GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 295 opinions finded in 1 websites

site_photo3

Nº 415 in 1596 in Wiltshire

Nº 86 of 307 Other cuisines in Wiltshire

CUSTOMERS TALK ABOUT DISHES WITH..coffeechickenpaysaladfishcakemerecookedmustroasteggs
Score
OpinionsNoteTripAdvisor2954.5

comment_iconOpinions

Just off the A303 this restaurant is part of a new factory that makes brushes. There is a museum and shop and lovely restaurant offering a good range of meals. Somewhere different with easy access and parking. Well worth a try.

site_logo

Stlo01 . 2023-11-21

MORE AT TripAdvisor

Most expensive burger and cup of tea I’ve ever had. 2 teas 1 chicken burger , and 1 veggie burger £40. This cafe is without atmosphere, the seating uncomfortable and the menu limited Probably the most expensive food i Mere pound for pound. I can also add the brushes are expensive and mediocre , Avoid this cafe, the services are cheaper, Morrisons in Wincanton is 5 minutes down the A303.

site_logo

Tony C . 2023-10-25

MORE AT TripAdvisor

Lovely cafe serving really good food, great for a stop off when on holiday. Interesting museum and shop selling their too quality brushes

site_logo

Y9259BVcarolp . 2023-10-07

MORE AT TripAdvisor

Went for coffee and ice cream. The team member who served me was lovely, the service was prompt, the ice cream and coffee delicious and she even brought a bowl of water for me dog. We sat outside under an umbrella. It was very pleasant.

site_logo

Gillian D . 2023-09-14

MORE AT TripAdvisor

So good I felt compelled to leave a review. If you’re travelling to the south west I’m yet to find a better spot to stop for breakfast, outstanding.

site_logo

jamesbK6833ZW . 2023-08-25

MORE AT TripAdvisor

The food was amazing and really fresh and cheap. the attention to detail is amazing. the brushes are amazing 10/10 would recommend

site_logo

Daydream05143969596 . 2023-08-25

MORE AT TripAdvisor

Disappointing for me! It seems I ordered the duff lunch… Cheese soufflé… which was more a 1cm deep cheesy puddle… followed by Caesar salad; rubbery chicken bits (not chicken breast) and a bottle sauce… in fresh lettuce… The Scotch egg my friend had looked nice though.

site_logo

Nichola M . 2023-08-21

MORE AT TripAdvisor

Found this place by chance looking for a stop on the way back from Cornwall. Modern and attractive restaurant attached to a factory in an industrial area of Mere. First observation was that the men's toilets paper towel dispenser was empty and women's toilets were without toilet rolls. This is just not acceptable. Ordered the breakfast from the all day menu but told it was not available so went for Charlies BLTs and Caesar salad. All were disappointing but particularly the BLT. Made from toasted rye bread so overtoasted you had to break them as you couldn't bite or cut them. Service was slow and when asked how everything had been I said it was awful but this drew no response at all. Paid and left never to return. A shame as so much potential if they just got the basics right.

site_logo

dicky1945 . 2023-08-20

MORE AT TripAdvisor

We visited Hillbrush on the way down to Cornwall and our return from our holiday. On both occasions the staff were really friendly and professional and the food was fresh and generous. On the way down we stopped for breakfast and while the adult menu was services prices, it was all fresh and very good quality and the kids menu was incredibly good value. On the return we stopped for lunch and my 5 year old was sick as we entered. There was no eye rolling from any of the staff and they immediately helped sort it out quickly and again in a very friendly and professional manner. The lunches were delicious, particularly the trout roll. The museum section was random but really interesting and engaging for my 5 and 7 year old. The staff are a credit to the company, it could be very easy for them to ‘call it on’ but they seem keen to ensure customers have a great experience.

site_logo

175piersc . 2023-08-08

MORE AT TripAdvisor

A great place to stop and enjoy great locally sourced food all made in-house. The food options are great and dietary requirements were taken into consideration. Nice to look around the museum that is on-site, and understand the history of the business and how it came to fruition. The shop stocks a great selection of products, even some that are manufactured on-site in the factory!

site_logo

Fearless_Jord . 2023-08-03

MORE AT TripAdvisor

A disappointing experience this time - as I had raved to friends about the perfect visit last time! The place was chilly, the coffee only warm and the poached eggs not runny. We had been really looking forward to going back as I had described it as having the best poached eggs/avocado/toast (and hot coffee) in the area! At £13.50 for a modest portion I feel you can only justify this if that standard is maintained? I don’t think we’ll be coming back sadly - there are warmer, less expensive places with a better atmosphere.

site_logo

tinamobsbym . 2023-07-25

MORE AT TripAdvisor

Just enjoyed great coffee & hot chocolate in a pleasant restaurant. Food looked good but we were only there for a drink. Don’t be put off by the industrial location and enjoy a break just off the A36.

site_logo

Camper40818401711 . 2023-07-14

MORE AT TripAdvisor

Wonderful stop off main road from Cornwall to Winchester. Very interesting exhibition, beautiful food, impeccable toilets and helpful friendly staff. So much better than a service station and not too expensive.

site_logo

Discerninglady2 . 2023-07-05

MORE AT TripAdvisor

Good spot for a stop off.. Wouldn't have known it was there unless we had heeded the makeshift sign to take the turning.. So glad we did.. An oasis on the A303.. Dont miss it!

site_logo

rosb311 . 2023-06-25

MORE AT TripAdvisor

£4.50 for a soya latte seems a bit steep to me! They charged me an extra £1 for soya milk! They never used they only started this recently. My husband and I go fairly frequently for coffee and cake but will think twice now. I think this will annoy a lot of customers. I can't have lactose so I'm being penalised for having an alternative.

site_logo

Dennis R . 2023-05-31

MORE AT TripAdvisor

Excellent flapjack however charged an additional £1 for oat milk in coffee - excessive just pure profiteering

site_logo

Ken H . 2023-05-26

MORE AT TripAdvisor

What a lovely place to stop on the way to the West Country. Easy to find and park. Don’t be put off by thinking you are entering an industrial premises. The service was friendly and professional. Food and facilities fab. This will be our go...

site_logo

steveg7pmg . 2023-05-20

MORE AT TripAdvisor

Previous visits were very pleasant. Today's was very disappointing. Staff were very pleasant, but apparently 'the kitchen' don't understand customer satisfaction.

site_logo

DavidW6905 . 2023-05-19

MORE AT TripAdvisor

What a lovely, and unexpected surprise! Stopped whilst driving cross country on the A303. The restaurant is in the green and leafy factory grounds and it has lovely gift shop, clean and tidy toilets. Staff were very efficient and food arrived quickly. Good quality food...

site_logo

Curious14165394225 . 2023-05-19

MORE AT TripAdvisor

Stopped off here on the way from London to Sidmouth. Had looked up online for somewhere to stop halfway. Really glad we picked this place. Lovely space, very clean & comfortable, service very pleasant and food/drink delicious. Definitely recommend.

site_logo

BabeRainbow59 . 2023-05-08

MORE AT TripAdvisor

We stopped here for breakfast en route to Brixham for breakfast and was so good we stopped on the way home. Tucked off the A303 at Mere. Rather a bizarre building and not where you would expect to find a place doing food. We had...

site_logo

Gossipmonkey . 2023-05-07

MORE AT TripAdvisor

This visitor centre is on the same site as the factory, it houses a shop, brush museum and a wonderful cafe/restaurant. There is plenty of parking in front of the centre. We stopped for breakfast, which was very, very good. The staff are friendly and...

site_logo

A3072SFdavidb . 2023-05-05

MORE AT TripAdvisor

We had a decent breakfast here. Nothing special - pancakes which were identical to the 4 packs I buy in M&S with a good bit of streaky bacon served promptly at a price which seemed slightly steep. The venue is a bit bizarre. A third...

site_logo

659darrenl . 2023-05-01

MORE AT TripAdvisor

Enjoy the Brush factory regularly, but very dissatisfied with the size of the scones we received today.

site_logo

MT_Tonto . 2023-03-10

MORE AT TripAdvisor

Cannot fault the service and standard of food As of two weeks ago dogs are now allowed in the restaurant they are in the process of updating their website to reflect this

site_logo

Wurzel78 . 2023-02-28

MORE AT TripAdvisor

Stopped entoute down the 303 as I suspect most of the trade did. Nice venue, good food, friendly service and a great alternative to others on the road but be aware you're paying for the priveledge. £35 for two sandwiches, two soft drinks and one...

site_logo

cannonfodder_12 . 2023-02-25

MORE AT TripAdvisor

Would thoroughly recommend eating here. The food was absolutely delicious . We both had the Beef blade which was cooked perfectly. lovely, tender and full of Flavour. The deserts were equally delicious. The staff were also friendly and accommodating. Very much looking forward to our...

site_logo

Loupeg1 . 2023-02-24

MORE AT TripAdvisor

A hidden gem! I’ve now eaten at Visit Hillbrush a few times, and it’s consistently good. The menu is varied, with high quality produce. Situated close to the A303 it’s a lovely place to break up a journey. There’s also a little brush museum and...

site_logo

CarrieBradshaw3 . 2023-02-04

MORE AT TripAdvisor

Such great fresh food. Beautifully presented in a clean and unique environment. Not the cheapest but well worth it,

site_logo

annyth . 2023-01-17

MORE AT TripAdvisor

We stopped at Hillbrush today on our journey from Cornwall to London , something we do regularly. We have always had a pleasant experience with good food but today was extraordinary. We arrived on the dot of 11.30 am and the conversation with the waitress...

site_logo

janepD4596EO . 2022-12-22

MORE AT TripAdvisor

An unexpected gem. Looks unpromising, a manufacturing site but well worth a visit. Restaurant very good, a bit pricey but really good quality and quantity. Interesting, casual, industrial space but really cosy and relaxed. Interesting musuem items, machinery and interpretation of materials, processes and 100year...

site_logo

dianesK2533KM . 2022-12-18

MORE AT TripAdvisor

We organised a reunion lunch as a group of ladies and chose Visit Hillbrush, because we are friends of Visit Hillbrush and it had been recommended. Whoever is managing Visit Hillbrush needs to pay attention to actually managing the restaurant. If you need a lesson...

site_logo

FreddieAndFanny . 2022-11-29

MORE AT TripAdvisor

The staff and venue are a delight but even though the food is reasonable the prices make one ultra critical and it falls into the not good value for money bracket. If you are feeling flush then try it, I still do!

site_logo

J7902GHrs . 2022-09-14

MORE AT TripAdvisor

We arrived at 0900 just as the restaurant was opening and received a very warm welcome. The new menu for breakfast did not disappoint. Wilful mushrooms and poached eggs on sourdough perfectly cooked and presented. And egg breakfast bun with vege sausage and potato waffle,...

site_logo

beth c . 2022-09-13

MORE AT TripAdvisor

Booked the day before for my birthday breakfast and they replied to the email so quickly and booked six of us in. Food was amazing the pancakes and hash browns were the best i’ve had. Amazing staff too, our waitresses (Holly, Lerryn and Krystal) were...

site_logo

lanaavers . 2022-08-11

MORE AT TripAdvisor

Our holiday began (very unexpectedly) 3 hours before it was due to because of the outstanding food, service and menu. What a brilliant place to stop off on the A303.

site_logo

gusn2020 . 2022-08-10

MORE AT TripAdvisor

We were advised to pop into Hillbrush for lunch. Friendly, helpful staff, with a full varied menu. Situated in a broom factory, with interesting nick nacs on the walls and surrounds. We sat next to an old broom machine. Our food came fast, was very...

site_logo

Suki V . 2022-08-09

MORE AT TripAdvisor

We were aware before our visit that there would be sandwiches, coffee and cake only (due to the chef being on holiday) but this wasn't a problem as we only wanted coffee and cake (it being about 11.15)! Entering through the shop a sign asked...

site_logo

Pat_in_Fareham . 2022-06-27

MORE AT TripAdvisor

As a regular driver down the A303 I wish I had found out about this earlier. It’s the perfect pit stop if you are heading down to the South West (or up to London). We visited on a quiet Saturday morning and initially were surprised...

site_logo

cltboy . 2022-06-12

MORE AT TripAdvisor

We visited Hillbrush on Sunday morning 29th May 2022 and there wasn’t many cars in the large car park. We waited for around 5 minutes for somebody to come and give us menus then show us to a table. A waitress then came over and...

site_logo

773lc . 2022-06-01

MORE AT TripAdvisor

This is a well placed premises near main roads with a large free car park and electric car charging facilities. The shop is interesting with high value quality items. The restuarant is family managed, with excellent efficient and friendly staff. The menu is comprehensive and...

site_logo

5RHM . 2022-05-19

MORE AT TripAdvisor

We visited this gem of a place again this time with some friends hoping it was good as the last time. The food is top class with great service in a light and airy dining space. We definitely recommend this place.

site_logo

220jimmys . 2022-05-05

MORE AT TripAdvisor

It’s unusual to find a restaurant which offers, and provides, an interesting and educational environment, crisp, pleasant service and good food. Hillbrush does all this. This manufacturer of brushes manages to make product, show how it is made and cater to an excellent standard all...

site_logo

Rusboy . 2022-05-04

MORE AT TripAdvisor

What a fab start to our holiday! Great little book Sawdays from my friend for Christmas had this place in it so we stopped on our way to Cornwall. It’s not a cheap lunch but you pay for what you get. Delicious crab bun worth...

site_logo

Lesley E . 2022-04-21

MORE AT TripAdvisor

Driven by this restaurant many times but decided to stop for lunch yesterday (15/12/21 ) We waited for over 15 minutes to be seated in an almost empty restaurant.I started to get a bit agitated waiting so long and being disabled and ignored while the...

site_logo

christopher s . 2021-12-15

MORE AT TripAdvisor

Was searching on the internet for somewhere to stop for breakfast close to the A303 and Hillbrush came up. A really quirky set up on the side of a brush factory - the staff were excellent and the full English breakfast was top quality and...

site_logo

Matt T . 2021-12-07

MORE AT TripAdvisor

On the way back from our holiday we stopped for brunch, we sat outside as we had our dogs with us. Great little spot, tasty eggs benedict and coffee. We also took cake home with us for the rest of the journey. Staff were friendly...

site_logo

369talh . 2021-10-28

MORE AT TripAdvisor

We visited as saw the signs on roadside. First impressions were not great as we waited a while to be seated. The menu had one vegetarian option but was told by the waitress that this was not available and there were no chips today? My...

site_logo

Phil W . 2021-10-23

MORE AT TripAdvisor

It's a shame, as we have had lovely lunches here. The breakfast was OK, but just OK. I love this place, especially the lunches. I am disappointed to have to write a mediocre review.

site_logo

stevehX7805OT . 2021-10-08

MORE AT TripAdvisor

Very slow in serving lemon drizzle cake very dry did not have no taste off lemon raspberry Bakewell cake was as so very dry not worth the money paid for it only good thing was the tea

site_logo

lala40 . 2021-09-30

MORE AT TripAdvisor

The service was slow and the waitresses incompetent. We didn’t get served all our coffees. We had to remind the waiting staff to bring us sugar and cutlery more than once and the wait for food was long. When our food eventually came out we...

site_logo

Kebabi . 2021-08-31

MORE AT TripAdvisor

On arrival you drive onto an industrial site, yes they make brushes! Then when you pull up at the front of the factory you come across the entrance to the brush shop, then into a spacious eating area. First impressions… large and very clean. Now...

site_logo

Geoff K . 2021-08-09

MORE AT TripAdvisor

Lovely Sunday Roast with family enjoyed now they have reopened. Service was friendly and not rushed, food was tasty and well presented and desserts were defo worth trying - thank you everyone.

site_logo

eaO9486SG . 2021-08-02

MORE AT TripAdvisor

Fabulous venue and love the shop. The cakes behind the counter looked amazing! Rather disappointed with the lunch menu and the prices had hiked since our last visit. Our crab starter, 4 small mouthfuls at £13.50 was we felt excessive. Disappointing.

site_logo

Sooziech . 2021-07-30

MORE AT TripAdvisor

Honestly we went past Hillbrush last Friday and popped in for some tea and cake - what can I say it like eating a brush - they may look inviting, but they were dry beyond belief, so dry that it literally crumbled like dust -...

site_logo

FIONA M . 2021-06-24

MORE AT TripAdvisor

A chance find on our drive down to Plymouth. It was a warm day so we found a shady table on the long terrace. My roast lamb was delicious from first bite and my husband said his lentil roast was too. We both had a...

site_logo

Diana M . 2021-06-17

MORE AT TripAdvisor

Even though this is practically on our doorstep, we hadn’t thought to visit for food. Our mistake! Easy booking online, COVID protocols all in place, friendly staff and a stunning venue. We were there on a Sunday so had the Sunday lunch. My husband had...

site_logo

Sara E . 2021-06-16

MORE AT TripAdvisor

Lovely to be able to visit again after lockdown. Great service, great selection. The coffee with ice was super and just the right strength, the cold drinks were really cold and refreshing, the cakes were good. We will be back.

site_logo

perle369 . 2021-06-15

MORE AT TripAdvisor

Every time we drive from Teddington in Middlesex to Penzance to see my Mum we always stop for brunch at Hillbrush even though it's not quite halfway! Sadly due to lock downs we have not been in over 10 months. Hillbrush finally reopened to customers...

site_logo

Emma D . 2021-05-28

MORE AT TripAdvisor

We had an amazing breakfast the other weekend. Being a vegan can be difficult to eat out, especially breakfast. Hillbrush did not let us down. Both the meat and vegan versions were excellent. Great choices for everyone. Coffee was very good too. Great taste and...

site_logo

guliana53 . 2020-12-22

MORE AT TripAdvisor

What a treat to be able to Visit Hillbrush again after such a long period of lock-down. Once it was re-opened, we lost no time indulging ourselves with a lunch-time meal. The welcome from the staff was as warm as ever, and the manageress, who seemed to be everywhere at once, took the time to come and say hello and to ask if we were comfortable. To make sure there was plenty of space between tables, they have moved into the museum area so we felt perfectly 'socially distanced' from the other customers. There has been a change of menu, and it's possible to juggle the choice to suit the appetite, with a selection of starters, mains and sweets - and the cakes - oh my - the cakes! So, so tempting!! We're already looking forward to our next visit. Well done Hillbrush and all the staff. So very pleased you have weathered the Covid storm and have come back with all guns blazing.

site_logo

SueB925 . 2020-12-04

MORE AT TripAdvisor

It was lovely to go back to Hillbrush again to eat and buy some lovely Christmas gifts. Menu was sufficient for us to all choose something we liked, good value for money, good portions and cooked to perfection. Lovely local produce so also supporting local businesses which is good. I did not have room for a piece of the lovely cakes that were on show so we will have to go back again. The staff were very attentive and the Manager Laura was ensuring the establishment was kept covid secure and the staff took it in turns to thoroughly wipe the tables, chairs, condiments, door handles, card machine and anything the public had touched. Tables spaced for social distancing and hand gel available for us to use. We were so pleased to be able to go back as the establishment is run exceptionally well by the Manager with attention to customer service and safety a priority. We will be returning again soon. Welcom Back "Visit Hillbrush".

site_logo

Gambia19 . 2020-12-04

MORE AT TripAdvisor

Having been to the restaurant on many occasions it never fails to excel.the food is first class. the service is excellent. the whole experience is always outstanding.

site_logo

PAULWHITE668 . 2020-07-21

MORE AT TripAdvisor

Over full lockdown all I could do was drool over the memories of Visit Hill Brush.During semi lockdown I began to drive past once a week, wondering, hoping, longing for those gates to open like the lips of a dusky maiden lusting over her first taste of a forbidden fruit.Now that we have moved past semi I am finding it hard, really hard to know that I still have another few weeks to wait, but wait I shall.I am so looking forward to all the hugs and kisses - oh, whoops, that’s August 2021 before we can hug and kiss, so I guess a wink, a nod, a smile and some good food will have to suffice for the next 12 months.Good luck Laura and her gang with the reopening.All the bestDerrick

site_logo

IXI971 . 2020-07-08

MORE AT TripAdvisor

I am lucky to live not too far from Hillbrush so it's my go to place to meet up with friends and relatives who are travelling eastwards on the A303. The cooked breakfasts are substantial to say the least ! I meet up here quite often for coffee and diet busting cakes. The service and food are always excellent. Really missed it during lockdown.

site_logo

brownbear250 . 2020-07-08

MORE AT TripAdvisor

We had been promising a family get together but never managed to get round to it as we could never find a suitable venue. Hillbrush was the ideal location for everyone. The staff were very attentive and coped extremely well with a group of 12. My wife & I had visited before for lunch and had never been disappointed with our meals. However, we weren't sure whether service and meals would be compromised due to the size of our group. Our fears were unfounded! The meals were served in record time, without fuss and excellent quality. Thoroughly recommended.

site_logo

X6831EPalanb . 2020-07-08

MORE AT TripAdvisor

My husband and I visited on a very wet day and enjoyed a late breakfast, visit to the museum and shop of course!! Delicious food and a lovely setting - the staff are very friendly and helpful too. A relaxed atmosphere and fantastic toilets too. A delightful experience and can't wait to be back when it is safe to do so.Husband bought a yard brush which is his pride and joy!!

site_logo

Z7770QBjacquelines . 2020-07-08

MORE AT TripAdvisor

Excellent food and service. We really enjoyed the Monk Fish Curry - can't wait to come back for more!

site_logo

Sandra E . 2020-07-08

MORE AT TripAdvisor

The family have been to Visit Hillbrush on a number of occasions, for breakfast, lunch and their Friday evening themed nights. The food is always superb and the front of house staff are always polite, friendly and attentive.

site_logo

T5171OXdavidh . 2020-07-08

MORE AT TripAdvisor

Break in a long journey always seems to end up here!!! With the obvious effects of Coronavirus the restaurant was virtually empty - very unusual!!! Still serving up excellent, stomach filling top quality food served up quickly and efficiently. On the CoVid19 front, during the hour spent there we witnessed the staff wiping the customer touched surfaces, loo doors, tables, till area, card machine, brlliant attention to hygiene.Now that they have been forced to close they are offering a take away and delivery service and I wish them all the best in this venture in order to try and keep some of the staff employed.

site_logo

tartancustard . 2020-03-18

MORE AT TripAdvisor

Popped into the hillbrush restaurant today for a coffee and decided we might try the lunch menu. Have been in this place for a drink a few weeks ago and thought it looked quite a tempting menu.We did sit at a low coffee table but when we decided to eat, we asked the waitress if we could move to a dining table. The response was not very helpful and we were frowned upon for requesting this, as we were told the tables had been booked but nobody was sat at one of the tables for over half an hour and it was still unoccupied when we left. I suppose the service is so slow, they couldn't chance letting us have the table. We agreed to stay put but had to ask for a tray for my elderly mother. They did come over half way through, to say we could have a table now, but it would have been too difficult as my mother is an invalid.We could have overlooked all this if the meal had been at all edible. It arrived and I could not decipher what was thrown on that cold plate. The roasted potatoes had been burnt completely and the veg consisted of a shrivelled up black chartenay carrot and a disgusting stem of soggy broccoli. I couldn't allow my husband to consume such slop and demanded it be exchanged. The waitress brought the plate back with fresh roast potatoes but the soggy green slop and cremated carrot.... think that's what it was ! Remained. Such a low quality canteen style meal that I would not feed my dogs. The staff are quite unapproachable and the person that walks around overseeing the waiting staff, carries are aire of grandeur but really cannot organise and a bun fight in a bakery.All in all I would never recommend any one to visit. They should stick to brushes and leave the restaurant business to the professionals

site_logo

Dexterdodoo . 2020-03-08

MORE AT TripAdvisor

My wife and I tried Hillbrush for the first time a few weeks ago and were looking forward to having a cuppa and a quiet chat. The welcome was fine but the service was tardy to say the least. We had to wait 10 mins for our order for two breakfast teas to be taken and another 20 minutes before they arrived. We couldn't have been more visible. The restaurant wasn't that busy and there appeared to be ample staff on duty. Eventually I asked how long it would be before we got our drinks and was told that all orders are placed in sequence. How long does it take to put a teabag in a pot with boiling water? Anyway, I gave them the benefit of the doubt and went back again today. I was seated quickly and given a menu, which was promising, but waited nearly 10 minutes without any acknowledgement that I was there. The invisible man again. People around me were receiving their food orders and their meals looked very tasty. I tried to get attention from one of the waitresses but without luck, so just gave up and left. No one acknowledged that I was leaving - invisible again. Sorry, I won't go back a third time. Such a shame as it looks most inviting.

site_logo

Soberty1 . 2020-03-06

MORE AT TripAdvisor

A Super Sunday Lunch! The food is cooked and superbly presented. Do try the sticky toffee pudding! Nothing to fault here.

site_logo

rolandm600 . 2020-03-05

MORE AT TripAdvisor

There is so much to like about Hillbrush; lovely site, neat tidy, plenty of parking; it's a treat to walk into the place; I've visited a few times as has my pal;I'll cut to the chase - what lets this place down badly is the service; this is something that comes up time and again in other reviews on TripAdvisor.On arrival, there were two waitresses on duty; lovely girls, well intentioned, but absolutely directionless.It took 30 minutes from arrival to getting drinks.Things improved when two other members of staff appeared.It wasn't so much a case of under-staffed but rather, no focus, no direction; industriously clearing empty tables whilst not noticing customers requiring service; no idea what the soup of the day was.Food was good quality - but luke warm - sat around? Service issue ?I like the place, I really do, but they need to sharpen up their act.They may be doing well, but they could be doing great.

site_logo

allanm09 . 2020-02-15

MORE AT TripAdvisor

First visit whilst on a bike ride. Nice place with a good veggie breakfast and coffee. Will be back soon.

site_logo

Damo_M_G . 2020-02-05

MORE AT TripAdvisor

Couldn't fault my 3 course meal, so tasty and good value for money. Friendly and fast service. Thanks for a great evening.

site_logo

R8765ZTjuliah . 2020-02-01

MORE AT TripAdvisor

We were delighted with a well crafted menu and beautifully cooked food at Visit Hillbrush’s themed Friday night. Super value at just £17.99 for 3 courses and were attentively looked after by the staff on duty. Even managed to speak with the head chef who gave some insight into the freshly sourced monkfish and soft shelled crab starter. It really was delicious! Definitely a healthy and amazing value for money option on Friday nights - my 12 and 10 y/o girls loved it!... and I believe they will be offering takeaways soon. Bonus!

site_logo

dpchages . 2020-02-01

MORE AT TripAdvisor

Called in here today for coffee ...what a fabulous place...great for coffee and lunch ..warm friendly atmosphere...and great experience looking at the history of Hillbrush...super place for every occasion...

site_logo

susan194 . 2020-01-29

MORE AT TripAdvisor

We'd previously heard good things about eating here. So after a Sunday morning walk around Stour Head we decided to pop in for a coffee and a bite to eat. We were greeted with "have you booked a table". Didn't know we had to - it's a brush factory. So our answer was no. To girl runs off to check if we can have a table. Comes back and says yes we can seat you, but we need the table back by 1 as it's reserved (there were at least 40 empty seats that we counted). It was 11.35 when we arrive. So we sat down and waited for someone to take our order. I ordered a gluten free breakfast and a coffee, my partner had a normal breakfast but asked for no mushrooms or hogs pudding. And a coffee. It was another 20 minutes before we were served coffees. Yet the staff were milling around not doing much at the coffee bar. When the 2 breakfasts finally came out at 12.15 we were very underwhelmed. My partners breakfast had mushrooms and hogs pudding on it despite asking not to have them, the toast was dry with no butter provided and the whole meal was luke warm at best. The gluten free one was pretty much the same, no butter for the toast, there were no gluten free alternatives offered for the sausages and hogs pudding. You'd have thought they'd at least offered extra bacon. Don't state on the menu that gluten free alternatives are available when all you're really doing is taking things off the plate! And again what was there was luke warm. So for £9.75 a breakfast, I'd say we were really disappointed, no only by the quality of the food, but also by the staff. Our first visit will also be our last.

site_logo

P9531CNlauram . 2020-01-26

MORE AT TripAdvisor

It was OKAY. Nothing to complain or rush back for. It’s a nice smart place but akin to a good garden centre rather than a restaurant.

site_logo

EijaMH . 2020-01-26

MORE AT TripAdvisor

We arranged to meet family ( half way point!), we had a lovely lunch, especially the sea food platters. The food was freshly made and the service was excellent. Lovely little shop attached to the restaurant or granddaughter loved the little sized brooms! Will definitely drop in again when passing.

site_logo

DevonDawn . 2020-01-25

MORE AT TripAdvisor

This place is well worth getting off the A303 going to or returning from Devon/Cornwall, say. It’s not even a ‘detour’, just a couple of minutes off the route.

site_logo

Michael J . 2020-01-19

MORE AT TripAdvisor

Visited for lunch on 2nd January 2020

site_logo

michael_kingdon . 2020-01-08

MORE AT TripAdvisor

Great Cafe Stylish gift shop. Recommended by family member, good breakfast menu, variety of lovely cakes too at reasonable prices, coffee and service great too. Decor very modern and very clean. Additional section to history of Hillbrush and the tools/machinery used to make. Will definitely go again,

site_logo

gfssa . 2020-01-03

MORE AT TripAdvisor

After another Stourhead visit, where we could not get a meal as it was so busy, we went on to Hillbrush. We had been a few weeks earlier and experienced very long delays in getting a simple snack. On arrival we asked if there was a delay, but she assured us they were busy but meals were on time. We told her about our previous experience and she seemed to do everything to make up for it. Our drinks and meals came out in very good time. As previously they were tasty and well presented. Always give a place a second chance! We will be back...

site_logo

BandD59 . 2019-12-29

MORE AT TripAdvisor

Surprisingly good food and venue for a brush factory! Clearly a lot of thought has gone into the eatery at Visit Hill Brush and the kitchen staff hold high standards.

site_logo

Corfusoon . 2019-12-15

MORE AT TripAdvisor

lovely food and location, but be careful when the wind is blowing in the wrong direction. smelly cows are not conducive with sunday lunch

site_logo

Carol G . 2019-12-01

MORE AT TripAdvisor

We stopped here on our way back up the A303 for brunch. 2 minute drive off the main road and the best cooked breakfast we have had for a long time!

site_logo

MrsUbiquitous . 2019-11-24

MORE AT TripAdvisor

Fantastic visit after my good took me to RDA. The coffee was great with a slice of their rich fruit cake.

site_logo

Sue W . 2019-11-05

MORE AT TripAdvisor

Visited hillbrush on the way home from Devon with the family. We didn’t know what to expect but the food was amazing. Between us we had a buttermilk chicken, a seafood platter, fish and chips and a mushroom tagliatelle! Service was good and a great selection of drinks. A super find and we will definitely use again.

site_logo

220jimmys . 2019-10-22

MORE AT TripAdvisor

It was my 7th visit Sunday lunch with my Nan. Even though it was very busy we were greeted with a smile, great service and delicious food. I have visited in big groups of friends, colleagues and family and every time experienced great service and amazing food. It’s good to have somewhere with a great atmosphere locally and consistent great customer journey. Thank you Hillbrush.

site_logo

Gemma S . 2019-10-21

MORE AT TripAdvisor

Excellent choice of food and drink. A regular resting place on our way to Somerset. Back next month!

site_logo

Ernie S . 2019-10-20

MORE AT TripAdvisor

I only live a mile away and have been here several times. Service has always been on the tardy side of acceptable but .......

site_logo

geoffshilt . 2019-10-14

MORE AT TripAdvisor

Had an excellent lunch with a colleague here. She chose fish & chips which she stated was outstanding. I had the delicious soup of the day (spinach, asparagus & leek) with a toasted ciabatta.

site_logo

westcountrybird . 2019-10-03

MORE AT TripAdvisor

Probably the best eggs benedict I’ve ever tasted and my husband said his full English was amazing. Loved the museum, especially as I had ancestors who worked in the original factory in Mere. Will be back when down this way.

site_logo

sue h . 2019-09-29

MORE AT TripAdvisor

We had a fantastic breakfast here on our annual trip to Exeter. Who would have thought a brush factory would-be the place for that?

site_logo

Sarah A . 2019-09-21

MORE AT TripAdvisor

Birthday treat to Mexican theme night. Brilliant! Lovely staff, great venue, amazing food. We had loaded nachos and slow cooked duck taco, followed by rib-eye steak and chicken & mango quesadilla, rounded off with lemon & lime cheesecake and churros with warm chocolate sauce. Absolutely delicious, bursting with flavours. Looking fwd to the German night next month, but be sure to book

site_logo

Jaynand . 2019-09-20

MORE AT TripAdvisor

This was our second visit, we live in Huish Episcopi and pass by quite often, the new building is very spacious with its shop, museum and restaurant, it has an airy feel with plenty of room to eat.

site_logo

gregoryc866 . 2019-09-15

MORE AT TripAdvisor

Was erg mooi, maar erg duur ook, was een kleine collectie van goederen. Het ging voornamelijk over diverse borstels, die daar ook geproduceerd worden. Door de website dachten wij dat er meer te zien was.

site_logo

Marietje52 . 2019-09-12

MORE AT TripAdvisor

All of the positive comments from previous reviewers are fully justified. The A303 always seems such a long route - but this made a great stopping point on both legs f the journey - breakfast on the westward leg and then afternoon tea on the return. Lovely food, coffee and tea (and cakes). Full English is £9 - a little pricy. But it was very nice and worth the money. Clean and tidy (and of course don’t forget the chance to look around the brush museum!). And less than a minute from the A303 junction.

site_logo

robinwB4976HX . 2019-08-25

MORE AT TripAdvisor

Similary restaurants in South West

restaurant_img
4.5

27 Opinions

location-iconThe Packway,Larkhill,
Other cuisines
outdoor_seating_138009takeaway_138009delivery_138009

Lovely cafe with large selection of cakes, sandwiches and decent coffee. we stopped here to refuel whilst riding King Alfred's Way. Friendly staff, clean toilets, sensible Covid precautions and next door to a little Nisa shop for anything else you need

restaurant_img
4.5

385 Opinions

location-iconSemington Road
Other cuisines
outdoor_seating_214590takeaway_214590delivery_214590

Again the food is excellent and the service 1st class 👌. Thank you the selection of drinks would suit all flavours and the price are very reasonable.

restaurant_img
4.5

49 Opinions

location-icon64 Frome Rd
Other cuisines
outdoor_seating_155521takeaway_155521delivery_155521

Sadly, a place with an anchor, but no hope.

restaurant_img
4.5

40 Opinions

location-iconCollingbourne Road
Other cuisines
outdoor_seating_202987takeaway_202987delivery_202987

Stopped on a trip from Cinderford to Romsey , have driven past many times but never had time to stop, husband and son had ‘small ‘ breakfast and I had toast and jam, the breakfast was a great size, quickly served and tasted great, really good value for money . Toilets and rest of premises are really clean and can’t wait to visit again

restaurant_img
4.5

194 Opinions

location-iconHigh Street Potterne Potterne
Other cuisines
outdoor_seating_306078takeaway_306078delivery_306078

Went out for a family dinner. Very disappointed with quality of food. Worst meal we have had in ages. When Waitress asked why one plate of food went uneaten..we said it was swimming in oil and inedible. Her response was "I asked you earlier if food was ok and you didn't complain then". Not correct response. She didn't even offer to take price of uneaten meal off the bill. Then she added a service charge which we didn't pay. Birthday meal was ruined. Certainly won't be going back.