripAdvisor

Staying in sister hotel widbrook grange with wife and 2 sons,food quality was hi class prices very affordable and they welcomed my two sons (8 months and 3) with open arms will return

site_logo

sleepjohnb . 2015-01-21

MORE AT TripAdvisor

When on Sunday 30/11/14 for Birthday/Sunday lunch not been since the refurbishment of what was called the Beef n Barge. The Boathouse has a warm friendly atmosphere tastefully decorated very spacious. Good selection of food on the menu. I tried the veal stew, delicious all together very reasonably priced no complaints shall be visiting gain

site_logo

Ge0rdiestu . 2015-01-06

MORE AT TripAdvisor

Lovely food and it was a bonus that some nice real ales were available. A nice touch was a member of staff forgot to bring us a latte- we weren't in a rush but i checked after ten minutes and apologised and said he would get it but knock it off the bill. I like places like this where the staff are able to do this on the spot :-)

site_logo

Ben B . 2015-01-03

MORE AT TripAdvisor

We were excited to try the Boathouse after its big make over. The make over is a very big improvement and looks very cosy and welcoming. Unfortunately the food has not improved. I could only describe it as another basic bland pub food dish. Although the menu does look very impressive when the food came out there was nothing to make me go wow which us such a shame as I was hoping for big things. I would not rule going out to the Boathouse again but I would prefer to use it as an outside pub garden in the summer as there are lovely surroundings. I did get the feeling that more time, money and effort has been put into the decoration and gadgets for the staff to use.. whereas this probably should have gone more into the customer service and food.

site_logo

gemma_shrp . 2014-12-30

MORE AT TripAdvisor

We booked well in advance for Christmas Eve as we have eaten at the Boathouse twice before and it's been lovely each time. As there was 9 of us who all live in different areas of the country, we decided to have the normal menu instead of the Christmas one to make things easier as you had to pre-book the Christmas menu. As we sat down it was quickly apparent that they hadn't put any music on which we thought was strange as, like a lot of people, like to have abit of ambiance with our food, especially on Christmas Eve! Not everyone likes Christmas music but something would of been nice.The service was not as great as previously experienced, and had heard from friends that they wouldn't recommend the boathouse because of the bad service they had received. We weren't offered drinks and had to go to the bar every time we wanted one. The food however was amazing. But unfortunately the attitude and knowledge of the waitresses put abit of a downer on the evening. My partner is a manager in the food industry and said he wouldn't want anyone like that working for him. When you have a table full of empty glasses and the wrong cutlery etc and you can see the waiters/waitresses standing around the bar chatting, and then having to ask for your bill at the bar also as no one was around, it is very off putting. On Christmas Eve the boathouse should of been a lot busier, and I do think it has a lot to do with the staff. It's such a shame as the food was so lovely, but for our family it's about the service, the food and the ambiance. With no music, bad service but amazing food, it's a shame.

site_logo

Ashley V . 2014-12-27

MORE AT TripAdvisor

Worth a visit, nice clean and airy restaurant. The staff were really nice and the food was amazing. Met up with friends for our Christmas meal, we were all impressed, very good quality/price. This restaurant might become our regular monthly get together over dinner.

site_logo

Caroline R . 2014-12-12

MORE AT TripAdvisor

Similary restaurants in South West

restaurant_img
4.0

67 Opinions

location-iconHigh Street, Rowde
British
outdoor_seating_150543takeaway_150543delivery_150543

My first visit to the Cross Keys and one of many to come. Participated in a chivelrous bout for the ages in the infamous premier pool league. Their tap water and ice is unrivalled and even better still, the owner and his family couldn't have made me feel more welcomed. Carvery is next...

restaurant_img
4.0

60 Opinions

location-iconFox and hounds, the street
British
outdoor_seating_330463takeaway_330463delivery_330463

Lovely pub, good atmosphere & great wood fire. Landlords an interesting chap too 😃

restaurant_img
4.0

1361 Opinions

location-iconRowden Hill
British
outdoor_seating_103402takeaway_103402delivery_103402

Haven’t been here for ages so called in when passing , lovely friendly services as always . New menu loads to choose from, we had chilli burger with nacho cream and chips which was lovely only complaint was the nachos cheese was watery and tasted like water , needs to be thick and taste of cheese … my daughter loved her a mac and cheese chicken toast sandwich thing and chips . Definitely recommend and return

restaurant_img
4.0

899 Opinions

location-icon24a Bridge Street
British
outdoor_seating_146146takeaway_146146delivery_146146

We came after a recent flood and after ordering 3 club sandwiches which come with chips and a cheese toastie with an added portion of chips we were told the chip fryer was broken so chips were not available. Nevertheless, we were charged FULL price for the 3 club sandwiches with NO chips and more disgustingly we were charged an extra £4.90 for chips we did not receive. See the receipt. There are other tea rooms in Bradford on Avon that are worth visiting and you wont get ripped off.

restaurant_img
4.0

1 Opinions

location-iconRushmead House Rushmead Lane Orchard Farm Campsite, South Wraxall England
British
outdoor_seating_259975takeaway_259975delivery_259975

Great new venture, that has been open about 4 months. I was served by the welcoming Izzie, and had two lovely black coffees and a flapjack. It's early days for the business, so just a small selection of cake at the moment. Plenty of parking, seating inside and out, and dog friendly. WiFi is available, too. As the business grows, it is listening to what customers want, and bacon sandwiches are on the 'to do' list. Cash only at the moment, so take some change. Well done, Izzie! Chris.