GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.3

Based on 162 opinions finded in 1 websites

site_photo3

Nº 2120 in 2648 in Liverpool

Nº 40 of 50 Asian in Liverpool

CUSTOMERS TALK ABOUT DISHES WITH..noodlescurrycookedchickenchilliprawnsricespicymeategg
Score
OpinionsNoteTripAdvisor1623.3

comment_iconOpinions

Wok&Go siempre guarda el día en que no podemos encontrar ningún sitio para comer. Todos los lugares que visitamos en un sábado ocupado estaban llenos y todos estábamos hambrientos e irritables. Decidimos tomar unos fideos y fue una buena decisión. La comida se hizo súper rápido y todos nos sentamos a charlar y comer nuestros fideos. Fue un buen final para un día divertido. Lo único malo es que era tan caro.

site_logo

Jenn Cara . 2025-05-04

MORE AT TripAdvisor

Ordered 4 items for takeaway. Teriyaki fries (missing from delivery) , salt and pepper tofu (delivered salt and pepper chicken), vegan fried rice with vegan duck (delivered with duck meat). Cost a total of £37.78 and only £16.45 of it was delivered or edible. I’ve never been to a more useless takeaway, appalling!

site_logo

Sam B . 2024-05-05

MORE AT TripAdvisor

We recently visited Liverpool and was struggling to find somewhere for an evening meal, we have allergies and intolerances so a lot of menus were not suitable for us. We looked at the menu of Wok&Go and saw they had a bunch of vegan options so we decided to get some noodles, When we arrived we realised that the kitchen staff had cleaned up and assumingly was ready to close up for the night, the staff were so so kind and still sorted us out. We had no idea what time they closed so we felt awful but the staff on the desk was honestly so attentive. The noodles were so nice and we will definitely be returning!

site_logo

Jenn Cara . 2023-04-13

MORE AT TripAdvisor

My son really rated this place so gave it a go whilst in Liverpool and was not disappointed. I had the Hot Box which was cooked fresh and was amazing. 1 negative was there was not a lot of meat in the box but still worth the money.

site_logo

neil LFC . 2023-03-26

MORE AT TripAdvisor

Ended up in wok & go after Bazza hadn’t organised any restaurants for the stag group, Bazza thought it was great that nobody was sitting in the establishment and just thought we were so lucky. The establishment has no toilets and doesn’t sell alcohol and as we were on to our 8th hour of binge drinking that didn’t go down well. Food was ok but should maybe think of adding cheese sandwich to menu as David would like that. Food was ok just not what we wanted.

site_logo

Craig Collins . 2023-03-20

MORE AT TripAdvisor

I’ve eaten from many wok n go’s, usually the rice boxes are full of ingredients; lots of crunchy veg and variety of tasty meats. The box I ordered lacked everything other than rice! Barely 3 pieces of meat, couple of pieces of broccoli and even very minimum bean sprouts, could not find any egg (picture attached). Definitely not worth £7.30, 3/4’s went in the bin. Really disappointed as I felt as if they were cutting costs at the customers expense.

site_logo

Davedavedave . 2021-11-05

MORE AT TripAdvisor

Absolutely the worst Worst place you can go to in liverpool I ordered pad thai box which tasted like noodles with sugar. Pad thai s never like that, and i ordered katsu curry box but they gave indian curry instead Both food were just full of carrots We only had 4 pieces of meat even though we ordered large boxes. And who in the hell puts carrot in pad thai. Plus, both food had hairs inside, and uncooked rice and noodles as well.

site_logo

Tselmeg B . 2021-04-04

MORE AT TripAdvisor

Been a few times with friends and like it but some of the noodles lack sauce, it's filling and they have a meal deal with a side and drink.

site_logo

MichaelLive . 2020-12-31

MORE AT TripAdvisor

Place was nice inside and so was the food. However the customer service wasn’t up to its best standards. Christie on till was very rude to my mum. I wouldn’t come to this store again because of this!

site_logo

Jn2117 . 2020-10-26

MORE AT TripAdvisor

Ordered online; then received a call to say various standard items "out of stock" - refused to refund for items not available. Then arrived to collect at time confirmed only to have to wait a further 20 minutes. Barely any meat or veggies in food, just stodgy noodles. Really overpriced for what was provided. Absolutely awful customer experience all round.

site_logo

Venture324890 . 2020-09-02

MORE AT TripAdvisor

A few days a go Thursday 13 August 2020 my partner and I and our 6 year old son who is autistic was refused service by a female member of staff because my partner had an exempt badge as she as Asthma and can't breath with one on, the staff seen this and refused to serve us, I pointed out to them that they had customers in the shop not wearing a mask and had no badge the female said that's because they are eating, I told her we were going to eat but she sis not care and told us to leave. When I said I was going to report her she stuck to fingers up to me and said she doesn't care. I have tried to reach head office twice now through Email due to the being no phone number to call them, I stated my complaint and then sent another email asking for an update a couple of days later. No one as got back to me. the fact that we had to deal with our son as he got extremely upset when `he got out side the shop because he could not eat in where we have been a few times with him was disgusting in it's self and the female as not been held accountable for her actions. and no one as got back to us about our complaint

site_logo

PeterB9443 . 2020-08-15

MORE AT TripAdvisor

Asked for sweet chilli souse instead I’ve got super hot souse and it’s impossible to eat at all.Costumer service is awful ,really rude and never had discount even when I’ve said that I’m ready to eat in.I understand if I didn’t ask but staff approved that they do 50% discount because it is a right day for it .I work in costumer service and I do understand that it’s stressful when it’s busy but you still can be at least polite and understand that people can struggle to explain things specially when you’re foreign .Never will recommend this place to anyone and never will be back there.

site_logo

katekruc . 2020-08-12

MORE AT TripAdvisor

Great food, great service from the lady who served us, shame about the atmosphere with a member of staff crying and complaining about the job and people she worked with next to our table made us feel very uncomfortable

site_logo

Foodreviews1620 . 2020-07-06

MORE AT TripAdvisor

Feeling hungry and wanting a tasty lunchtime meal me and my wife popped into Wok and Go in Liverpool whilst visiting relatives. We both chose to select the 'customise' menu where you can add extra ingredients to the basic noodle mix. Upon opening our boxes we were shocked at the miniscule quantities of the so-called 'Extras', possibly a half mushroom between us, a couple of tiny broccoli florets and a couple of tofu pieces each. All for a grand total of nearly £20. We could have eaten in the Chinese buffet restaurant literally opposite Wok & Go for the same price, and if we happen to be in Liverpool city centre again wanting to each Chinese then that's exactly what we'll do.

site_logo

Capirossi56 . 2020-02-03

MORE AT TripAdvisor

Exactly what fast food should be. There’s a great selection on the menu and the food is always tasty, quick and to a high quality. Service is also always very friendly.

site_logo

Peter0507105 . 2020-01-15

MORE AT TripAdvisor

Why would you pay for something that is just slimy and TASTELESS? The price is decent for the size of the portion, but it was just lacking flavour overall. The food wasn't cooked wrong, ie it's just seems like the separate ingredients have been put together rather the cooked together.

site_logo

Potabol4 . 2020-01-13

MORE AT TripAdvisor

the food was delicious and was served quickly. They have different prices for various box sizes which was really confusing, but will definitely eat there again.

site_logo

john m . 2019-09-07

MORE AT TripAdvisor

FOOD: Better than expected .... The Nasi Sauce on Flat Rice Noodle with Squid was acceptable ....... however the Noodle Menu only offered regular size boxes which was too much for one person .... the smaller boxes are only available for the "Classic Box Menu" ..... confused ..... so am I .... and the menu on the window and the counter was the previous one with previous prices even the staff and till were confused PRICE: We paid £13+ for two regular boxes ..... a bit pricey for what we ate SERVICE / STAFF: Noisy and Confused ........ like the customers AMBIENCE: Nil ...... its a tiny cafe with few tables and hemmed in. But it is what it is I guess Wok & Go FACILITIES: No rating didn't try the bogs (didn't see any bogs either). Just wanted to eat up and leave. Might give the Hanover Street a try for comparison though.

site_logo

Jake-from-Liverpool . 2019-09-02

MORE AT TripAdvisor

All of our food got put in the bin after discovering a hair in the food. Will never ever go there again, hygiene practices were questionable.

site_logo

Odyssey147609 . 2019-08-29

MORE AT TripAdvisor

This was my first time trying a noodle bar and it was lovely.Excellent portion sizes small medium and large,lots of meaty filling and so so tasty,there was no hassle picking and mixing a meal for my 10 year old son.the whole experience was great and I would definitely recommended paying wok & go a visit.

site_logo

Voddie76 . 2019-08-27

MORE AT TripAdvisor

Barato y rápido. Bastante buena comida. Apto para vegetarianos. Camarera deprimida Me pregunté con mi amiga por qué estaba tan deprimida. ¿Es porque todos los demás miembros del personal son asiáticos y hablan entre ellos en un idioma extranjero, pero no con ella, ya que parece que no sabe ese idioma? Bueno, espero que ella pueda mejorar pronto. Para la comida, definitivamente no son cinco estrellas, sino comida asiática de la calle. Es sabroso y abundante.

site_logo

Steeve17 . 2019-08-21

MORE AT TripAdvisor

I love wok and go and eat there regularly but the last two times I’ve been, I’ve ordered a create your box where I’ve asked for noodles, veg and sauce and nothing else, and BOTH times they’ve given me a box with meat in (but managed to get the no egg part right!!)

site_logo

emma5168 . 2019-08-11

MORE AT TripAdvisor

Went hear for lunch with my wife as we were in bold street shoppingHavn't been for a couple of years but decided to call in.I had nasi seafood regular not a patch on the previouse time I ate hear, rice was verry gloopy had only 4 prawnsi think they gave themselves up,and what was supposed to be fish cake tasted like a cross between tofu and crab stickNot at all enjoyable The wife had mee gee seafoodNot much different cheep ingrediantsNeed to go back to your original conceptShould have realized when we went in they had no customers said alot

site_logo

T2449GMpeters . 2019-07-18

MORE AT TripAdvisor

First time customer! Definitely coming back, staff was amazing! Food was excellent! Lydia Woodroofe gave me amazing service and helped with my order!

site_logo

Lydia W . 2019-07-06

MORE AT TripAdvisor

I used to love visiting Wok & Go and ordering a good old HotBox. When it first opened it was great, but now the establishment has really let me down. The ingredients they now use are just cheap and nasty if I’m honest. The Char Sui in the HotBox was really terrible, it looked cheap and nasty, every piece looked like a pigs ear or something. The Chicken just looked like pieces of rubber, and the Beef was clearly just the cheapest ingredient they could find. I found myself picking out all the meat, and just eating the noodles by themselves because I was really hungry. Good quality ingredients it’s a must! Customers deserve good quality ingredients instead of the establishment thinking we don’t know what good food is and just trying to profit as quickly as possible by feeding us nasty food masked by the sauces in the noodle boxes.

site_logo

PengOrNah . 2019-06-15

MORE AT TripAdvisor

An excellent good value noodle and rice restuarant in Central Liverpool. The dishes were prepared speedilty and the portions were excellent. A must vist to Liverpool .

site_logo

Vikmis2013 . 2019-06-05

MORE AT TripAdvisor

Great food as always at wok and go 👍 Fast and convenient while shopping in Liverpool city center really tasty food and great staff

site_logo

markw2285 . 2019-06-05

MORE AT TripAdvisor

He ordenado arroz frito con verduras y he elegido más verduras adicionales para agregar: champiñones, pimiento morrón, pensando en hacerlo más rico.

site_logo

Ram0na12345 . 2019-04-26

MORE AT TripAdvisor

Ordered through Deliveroo. All 3 meals were disgusting. Veg (what there was of it) was over cooked, duck tasted weird and it was dry with hardly any sauce. Called the shop and were told their best chef had cooked the food. Waste of time.

site_logo

sgray26 . 2019-04-16

MORE AT TripAdvisor

Mi ir a la calle en negrita! ¡Soy bastante habitual en este lugar! Absolutamente encantadora gerencia y personal que siempre cuidará de usted. La comida siempre es deliciosa gracias a los excelentes chefs de la cocina. Siempre me dan la caja de mariscos Mee Gee y lo recomiendo altamente. Todos los lados son fabulosos! Siempre hay grandes ofertas de comida y descuentos para estudiantes. El servicio es siempre rápido.

site_logo

Saltygal1 . 2019-02-19

MORE AT TripAdvisor

Mi primera y última vez visitando Wok and Go. Pedí 1 comida del menú y esperé 30 minutos. Deliveroo y Uber comen la entrega de ciclistas parecen tener prioridad, lo que es incorrecto para mí. Deben ser los clientes que están esperando para comer en el restaurante. La comida era muy sabrosa pero la espera fue inaceptable.

site_logo

irubery . 2019-02-10

MORE AT TripAdvisor

Ony guy trying to deal with taking orders, prepare food for delivery and answer phones at the same time. Disgusting smell in the local. Waited a long time to order my noodle box and then to get my order. The meal was tasteless. Definitely not worth its money. Not recommended. Won't be back.

site_logo

sylwiashere . 2019-02-01

MORE AT TripAdvisor

Had the Hot Box and it was super tasty! Nice and spiced with plenty of meat, which you don’t often get in these places. Staff very friendly. Will be back soon

site_logo

ConanM12 . 2019-01-26

MORE AT TripAdvisor

My 3rd time coming to this place and it just gets better every time! Staff are always so welcoming and happy to help with any questions/requirements and the food is always perfect!

site_logo

. 2019-01-23

MORE AT TripAdvisor

Decent portion, great flavour, lots of choices (thai, chinese, curry, terikayi)

site_logo

clpmt . 2019-01-23

MORE AT TripAdvisor

My first experience with Wok N Go and have to say that we were disappointed with portion sizes for the price, especially for the extras. The staff was quite nice and place reasonably clean though. First and last experience, can't justify the price.

site_logo

. 2018-12-27

MORE AT TripAdvisor

I went here around 10pm on a Friday night (sober I should add) and ordered the ‘Veggie Curry’ box. It should have been full of tofu, mushroom, mixed peppers, broccoli, Yaki Soba noodles and Thai Green Curry sauce.

site_logo

661IanM . 2018-11-16

MORE AT TripAdvisor

Wok and go was fast and fresh quality food. The customer service was lovely and I enjoyed the meal. I did originally want something different on the menu but they advised me that hey had run out of it so I had to order something different. I didn’t mind too much as what I ended up ordering was still great

site_logo

W6324VXstephaniep . 2018-11-06

MORE AT TripAdvisor

My daughter ordered a Yasi Yaki wrap and waited ages. When it finally arrived they said the wraps were frozen so they just gave her a box of the filling. No alternatives or other options. Poor!

site_logo

Tomreviewer . 2018-10-22

MORE AT TripAdvisor

I had stopped by for a quick bite to eat on my way to a meeting and took the opportunity to catch up on a few emails on my laptop. It was fairly busy and I hadn’t eaten there before, I was immediately greeted by Shaun who offered his advice on various meals and showed me to a table. On Shaun’s advice I ordered and sat down, the WiFi was down meaning I couldn’t work which is what I’d stopped to do, he immediately stopped what he was doing and went upstairs returning with a pin for his personal WiFi. The food was excellent and the service was too! It’s the little things, well done Shaun

site_logo

Kilcourse1234 . 2018-09-24

MORE AT TripAdvisor

Ate here today for the first time in a while, ordered the Hoi Sin Duck box off of the special menu and was not disappointed, very flavoursome - will be getting extra meat next time tho as slightly skimpy on it! Got this as a meal with 2 spring rolls and a drink for £8 - great deal and very filling.

site_logo

Tom E . 2018-09-04

MORE AT TripAdvisor

I ordered a food and never came. I was calling up to 10 times just to tell me someone what happened and none answer to me

site_logo

man m . 2018-08-20

MORE AT TripAdvisor

Location spartana e si mangia nei cartocci di cartone e con le posate di plastica ma il rapporto qualità/prezzo è ottimo! Provato sia il piatto con gli spaghetti all’uovo con carne di pollo e vitello e verdure che il piatto spicy a base di riso pesce e verdure (consiglio soprattutto quest’ultimo).

site_logo

mauroo182 . 2018-08-15

MORE AT TripAdvisor

Este es el lugar perfecto para fideos descuidadas con carnes crudas y grasientas salsas. Imaginar una comida para llevar China después de tres días fuera, entonces he imaginado un plato de Wok & Go. Mantente bien lejos.

site_logo

Smackavoy S . 2018-08-11

MORE AT TripAdvisor

Tanto estaba equivocado! Fideos insípida, albóndigas sin la salsa prometieron y no cubiertos (que era especialmente ordenados). Pasa si buena comida y buen servicio.

site_logo

road_slave_27 . 2018-07-25

MORE AT TripAdvisor

Fantastic fresh food. First time here and it won't be my last 😍. Would be eating from here each time I travel over to Liverpool

site_logo

Natalie M . 2018-07-17

MORE AT TripAdvisor

Visité wok & go recientemente y quedé muy sorprendido de que una amplia variedad de opciones, el vegetariano hasta el personal era muy servicial y educado en la vegetariana y opciones no disponibles. vegana

site_logo

louiseann840 . 2018-07-11

MORE AT TripAdvisor

Excellent food, clean store and very friendly staff! Would defently recommend anybody to go here! Every time I have been here I have had great experience.

site_logo

KatieJPatterson . 2018-07-09

MORE AT TripAdvisor

Great service, good clean and fresh food. Great for gluten free. Check out their offers as they can save you lots of money. Portions are huge. X

site_logo

Kylie M . 2018-07-04

MORE AT TripAdvisor

Very bad food, very, very, bad food. Terrible customer service. No please, no thank you at the till.

site_logo

lovelyfoodman . 2018-07-03

MORE AT TripAdvisor

It was some of the best food I’ve had, everything was done to perfection and I’ll definitely go again

site_logo

El J . 2018-07-03

MORE AT TripAdvisor

Estado aquí varias veces, cada vez he notado los ingredientes en las cajas cada vez más pequeñas, pedí mi habitual fuerte mee Gee mariscos pollo extra con 7 libras. 50. Deben ser literalmente el escrutinio de piezas de pollo verduras y otros ingredientes, pollo pedí no existía! 1 pequeñas piezas de brócoli, cargas de la tofu y llena de fideos. Un montón de cosas y no el barato de los ingredientes principales. Barato y mezquino! Si quería comer solo fideos podría quedarse en casa con paquetes si 50 p y la garganta de fideos en ellos, pero no quería la comida del mar! Qué estafa

site_logo

GenitcallyM . 2018-06-26

MORE AT TripAdvisor

Normalmente es fiable y wok, proporcionando fideos caliente y sabrosa. Nunca pedimos para entrega antes de hacerlo y no lo hará de nuevo. . Las cajas mee gee. no contenía langostinos y verduras muy poco. No escapar wity este en la tienda ya que se queja de inmediato!

site_logo

Appsy_C . 2018-06-09

MORE AT TripAdvisor

Die Speisen im Restaurant und auch die Take-away - Boxen sind sehr lecker und von der Menge sehr gut. Die Preise sind in okay, dafür werden die Speisen auch frisch nach den Wünschen des Gastes zubereitet.

site_logo

Achim4711 . 2018-05-26

MORE AT TripAdvisor

was really nice last time i went love the sweet box which they used to do i belive now they only do certain box sizes and only a few flavours

site_logo

Mark P . 2018-05-10

MORE AT TripAdvisor

Recently seen the advertisement for vegan options and wok & go so gave it a try. Asked specifically if the box I asked for was vegan, the server said yes. Throughout the box I kept seeing/tasting thing which looked like egg however the tofu had a very eggy texture so I assumed it was some bit of tofu however when getting to the bottom of the box I found a large bit of egg. With the advertisement of the vegan/veggie options you would have thought more caution would have been put in in ensuing these are actually vegan and meet the customers expectations, disappointing, even worse if I was someone with an egg allergy trying to avoid it by choosing the vegan option

site_logo

Jasmine O . 2018-05-08

MORE AT TripAdvisor

8 pounds for a noodle box and a diet coke. Average food. Hot box not hot. Friendly but not especially helpful service.

site_logo

Stubowler . 2018-04-26

MORE AT TripAdvisor

I love Asian food but sometimes in the UK it is hard to get good Asian street food, but wok and go get it spot on

site_logo

deedeep1970 . 2018-04-24

MORE AT TripAdvisor

Primera vez en ir a uno de estos lugares. Sólo me apetecía algo así simplemente bobbed con fideos en mientras andando. Debo decir que me quedé muy impresionado por la higiene del lugar. El personal era muy servicial y champaña. El menú no podía creer que había tanta variedad. Tuve un pollo dulce y agria de tamaño regular de seguridad. El precio de las cajas eran muy razonables, junto con artículos adicionales que podría haber en su comida. La comida en sí era muy bonito. de muy buen gusto y la parte de la caja era el justo para una comida si no tienen un apetito muy grande. En general, fue una experiencia muy agradable ir allí y sin duda recomendaría este lugar a amigos y familiares. Bien hecho a todo el personal que trabaja allí para darme una agradable visita.

site_logo

lilypug2 . 2018-04-08

MORE AT TripAdvisor

Mmmm liverpools finest half time meal deal. After 6 hours in busy traffic nothing like a sweet chilli box from the lovely staff at boldstreet always a pleasure. Only thing missing is a nice cup of chow to wash it down with.

site_logo

markrome18 . 2018-03-27

MORE AT TripAdvisor

Visitamos aquí con algunos amigos no me decepcionó después de un viaje de compras a Liverpool,! La comida era increíble y el personal era muy agradable y una gran ayuda, teniendo en cuenta que era mi primera vez! Yo opté por el cuadro combinado y una oferta de comida e incluso algunas tenían sobrado para llevármela a casa! La tienda estaba muy limpio y el ambiente muy relajado aunque la tienda estaba muy lleno. En general, una encantadora visita y sin duda volveré y lo recomiendo!

site_logo

EmilyGarndner228 . 2018-03-27

MORE AT TripAdvisor

Came up to Liverpool on a business trip for the weekend and thought I would try out wok and go, considering it was my first time being there, the staff where very helpful in choosing the best meal for me. Very chatty and smiley, could only fault the noise of the chefs, as they were very loud, however over the three days I was here, I ate here twice and will defiantly be coming back again soon! Well deserved 5 stars

site_logo

Williammooree . 2018-03-25

MORE AT TripAdvisor

I’ve heard many good reviews from my friends about wok and go so I decided to give it a try,...

site_logo

JKingg12 . 2018-03-25

MORE AT TripAdvisor

as an enthusiastic noodle lover I thoroughly enjoyed my hot box, the manager was pleasant and staff on the counter were friendly. Restaurant was clean.

site_logo

Jordan W . 2018-03-25

MORE AT TripAdvisor

Popped in here as have heard about great reviews about the friendly staff and great chefs fòod was excellentI had...

site_logo

cathycushen . 2018-03-22

MORE AT TripAdvisor

Love this place the staff are really friendly and the food is delicious, its reasonably priced I'd defiantly recommend eating...

site_logo

Cathy I . 2018-03-22

MORE AT TripAdvisor

i visted this store on a family day out, we didnt want to wait around for a table anywhere as...

site_logo

citydreams2018 . 2018-03-22

MORE AT TripAdvisor

Fantástico, la comida era precioso y el precio muy razonable. Tuve la fuerte curry verde tailandés, fue una gran parte y muy agradable. Recomiendo encarecidamente

site_logo

Pete H . 2018-01-16

MORE AT TripAdvisor

This is exactly what it 'says on the tin'. Great food and served quickly. Good choice without having an 'overbearing'...

site_logo

Matt B . 2017-12-30

MORE AT TripAdvisor

After Christmas shopping in town popped into here and bought a Hot Box to go. Took it home and had it for tea, delish.

site_logo

graham198 . 2017-12-20

MORE AT TripAdvisor

I usually visit the Bold Street franchise which is generally very good, food is tasty (I normally go for a hot box) and the service is always very quick. Central Station branch is also good although frequented less often. Today I visited the new Hanover street franchise and was VERY disappointed, I got my usual hotbox but the sauce wasn't the same (sweeter) and it was also very 'wet'. I was also disappointed with the lack of meat. A hotbox is normally dry with chicken, beef and char sui. There was no char sui in mine and very little beef and chicken- completely different to what I usually get from the other two franchises visited. I would have thought that although they are different franchises similar training would be given as to how to cook the food to ensure consistency? I would not visit the Hanover Street restaurant again although I do want to stress this is not a reflection on either the Bold Street or Central station restaurants (particularly Bold Street).

site_logo

Lovelubelle . 2017-12-09

MORE AT TripAdvisor

Visited here on Monday after a weekend shopping trip to the city from hull for something tasty on out trip home. Unfortunately it wasn't a pleasant experience. I ordered two boxes of sweet chilli noodles ordering extra prawn. They both had barly any flavour they were just plain noodles with barly any filling and 3 prawns between both boxes and it was all really dry not like it had been freshly cooked. We have wok and go in hull and it's always excellent for such a big city I expected it to be on par or much better.

site_logo

kirbyfamile . 2017-12-07

MORE AT TripAdvisor

Muy fideos sabroso! Las ofertas de comida sin duda llenará! Las comidas son una buena relación calidad-precio teniendo en cuenta la cantidad de comida en la caja. Las envolturas son muy grandes.

site_logo

Roxanna H . 2017-10-23

MORE AT TripAdvisor

instead of Boring hamburger or pizza, you can have noodle......Mmm Mmm...... delicious!!!!! You can find different tastes. Go and try them

site_logo

Antonella A . 2017-10-15

MORE AT TripAdvisor

Wrong order and it's mainly just noodles. 80p per vegetable and there's barely nothing. I paid nearly £7 for just noodles. Absolutely awful.

site_logo

liverpoolcity111 . 2017-10-14

MORE AT TripAdvisor

This is the place to go for noodles in Liverpool ... it was fantastic !!!!

site_logo

Lee b . 2017-10-05

MORE AT TripAdvisor

Una gran selección de comida a elegir para los amantes de fideos y responsable también un gran servicio a un gran precio, comida degustación

site_logo

Bennyjen . 2017-08-16

MORE AT TripAdvisor

Wok&Go does excellent noodle and rice dishes that can be eaten in or taken out. I can vouch for the Mee Gee Seafood box being tasty, though the vegetables are more for texture than anything else as the sauce drowns out the taste. Fortunately, the sauce is delicious. The dishes are packed tightly into boxes allowing them to stay hot whilst you catch a train or get where you need to be. I can also highly recommend the delicious sides.

site_logo

Joseph H . 2017-07-18

MORE AT TripAdvisor

Came across this place on my way to catch the train at lime street. Vermicelli , chicken and fresh greens all cooked to perfection and in super fast time. You get plenty and definitely won't go hungry on one of there noodle boxes.Clean, open kitchen and pleasant staff too. Enjoy.

site_logo

mrtenerife1 . 2017-07-11

MORE AT TripAdvisor

Ordered chicken Thai noodle box. Approx 3 pieces of chicken in it. Completely bland and tasteless.. Will not be returning.

site_logo

RSA3 . 2017-06-12

MORE AT TripAdvisor

My first time having Wok&Go.I was dissapointed with the noodle boxes, the chicken was dry, there was hardly any prawns and the sauce was bland, leaving a bad aftertaste in my mouth.The only good thing was the sides. Overall poor quality.

site_logo

Sian-c-powe . 2017-05-28

MORE AT TripAdvisor

Quick lunch before train journey. The nasi box was very satisfying. Hot and nicely flavoured fried rice with bits of prawns and meat.

site_logo

anibani . 2017-04-15

MORE AT TripAdvisor

I've been here twice. The first time I had the regular noodles and was sorely disappointed.Second time I had the gluten free rice noodles. What a difference. One of the best meals I've ever had, served quick without pretension.

site_logo

hmm1986 . 2017-04-09

MORE AT TripAdvisor

Comimos en nuestro primer dia en Liverpool algo rápido para seguir conociendo.Fue un lugar afable y buena comida

site_logo

adaniele2005 . 2017-03-05

MORE AT TripAdvisor

My partner and I called in for a quick refuelling stop before a train journey, so we just chose a simple box of noodles each. Partner chose egg noodles in sweet chilli sauce; I went for pad thai, one of my fave noodle dishes.The positives: the food was ready quickly and served hot in generous portions. And that's about all that was good.The negatives: my rice stick noodles were overcooked, sloppy and watery; very little evidence of protein in the sauce - pad thai usually features shrimp and sometimes chicken. And veg was sparse too - a few bits of spring onion, not much else. And the sauce flavouring was poor - I couldn't taste tamarind (one of the defining ingredients of pad thai). My partner's noodles were "OK-ish" and not overcooked like mine, but again her sauce was nasty - tasted like cheap sweet chilli out of a jar - and lacking in protein and veg.Add to that the fact that the place didn't seem too clean (sticky tables...) and we both felt we'd paid too much for sub-standard street food. The profit margin must be huge... No doubt they sell lots of food to undiscerning hungry pubbers and clubbers in this lively neighbourhood, but unless you're in search of noodle-heavy but protein-light rib-stickers, it's probably best to give this place a miss.

site_logo

SpiritOfViator . 2017-02-20

MORE AT TripAdvisor

I'm sorry but I could barely even taste the sweet and sour, £6 is bad, the soup however is really nice, I wouldn't come here regularly.

site_logo

MrPleasant_exe . 2017-02-09

MORE AT TripAdvisor

wow had heard many people say that the food was nice from here so after attempting to visit our usual noodle bar (inch noodle) to find it closed for refurb thought why not give wok&go a try!well never again! staff member who served us was pleasant and friendly but that unfortunately is the only nice thing i can say. The food was disgusting and that is putting it nicely. I myself had opted for noodles which were not only under cooked but had none of sauce i requested and paid for on and were actually swimming in grease! The chicken was seriously dried out and over cooked! (even the grease could not save this) also paid 80p extra for mixed peppers and whole meal consisted of one small slice of pepper! the food was that bad I could not eat it my partner and son also attempted to eat this meal (thinking i was exaggerating) but also could not stomach it as was that bad!! My partner had opted for a rice box with chilli sauce (this did have some on) but yet again the food was full of grease and for only second time in 20 years did i witness him leave a paid for meal uneaten. Now not sure if this was just a very bad day for wok&go or a bad chef in but I will never eat her again and still livid about the money I spent on this garbage!!

site_logo

Jacqui S . 2017-01-12

MORE AT TripAdvisor

This place is so tasty for the price you can't go wrong I had the rice combo box and was completely full after eating it's in the nightlife section of liverpool which is convenient for hungry party goers. But if you just wanted some lunch or an evening meal. You can't go wrong at this place. Fresh food cooked in front of your eyes. Enjoy.

site_logo

5PR1N74 . 2017-01-04

MORE AT TripAdvisor

Il locale ha cucina a vista e permette di comporre interamente il proprio wok o di ispirarsi ad alti già fatti. La qualità è ottima anche se il locale non è particolarmente curato. Le porzioni sono davvero abbondantissime.

site_logo

TRNFNC . 2016-12-31

MORE AT TripAdvisor

Ordered a hot box which had hardly any meat in and could tell it was very cheap produce. Girlfriend ordered a pad thai which was tasteless and contained hardly any chicken, noodles were overcooked and sloppy. We also had bad stomachs the day after... The place looks like it needs a good clean!!!Do yourself a favour and walk a bit further into town and visit Ichi Noodle which is far superior.

site_logo

sean0s . 2016-12-23

MORE AT TripAdvisor

Absolutely love your food but sadly was let down tonight. It says outside and on the website that it's open until 23:00 yet when I turned up at 22:35 they said they wouldn't take anymore orders. Long loyal customer will not be returning.

site_logo

Michael T . 2016-12-23

MORE AT TripAdvisor

I have been here a few times now for a quick bite to eat in between my studies, but I have had some mixed experiences. The first time I tried it I was over the moon. I thought it tasted magnificent, and they had plenty of all the ingredients in the box. However, every time I come back I feel like it is getting worse and worse. I went there a couple of days ago and had the Pad Thai box with tofu instead of chicken. It almost did not have any vegetables in it at all. I think there should be a good balance between all the ingredients, and when I order a box I do expect it to be more than just noodles. I might come again just to see if I can get lucky with the next one, but I am slowly changing my mind about this little place.

site_logo

KMath7 . 2016-12-17

MORE AT TripAdvisor

very simple place, but the noodles are really delicious. There's really a menu with so much choice and in addition you can customize and create your own meal and the size of your box. Obviously service time compared to cooking and the confusion of the moment, normal prices for me. Fine cooking and taste. Fully satisfied and not at all heavy. I would stay here again and again

site_logo

travelman76ct . 2016-12-04

MORE AT TripAdvisor

Looking for a quick eat on bold street to takeaway. We opted for two large hot boxes. There was very little meats and the noodles were overcooked and sloppy. On a positive the flavours were there. But overall dissatisfied.

site_logo

chezablo . 2016-11-20

MORE AT TripAdvisor

When I go to this place I always get the Thai Green or Red Curry with egg noodles, and it never disappoints. This place is so satisfying to get food from. I love this place!

site_logo

Gary K . 2016-11-11

MORE AT TripAdvisor

Bought a Hot Box , took it home and warmed it up in the microwave. Delish. Definitely a hot box not too over powering though, Good value, served quickly by friendly staff.

site_logo

graham198 . 2016-10-27

MORE AT TripAdvisor

Ordered the Combo Box with Roast pork, lean beef, chicken, prawn, shrimp, broccoli, other veggies and oyster sauce. And, it was hotly served and taste good. You can actually choose whether to serve it with rice or noodle. The cashier unfortunately put noodle instead of rice but, when my food arrived for second time, it was hot and taste good! I think around GBP5.50 is the cost of the box that I ordered. Cheap!

site_logo

vinatraveler . 2016-09-25

MORE AT TripAdvisor

We popped in Wok&Go for a bite to eat as it was late and we wanted something quick. I had vegetarian Thai red curry with extra broccoli and my friend had beef with oyster sauce - both with rice. There were only two pieces of beef which were grey, chewy and tasted nasty in the beef dish and the Thai red curry was nothing like one I've tasted before, it was bland, boring and also tasted nasty. In both meals the rice was overlooked and more suitable for plastering a hole in the wall! There are better places to eat in Bold street.

site_logo

Butt F . 2016-09-03

MORE AT TripAdvisor

I enjoyed my noodles and the staff were patient when both me and the party in front of me were struggling to make up our minds. The food was lovely, although it takes a bit of time for it to come because it is cooked to order! The staff were helpful in pointing out the meal deal which I appreciated. It could have been cleaner but it was a busy lunch time on a weekend so completely understandable that there was little time to wipe down tables!It may look like you have paid a lot for a small box but there is so much food packed in that it's worth it!

site_logo

Poppy R . 2016-09-02

MORE AT TripAdvisor

Me and my partner regularly visit wok and go, in liverpool, as a quick bite to eat during a shopping trip, or before the cinema and have always enjoyed. However the past 3 times we have been have been terrible. My partner visited and ordered takeout, he walked half way back to his car before realising his noodles had no sauce and no chicken. We then visited about 2 weeks ago, ordered food, and they did the same to me, no sauce. Luckily wesat in and they were able to fix it, it was quite busy so i put it down to that. Lastly, yesterday evening we went before the cinema, as we had a bit of time to kill before the film, completely wrong order made for my boyfriend, so he didnt eat at all. They also gave him an upset stomach which disturbed the film for us. Also the staff seemed to be paying more attention to the pranks they were playing on each other than actual customer service. Most of the chefs were yawning and didnt seem to be bothered about the food. Safe to say we wont be returning.

site_logo

montannamber . 2016-08-22

MORE AT TripAdvisor

Similary restaurants in North West

restaurant_img
3.3

127 Opinions

location-icon613 West Derby Road
Asian
outdoor_seating_68163takeaway_68163delivery_68163

Ordered over 2 hours ago still not got it. Will edit if/when I get it or if I have to charge back on paypal

restaurant_img
3.5

6063 Opinions

location-icon9-11 Whitechapel
Asian
outdoor_seating_305886takeaway_305886delivery_305886

Mis compañeros y yo acabamos de terminar una sesión de remo y queríamos conseguir comida así que nos dirigimos a Jollibee y fuimos rechazados groseramente por el tipo de seguridad que trabajaba allí solo por nuestra apariencia, dijo "no necesitamos gente como tú aquí"

restaurant_img
3.0

176 Opinions

location-icon116 Breck Rd
Asian
outdoor_seating_68107takeaway_68107delivery_68107

Anfield balti… what can I say a beautiful taste from the east… if you are one of those long time patrons! If you expect fast service and cheaper food unfortunately you are going to be disappointed!! Waiting is an absolute virtue!! Wait your turn, collect your order!! I remember the best experience from this establishment! Many people who have had a similar experience know this was a great luxury!! Thank you for your service!!

restaurant_img
3.7

309 Opinions

location-icon38 Townsend Lane
Asian
outdoor_seating_128029takeaway_128029delivery_128029

I really like the kadahi paneer and garlic naan of Jasmine

restaurant_img
2.9

63 Opinions

location-icon12 Hardman Street
Asian
outdoor_seating_333611takeaway_333611delivery_333611

Will give a 5 star if they add a selection for dessert and free lettuce. Please make your other meat thin having a hard time to grill it because of the slice. The service was great the two ladies was lovely and so accomodating.