GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.9

Based on 627 opinions finded in 2 websites

site_photo4

Nº 1472 in 2408 in Camden

Nº 48 of 74 Asian in Camden

CUSTOMERS TALK ABOUT DISHES WITH..soupporkchickeneggstewfriedricespicy

comment_iconOpinions

Super tasty food, we really enjoyed it!!

site_logo

Flavio Corpa . 2025-05-16

MORE AT Google

The staff were all so friendly and it was so delicious. It tasted better than Korea! Prices are reasonable everywhere you go in London, so the prices are reasonable, and it's close to the British Museum, so it's easily accessible. It's close to work, so I passed by it every day, but I finally tried it. The kimbap is really delicious, but I want to try something else next time. I recommend it. All the staff were so kind and it was so delicious. It seems to be more delicious than Korea! Everywhere you go, the price is expensive because it's London. So resonable price and it's close to the British Museum, so it's accessible. I've been passing by every day because I'm near my work place, but I'm finally trying it. Gimbap is so delicious as well, I'm thinking of trying something else. I absolutely recommend it.🥰

site_logo

Hajin Seong . 2025-04-23

MORE AT Google

Ordered a dak gangjeong and it was chicken nuggets (like a mcdonalds chicken nugget) covered in sweet soy sauce. It was not even a real chicken coated with breading. And it was for 8.5 pounds for 6 pieces. What a joke

site_logo

lui garrel . 2025-04-23

MORE AT Google

Very good food. Portions smaller than I had expected. Otherwise great.

site_logo

Nicholas Green . 2025-04-22

MORE AT Google

Food delicious however service is not up to standards. No toilets and staff miserable.

site_logo

vivien enecito . 2025-04-21

MORE AT Google

The food itself was really good and not expensive while the Staff was really friendly and nice.

site_logo

Paweł Sroka . 2025-04-14

MORE AT Google

Very friendly & cozy; pumpkin croquette was delightful

site_logo

Sybf Ibis . 2025-03-09

MORE AT Google

The Chapchea Beef is very watery and the staff explained that cause of the sauce from beef? So salty, why they have to put that much of beef's sauce to chapchea??? Also the staff are so ignoring on your concern. It is really not worth for 11.50 for the amount and taste. I couldn't finish it, too salty.

site_logo

April . 2025-02-21

MORE AT Google

Tofu (Sundubu) Jjigae is literally legit. I already had more than 6 times and their service is so nice and kind. (Even there’re No service charges!) The best Korean Jjigae place in London. While living in London, I have already come to eat soft tofu stew more than six times. If you are visiting the British Museum, be sure to stop by. The owner and his wife and the servers are really kind haha. They even brought us Valentine's chocolates as they said they were regulars haha.

site_logo

Sunyoung Kim . 2025-02-14

MORE AT Google

Delighted with the food and the workers. I highly recommend the place and the food 😊. I will return many times without a doubt

site_logo

Yolanda Díaz . 2025-02-03

MORE AT Google

Marked as open and closed over an hour before listed time

site_logo

구스만보라 . 2025-02-02

MORE AT Google

It's in front of the British Museum, so I recharged my energy with delicious Korean food. The price is reasonable and the taste is good 👍

site_logo

Emily . 2025-01-19

MORE AT Google

Food was very authentic and delicious. The staff were attentive and very friendly. Would definitely return here. 😁😁

site_logo

Hyung-In Kim . 2025-01-18

MORE AT Google

We ordered a meat box and a vegetarian one, both were very tasty. Simple atmosphere, friendly staff, delicious food. Good location of the cafe if you need to take a break while visiting the museum🙂

site_logo

Viktoriia Sydorenko . 2025-01-17

MORE AT Google

Quick and delicious!! Definitely coming back here next time!

site_logo

Ira Serge . 2025-01-17

MORE AT Google

We ordered Sundubu Jigae, Kimchi Jigae, Green tea with brown rice, and ginger tea. These are perfect combination in the winter season! This little restaurant is really a GREAT place to have lunch! We're so upset because the British Museum is close today... but this little restaurant just across the museum, with their comfort food cheers us up.

site_logo

Pauline . 2024-12-26

MORE AT Google

I found it by chance while passing by. my mom likes it so much The soft tofu stew is delicious and the bibimbap is also great :)

site_logo

Bella Jung . 2024-12-22

MORE AT Google

Great Korean restaurant The food was excellent!!

site_logo

jennifer CHARIF . 2024-12-19

MORE AT Google

The taste of seafood soft tofu stew is a bit disappointing for Koreans. Friendly staff, reasonable prices.

site_logo

Jihwan Park . 2024-11-13

MORE AT Google

fantastic food, we came back the second time and remembering us they also offered us dessert!!!!! highly recommended

site_logo

giulia mazzotti . 2024-11-09

MORE AT Google

Food is awesome, honestly, try it

site_logo

Sunmi Hwang . 2024-11-05

MORE AT Google

Delicious and well priced for what you get. Not much seating but very convenient to the Museum.

site_logo

Stefanii Morton . 2024-10-27

MORE AT Google

Bugs come out haha... and it doesn't taste that good... Part-time workers are really noisy ㅜ

site_logo

알로하 . 2024-10-17

MORE AT Google

to recommend👍 after having some days of western food, finally xfound a good place😅

site_logo

T. Lu . 2024-10-17

MORE AT Google

It was so delicious!! ~ It was so good! definitely recommend

site_logo

Yewon Lu . 2024-10-17

MORE AT Google

Tiny little cafe near the museum, can take away or don't in if there's space- not great seating arrangement as all stools face the wall where the menus photos are placed so you'll get lots of people bumping your back as they look at the wall. I had a bibimbap set: bibimbap, Miso soup, kimchi and a drink for £16. The food arrived immediately, and it's clear why- the rice was stodgy, the egg looked like a McDonald's egg with a hard yolk and lukewarm, the 'veg' consisted of bean sprouts, Asian spinach, carrots and cress (?! Never seen cress on a bibimbap before). The spicy pork was at least tasty, and the kimchi decent. Disappointing bibimbap though. There's way better places to go that will offer fresh cooked egg and veggies.

site_logo

Lucy Bennett . 2024-10-16

MORE AT Google

Cute little restaurant beside the British Museum serving korean food. The bibimbap was great, proportion of food was just right for you to be full. We completely finished our bowls. It's easier to eat here if you're 1-2 people instead of a large group. Staff was very friendly.

site_logo

Neil Cabato . 2024-09-29

MORE AT Google

cute little spot ☺️ ordered the japchae and soy chicken deopbap. food was really yummy, and portions were filling! service was good and the food came out fairly quickly.

site_logo

Tia . 2024-09-25

MORE AT Google

It’s my second time here. We ordered bibimbap with spicy pork takeaway and had in our accomadation. It reminds me of the authentic food in Korea. Highly recommended.

site_logo

Hyeonseo Joo . 2024-09-21

MORE AT Google

Food was tasty and authentic. Zucchini tasted a little bitter. For the high price, I would have expected more vegetables. There is no restroom here.

site_logo

L C . 2024-09-20

MORE AT Google

kimchi fried rice & topokki were quite spicy. staff were quite nice, but we had to pay before we got the food. seating areas are extremely small & cramped, would rather get takeaway & eat it elsewhere.

site_logo

N . 2024-09-17

MORE AT Google

The food is delicious, I loved the chicken curry 👌🏻🤍 Customer service is good, even a lady spoke a little Spanish. I will definitely come back... one day 🔮

site_logo

Lula Mae_Away . 2024-09-13

MORE AT Google

A great place - simple but tasty food, nice service. Not suitable for long staying.

site_logo

רועי הורביץ . 2024-08-22

MORE AT Google

felt really authentic, had super yummy kimbap and very nice servers

site_logo

Marlene xx . 2024-08-22

MORE AT Google

Incredibly nice personnel and pretty good kimbap

site_logo

paula . 2024-08-22

MORE AT Google

Great food and lovely staff. Food tasted great and was a reasonable price for the area.

site_logo

Alex B . 2024-08-20

MORE AT Google

The japchae was really good and the staff was very nice.

site_logo

Louise Beugel . 2024-08-16

MORE AT Google

I recommend visiting the British Museum when you want to eat Korean food after a long time! The bibimbap was delicious and the other dishes tasted almost the same as what I had in Korea.

site_logo

남서현 . 2024-07-30

MORE AT Google

Expect a delicious authentic bibimbap. My favourite in London so far! And authentic restaurant vibes. Love it!

site_logo

Jessica Squibb . 2024-06-27

MORE AT Google

Good atmosphere, very delicious food, good price. Perfect for a bite to eat before visiting the British Museum.

site_logo

victor garcia . 2024-06-22

MORE AT Google

The food is delicious and the servers are friendly. But I don't like hearing the old man's constant gibberish. The food tastes good, but the older men are the worst.

site_logo

승우 . 2024-06-22

MORE AT Google

Great service and great food it’s a must visit.

site_logo

Elizabeth G . 2024-06-13

MORE AT Google

They have been serving since way before Korean food became a fad. Run by Korean owners, it has always tasted authentic. If I'm at the museum, I'd always aim to go there and am fascinated how much they have changed. I was surprised that I was asked to pay upfront for eating in (even when they knew I was Korean, as if I'd eat and run?). The bibimbap is always good, w their special grain rice but the small paper bowl makes it nigh on impossible to actually bibim, which is literally to 'mix'. Shame their bulgogi was dry but they make the fried egg fresh. Their menu has expanded quite a bit. Wasn't keen on the canteen style row of seating. I appreciate it's to maximise space but just felt like it's not their ethos. Miss their art gallery and Korean food shop that used to be across the street. Still a filling place, reasonably priced for such a location. It's rare to see burdock tea anywhere even on teabag sale basis so that was nice to see. No parking. Disability inaccessible.

site_logo

Lia Johnson . 2024-06-06

MORE AT Google

Nice small Korean place. Lucked out to find the best Korean food here as we were so hungry after a long tiring day at the British museum. Still remember the taste and drooling over the picture.

site_logo

Ritu Manandhar . 2024-05-28

MORE AT Google

This is the first Korean restaurant I visited during my trip to Europe. This place is really, really delicious!!!! Even though I ate a lot for lunch, I ate every ounce of rice. You know that kimchi filling is essential for Koreans, right?? Even though I can't eat spicy food, I enjoyed it, so it probably won't be too spicy for foreigners either. And the combination of kimchi and seaweed is truly the best. Be sure to try it like that!! The owner and his wife are really kind, and the part-time workers who work at the store are also really kind and speak Korean well!! Recommended!!

site_logo

류하연 . 2024-05-19

MORE AT Google

A great Korean restaurant that I went to while traveling in England because I really wanted to eat Korean food! I was feeling sick from a cold, so I was craving some warm soup, and the soft tofu stew was really delicious😋😋 After eating all the food, I felt completely full and warm. The taste of home I felt in a far away country...🫶 And the two Korean owners were so friendly that I started coming out right from the moment I entered the restaurant. I felt good until then. The staff spoke Korean really well and were cute. It's right in front of the British Museum, so I recommend it if you're nearby!!!

site_logo

김지은 . 2024-05-19

MORE AT Google

Great hideaway for some authentic Korean street food. I had the bibinbap and pumpkin croquettes. Food came fast and went down fast and fulfilling. Also enjoy the view of people queuing opposite for overpriced fish and chips.

site_logo

Thomas Salsbury . 2024-04-27

MORE AT Google

A Korean restaurant I happened to stop by while passing by. If you come to the British Museum, be sure to try it. It's really big and delicious haha.

site_logo

김재현 . 2024-04-26

MORE AT Google

Really enjoyed my first lunch here with my husband, he spoke so highly of it he had to bring me here. Found this place by lucky accident. Staff are so warm and inviting, will Def be back.

site_logo

anonymous flower . 2024-04-26

MORE AT Google

A very good Korean restaurant near the British Museum. The staff was very welcoming and helpful. The Italian waitress was very kind.

site_logo

Rosa Calabria . 2024-04-21

MORE AT Google

Love this shop but found two pieces of plastics 🥲🥲🥲🥲🥲🥲🥲 so sad

site_logo

Jiayue Pan . 2024-04-15

MORE AT Google

If you want the best Korean restaurant level in London, give it a pass. After not eating Korean food for 3-4 days, we came here and the two of us devoured 4 menu items. It seems to be the earliest Korean restaurant to open in London.

site_logo

JI Heon Ryu . 2024-04-14

MORE AT Google

Really kind staff and bibimbab was very good! We had it with the marinated beef, kimchi and drink set and a single bibimbab with tofu. Would highly recommended!

site_logo

Aimee M . 2024-04-11

MORE AT Google

Great food, and service. Just good value and well worth a visit. The spicy pork was brilliant

site_logo

Christopher Goes . 2024-04-07

MORE AT Google

Hosted by a Korean, there are only eight seats, and the food is delicious.

site_logo

garfieldlego lau . 2024-04-01

MORE AT Google

Tasty korean food, fast service, clean.

site_logo

Marius Poenar . 2024-03-08

MORE AT Google

the food is yummy and the staff is very welcoming! I definitely recommend eating here if you're visiting/close to the british museum😄

site_logo

mia . 2024-02-14

MORE AT Google

Very small, cozy, and friendly Korean restaurant! Love it!

site_logo

Cherry Hung . 2024-02-04

MORE AT Google

Excellent place! The food was delicious

site_logo

Jaime Eduardo Aguilera Hernández . 2024-01-30

MORE AT Google

I always go to this resturant after my visit to British Museum, great Korean dishes. Fresh and tasty ✨

site_logo

Mo Monsef . 2024-01-30

MORE AT Google

Great food, lovely staff. A great spot to come across Thank you, will be back!

site_logo

Alys Horsfall . 2024-01-03

MORE AT Google

Amazing service and good. So flavorful and the staff is so awesome

site_logo

Reet Oberoi . 2024-01-01

MORE AT Google

I ordered kimchi stew and beef bulgogi, and it was delicious and the portion size was better than what I eat in Korea, so I really enjoyed it!! I was so thankful that they accepted me so kindly even though it was close to closing time ㅠㅠㅠㅠ

site_logo

이경원 . 2024-01-01

MORE AT Google

Very good korean food! Owners are very friendly.

site_logo

Kevin Ling . 2024-01-01

MORE AT Google

Very delicious food for the price. Very friendly and helpful staff. Only downside was the small capacity of the restaurant. It wasn’t an issue for us but larger parties at busy times may struggle to fit.

site_logo

Gigalocky . 2023-12-17

MORE AT Google

Very very good bibimbap, with good value for money. The staff is friendly.

site_logo

Marine Rupp . 2023-11-27

MORE AT Google

Staff members are friendly and helpful, we are enjoyed the food it’s was tasty highly recommend

site_logo

Natalija Bond . 2023-11-01

MORE AT Google

Good place with kind staff! Came to bibimbap cafe extremely hungry and it met my expectations greatly :)

site_logo

deniz . 2023-10-26

MORE AT Google

Feels like I am back in Korea and the street shop that I craved for. Food is amazing and service is fantastic with a small perk to learn bit of Korean language and culture from the owner 😄

site_logo

Brian . 2023-10-18

MORE AT Google

Great food & Friendly staff. Very patient with me

site_logo

Toby Larrone . 2023-10-14

MORE AT Google

Quite expensive considering the portion, unfortunately there are very few places to eat on site

site_logo

Natalia . 2023-10-06

MORE AT Google

Yummy simple bibimbap (I got normal chciken) but £11 is hefty, it used to be for £5

site_logo

L !! . 2023-09-30

MORE AT Google

The owner is very friendly and it tastes really good, just like eating in Korea.

site_logo

ʕ ́• ᴥ•̥`ʔ . 2023-09-24

MORE AT Google

After a month long Europe trip, I was craving some excellent Korean food and I found it here! I had the bento box with spicy beef and Kimchi fried rice. Both were delicious, spicy and flavourful. And large portions! I couldn’t finish it all even though I desperately wanted to. The staff were so friendly and kind, quickly making the food with smiles. If I had more time, I would definitely be coming back for more!

site_logo

Kandidly_Kate . 2023-09-22

MORE AT TripAdvisor

There are times when you think of Korean food while traveling... So I went there not expecting much, but it was more delicious than I expected and the atmosphere was nice. I thought I would go again next time I go to London. he

site_logo

범석 . 2023-08-22

MORE AT Google

Chinese restaurant, good food for those who like it.

site_logo

Guara Ueda . 2023-08-21

MORE AT Google

I think this is the perfect place to stop by when you crave Korean food during your trip. A taste of Korea in London? Haha, it was delicious.

site_logo

Bom Bom . 2023-08-16

MORE AT Google

This has Korean employees, and that's the only thing that was Korean! I had Dak Bulgogi (Chicken Bulgogi) and it was closer to Dak Jigae (Chicken soup). There wasn't even a drop of Bulgogi sauce. Plain chicken, watery liquid at the bottom of the bowl (not a plate), and tasteless. NO PAN CHAN (korean side dishes that are almost always complimentary). I asked for Kim Chi, and got a plastic container with wilted cabbage with too much GoChujang. I asked for a glass of water, they brought a bottle of water. Paid 3.5 pounds for the KimChi, and 3.5 pounds for a bottle of water. The BiBimBap was tasteless and a small serving. I've travelled South Korea, and eaten Korean food all over the world. This place is an embarrassment!

site_logo

Larry S . 2023-08-10

MORE AT TripAdvisor

An insult to Korean Food! This has Korean employees, and that's the only thing that was Korean! I had Dak Bulgogi (Chicken Bulgogi) and it was closer to Dak Jigae (Chicken soup). There wasn't even a drop of Bulgogi sauce. Plain chicken, watery liquid at the bottom of the bowl (not a plate), and tasteless. NO PAN CHAN (korean side dishes that are almost always complimentary). I asked for Kim Chi, and got a plastic container with wilted cabbage with too much GoChujang. I asked for a glass of water, they brought a bottle of water. Paid 3.5 pounds for the KimChi, and 3.5 pounds for a bottle of water. The BiBimBap was tasteless and a small serving. I've travelled South Korea, and eaten Korean food all over the world. This place is an embarrassment!

site_logo

Larry Schultz . 2023-08-10

MORE AT Google

I am very satisfied with my lunch during the trip!! It's plentiful and delicious. The location is good and easy to find. I recommend it~

site_logo

박연주 . 2023-08-08

MORE AT Google

I loved this restaurant, I recommend it 100%. Special thanks to Kim, who helped us choose the food. Kim speaks Spanish. Thank you for a pleasant experience.

site_logo

Luis R. Graciani . 2023-08-06

MORE AT Google

it is delicious. The bibimbap is delicious, the beef bulgogi is delicious (there are a lot of portions!), and the location is right in front of the British Museum, so it would be a good place to go. There is a break time, so watch the time carefully.

site_logo

_ Roh . 2023-08-05

MORE AT Google

The staffs are very friendly and sweet. I must say that I am happy to order the bibimbab because it is finally something healthy with more vegetables and protein with less deep fry and oily foods . Besides the price is acceptable.

site_logo

Amelia Liang . 2023-08-04

MORE AT Google

Amazing authentic Korean food, fast service and fairly priced!! Highly recommend. Right outside of The British Museum.

site_logo

Helen . 2023-08-01

MORE AT Google

It's really, really delicious and hearty.

site_logo

박채은 . 2023-07-28

MORE AT Google

I loved all the foods and employees were all very kind. Great experience

site_logo

Sejin Yoo . 2023-07-26

MORE AT Google

Fantastic food! It tastes like genuine korean home food. It was absolutely good food and nice service

site_logo

Sewon Lee . 2023-07-26

MORE AT Google

Excellent taste, authentic, great value for money especially considering location. Recommend Kimchi Jigae

site_logo

Karsten Kinzig . 2023-07-24

MORE AT Google

The food is delicious and the waiter's service is mediocre. In an environment like the UK, this should be considered very good.

site_logo

wolfson tw . 2023-07-22

MORE AT Google

Normal, not worth the price paid for the food. So disappointing and bibimbap is cold and japchae is bland.

site_logo

Charles Jomike C . 2023-06-17

MORE AT TripAdvisor

would go again, good food and bentos, miso was good too

site_logo

vi . 2023-06-09

MORE AT Google

While receiving friendly service in London, I felt bad at the really unfriendly attitude of the Korean part-time worker. In particular, the part-time worker who took my order was really unfriendly. The food was delicious, but I don't think I can recommend it because of the part-time workers. I recommend the kimchi stew, but I don't recommend the kimchi fried rice because it's too salty!

site_logo

나인선 . 2023-06-07

MORE AT Google

Had the bibimbap today which was really good and I especially enjoyed the fried kimchi topping, a great alternative to the more typical tofu -- both great for vegetarians. The fried kimchi was saucy and when mixed with the gochujang (sweet & spicy red pepper sauce), elevated the bowl to another level! The food was well-priced, fresh, delicious and authentic (I'm Korean btw!). Also the staff was very friendly. Highly recommended!

site_logo

Pomegarnet Fox . 2023-05-29

MORE AT Google

It wasn't super late, but after I read reviews when they first opened, I wanted to see what all the fuss was about. I ordered something resembling broth, tofu & seafood. Food arrived, piping hot with a side serving purple rice. The broth had few pieces of tofu, few bits of squid rings but not much of anything else for the super price of £12.95 you don't get much in change or food. Never again ever.

site_logo

Ralph W . 2023-05-25

MORE AT TripAdvisor

Tasty food. Lovely cafe, sit out on a sunny day and people watch. Absolutely priceless. Great location. Friendly staff.

site_logo

World TV . 2023-05-23

MORE AT Google

This restaurant used to be run by Korean people, cooking and serving cheap but decent Korean food. Now it seems to have new chefs and servers who are not Koreans. Also, the table set up has changed and are now just along one side wall. The food was mediocre. Location and prices still good though.

site_logo

Jan Menneken . 2023-05-22

MORE AT Google

They were so kind , the price is good for the food if u have the opportunity to try it do it ! (+ the girl that was speaking a little bit of French was adorable )

site_logo

Reem . 2023-05-20

MORE AT Google

The ingredients are generously used and the food is very tasty 👍👏👏👏

site_logo

우승연 . 2023-05-17

MORE AT Google

I came here to eat Korean food. I'm very satisfied. I don't know why the rating is low. best

site_logo

정두선 . 2023-05-14

MORE AT Google

Ordered bibimbab via Uber Eats, the taste is not bad as the food delivery, it’s also a good choice for a healthy lunch because of vegs

site_logo

Jorvik Zhang . 2023-05-04

MORE AT Google

Similary restaurants in London

restaurant_img
3.9

562 Opinions

location-icon16 woburn walk
Asian
outdoor_seating_83228takeaway_83228delivery_83228

I have eaten here many times, the location is great, as is the food and service.

restaurant_img
3.9

886 Opinions

location-icon16 Hanway Street
Asian
outdoor_seating_77989takeaway_77989delivery_77989

The best japchae I've ever had and I've had plenty. The Korean fried chicken was really really good too, wish it was saucier! Stir fried udon was almost as good as the japchae and the chicken soup is a must-order!!! Seems like you can't really go wrong here 😍 (only thing I'd say would be to order something other than the bibimbap, it was just average) Be sure to make a booking and a little warning but the area is pretty cramped and small so if you're carrying loads of things that might be one thing to think about!

restaurant_img
3.9

107 Opinions

location-icon30 England's Lane
Asian
outdoor_seating_108565takeaway_108565delivery_108565

Mi esposa y yo nos quedamos agradablemente sorprendidos de encontrar esta pequeña marca restaurante muchos positivos. No sólo había una buena selección de platos, pero también tenía una limitada pero amplia selección de vinos. El servicio era excelente, las raciones de comida eran abundantes y deliciosos. Sin duda lo recomendaría a cualquiera con un gusto por la cocina asiática.

restaurant_img
3.9

5215 Opinions

location-icon37 Charlotte Street
Asian
outdoor_seating_69078takeaway_69078delivery_69078

Visited many times, always enjoy.

restaurant_img
4.0

2599 Opinions

location-icon32 - 34 Monmouth Street
Asian
outdoor_seating_71828takeaway_71828delivery_71828

Quite good food but it was let down by slightly slow service and slightly austere waiters. Due to the layout of the restaurant it isn't always easy to get their attention. Average price but I wouldn't rush back due to service.