GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 1.044 opinions finded in 2 websites

site_photo4

Nº 2054 in 7028 in City of London, Westminster

Nº 19 of 32 Vietnamese in City of London, Westminster

CUSTOMERS TALK ABOUT DISHES WITH..pepperheartbrothsquidfishricefriedcreamsaladchickenprawnnoodlescoffeecookedporksoupchillibun

comment_iconOpinions

Excellent meals, fast service, and a relaxing atmosphere. Perfect for any occasion!

site_logo

Thomas Allen . 2024-09-10

MORE AT Google

Next door (practically) to Theatre Royal, Haymarket. Food tasty and generous portions. Reasonably priced too.

site_logo

Queen D . 2024-08-06

MORE AT Google

Fresh, quick Asian in the middle of theatre land !

site_logo

Samanthaa Woody . 2024-07-26

MORE AT Google

We came to vietcafe primarily due to its location next to the theatre. The service was friendly and quick, with food also coming out quickly, which was exactly what we needed pre theatre. The rice paper spring rolls were tasty, and the spicy pork mince packed a lot of flavour. But, several of the other dishes were either bland or mediocre when compared to other similar food we've had elsewhere. All in all, it served the function for a quick meal before the theatre, but would not go back her just for the food.

site_logo

Pavan Mason . 2024-07-24

MORE AT Google

Ok vietfood for the prices, but the food was a bit tasteless and the service was nice. We had the fried noodles with beef.

site_logo

Johanne L. Knudsen . 2024-07-17

MORE AT Google

It was okay. The pho tasted good with a nice broth, however the noodles were all broken into small pieces. A bit expensive for what you get especially as they add on a service charge

site_logo

Luke . 2024-06-28

MORE AT Google

Passed by this place for a quiet bite before the musical at the majesty’s theatre. Poor service and attitude. Food is acceptable.

site_logo

Angel Huang . 2024-06-08

MORE AT Google

Came there at 4:20 pm from the other part of the city to have some food, and found out place was closed… even tho google was showing place is open… Apparently they have 1 hr break from 4to5 😕

site_logo

Assylkhan Aitmagambetov . 2024-06-08

MORE AT Google

Love this little restaurant for a quick bite before an evening out. Please keep your prices friendly like that. ❤️

site_logo

Francois Souyri . 2024-06-07

MORE AT Google

Good food, especially lemongrass chicken. one issue was a dirty bathroom

site_logo

Evgeniy Klebanov . 2024-05-18

MORE AT Google

Very tasty!! Spring rolls are really refined. Sauce could have a little more flavor. Tasty noodles with chicken.

site_logo

Lars Corijn . 2024-05-14

MORE AT Google

Delicious pho, really good broth & generous amount of beef, fast & friendly service

site_logo

lau-mai . 2024-05-14

MORE AT Google

Stumbled across this lovely restaurant whilst looking for something to eat on Saturday May 4th. Well what can I say, what a find, the food was absolutely lovely and plenty of it, service was very quick and served with a smile. I would highly recommend you pay this gem of a restaurant a visit, you won't be disappointed! We will definitely be back when next in London!

site_logo

taz_nut . 2024-05-05

MORE AT TripAdvisor

I had been a bit weary to be eating pre-theatre in the West end on a main tourist drag but this cafe was a lovely experience. We only had starters: fresh, crunchy, fragrant papaya salad with prawns and veggie spring rolls, both of which were great. Recommend.

site_logo

Veronika Kuhrner . 2024-04-27

MORE AT Google

Lack of atmosphere but makes up with quality of the food and of the service. The lunch set menu is very good.

site_logo

Alessandro Butini . 2024-04-16

MORE AT Google

We had the pho soup and fried pho - food was too salty and the service staff was confused and unhelpful. Not a good experience and would not recommend.

site_logo

Lynette Lee . 2024-04-12

MORE AT Google

A pleasant surprise to find an excellent lunch menu (starter, main + soft drink) for less then 20 GBP (+12,5 pct service fee ...) in the heart of London. Really good quality food and decent portions, plus gentle and quick service. Recommending the salt/pepper calamari starter

site_logo

Guy Claeys . 2024-04-10

MORE AT Google

I wish there were negative stars. As a Vietnamese, I am ashamed and appaled that this place is serving "instant noodles" and "instant pho" and getting away with it. Then on top of it charges a 12.5% service fee. The operators are recent Vietnamese coming from the North region. Go elsewhere as you are getting instant quality food.

site_logo

paul nguyen . 2024-04-06

MORE AT Google

If you're looking to grab a quick bite before heading off to the theatre, this is good choice. Well situated and a stones throw from His Majesty's Theatre. Menu choice was good and very reasonably priced. The service was prompt and efficient albeit on a quiet Saturday afternoon, so they had plenty of capacity. We'd reserved a table online to ensure we had a seat and although it has more capacity in the basement, it would be worth booking during busier periods. The food was perfectly decent. Not the most memorable Vietnamese meal Ive eaten and I did find myself reaching for the condiments to add flavour. Overall, a quick bite in a basic restaurant, reasonable price and great location.....but the condiments saved the day.

site_logo

Michael B . 2024-03-15

MORE AT TripAdvisor

Nice food, good friendly service and a very reasonable price, particularly considering it's so near the theatre.

site_logo

Jan Rogers . 2024-03-13

MORE AT Google

Food is fine, cheap, fast food. The cafe has pumping house music playing in the restaurant, this is quite obnoxious and serves only to annoy the few customers that were present when I visited

site_logo

Michael Whitehouse . 2024-03-10

MORE AT Google

Quick service, good food, great choice

site_logo

Catherine Kington . 2024-02-18

MORE AT Google

Food ia really nice and authentic

site_logo

Michael Wong . 2024-02-10

MORE AT Google

Nice location, quaint restaurant giving it a nice a atmosphere. The food was very average, salt n pepper wings very over cooked and dry, pho wasn’t as flavorsome then other places I’ve been to in London but wasn’t bad, however I found a hair in the broth. Service was fast and efficient.

site_logo

Jemma Dunn . 2024-02-01

MORE AT Google

The food is very heartwarming! Especially during winter, it's perrrreefect to have a pho! I strongly recommend giving it a try, and the service is quick and pleasant. This is my first time trying the Viet cold coffee, and I am starting to look forward to my second one🤩🤩

site_logo

Tama Tama . 2024-01-31

MORE AT Google

Great lunch spot. Delicious food, quick service. Good prices, what more could you ask for😃

site_logo

Colin Edwards . 2024-01-30

MORE AT Google

The soup of the beef pho is rather tasteless. Whilst the beef meant to be median-cooked, but it came in super well-done. Definitely not worth the price

site_logo

david y . 2024-01-25

MORE AT Google

Authentic Vietnamese food, I brought my friend to this place, and he mentioned that food was as good as he remembers from his childhood. Delicious food accompanied by good service and affordable prices. Thank you everyone, keep the good work up!

site_logo

Pedro Jose Aguilar Curbata . 2024-01-06

MORE AT Google

Sehr netter Service und hervorragendes Essen für einen sehr fairen Preis (13 Pfund für die Hauptspeise). Ausgezeichnete Ente mit Reis.

site_logo

Christian W . 2024-01-06

MORE AT TripAdvisor

Beautiful fresh food. The service staff need to monitor the topics they discuss within the hearing of customers though

site_logo

Dennis Matheson . 2024-01-05

MORE AT Google

The food was nice however the service was poor. The staff were chatting loudly so all visitors could hear their conservation. They were too busy on their phones. I had to wait 10- 15mins for the waiter to finally get off their phone and offer me a drink. Food is good, service standards are low.

site_logo

LY & friends . 2023-12-22

MORE AT TripAdvisor

Went to meet with my ex-colleague for lunch. It was my first Vietnamese food and I had the set menu which consists if starter, mains and a soft drink. I has the salt and chilli squid as a starter and stir fried prawn noodle for the main. Taste good but I find it a wee bit salty and oily. It is my own own personal taste. Overall, I still enjoy my meal and would recommend anyone to go and try, if you are in Central London. You can google them .. more info there.

site_logo

Danny Tan . 2023-12-11

MORE AT Google

Food was nice and plenty. Service was also very friendly however did not like the fact they opened the main door and let the room go cold from the freezing weather outside, it demonstrated little care for the guests well-being.

site_logo

Dom H . 2023-12-07

MORE AT Google

Went there for lunch with my ex-colleague on 4th Dec. I had the set menu comprising of a starter, mains and a soft drink for £18 or so. It was well worth it and the food, really good. I had the salt & pepper squid for starter and fried noodle with tofu for the mains. I find that the noodle was a wee bit oily for my personally taste, may not me for anyone else. That was my first visit to any Vietnamese restaurant. Looking at the menu I think all in offer will suit most diners.

site_logo

Harley Biker 007 . 2023-12-06

MORE AT Google

I ordered the chicken wheat noodle soup and got a bowl of instant noodles with bits of chicken thrown in. Tasted average at best. Way overpriced for what it is but the service was good and the place was clean.

site_logo

Luis Rodriguez . 2023-11-27

MORE AT Google

Best vietnamise restaurant in London. Excellent service

site_logo

Vincenzo Mustaca . 2023-11-18

MORE AT Google

Dans la zone de Picadilly circus, ce petit restaurant est un régal pour les papilles. Les tarifs sont très correct et la quantité dans l’assiette ainsi que la qualité des plats est au rdv Si vous aimez la cuisine vietnamienne n’hésitez surtout pas c’est vraiment un régal !! Mention spéciale aux serveurs qui sont vraiment aidant et agréables. Sachez également qu’avant 17:00 si vous prenez entrée + plat plus dessert le tarif est encore plus avantageux 😋 Une très belle adresse en plein cœur de cette zone animée de Londres

site_logo

Florent H . 2023-11-08

MORE AT TripAdvisor

Good choice on menu. Friendly and efficient service. Food tasty. Watch out for the chilies in the dishes! A bit like going into tardis.. more space than you think. Location handy for theatres in Haymarket.

site_logo

Exquisitetaste2020 . 2023-11-05

MORE AT TripAdvisor

Viet Cafe, Haymarket This is a hidden gem in the bustling capital. The amount of times I passed VietCafe saying I need to try it one day. Sure, it doesn’t look all that from the outside but the food is amazing. The staff were really friendly, getting us seated quickly when it was pouring outside. We visited Sunday 29th October. The food was amazing, we ordered a range from the menu including, spring rolls, beef pho, lemongrass chicken and other items. The price is reasonable, considering where the restaurant is located. If you are deciding to eat at VietCafe Haymarket I would say go for it!

site_logo

Louis Leonard . 2023-11-03

MORE AT Google

Nice to get some Vietnamise dishes and beer at a reasonable price considering its location. Looks like there has been a few changes to the menu since i was here last but the great service has not changed.

site_logo

Tony Gittens . 2023-10-28

MORE AT Google

After waiting for 20 minutes at another restaurant without even being acknowledged, we decided for a change of fare and went to VietCafe instead. What a great decision that was. The service was delightful, the food delicious, and the timing was quick (a definite plus when you have a show to go to). Definitely a great place to stop pre-theater.

site_logo

Sarah Charlton . 2023-10-27

MORE AT Google

Overpriced for office work lunch £16 bill for just egg fried rice main dish, cheaper Vietnamese options in Chinatown and better Also having to sit on a wobbly table is never good.

site_logo

Rocky . 2023-10-18

MORE AT Google

Chicken is good. Not spicy. Noodle also good if you don’t like cilantro, you have to notice it. Service charge is added automatically

site_logo

Hye jin Park . 2023-10-11

MORE AT Google

Tiny place close to theatreland, a real find. Prompt and efficient service, excellent Vietnamese food in generous helpings, all freshly made.

site_logo

Edwina Currie Jones . 2023-09-30

MORE AT Google

The food was authentic tasting and yummy. NGON.

site_logo

Fernando Bumbasi . 2023-09-30

MORE AT Google

We tried to come here at 3.30pm on a Wednesday. The sign outside says they are open '1100 - 2130' on every day of the week. Upon entering the guy says the restaurant is closed and will only reopen at 5pm. I ask him whether the restaurant closes in the afternoon every day and he says it does. I refer him to the sign and he says it is wrong, but does not change or remove it (it was a paper sign affixed to the door with tape). It is a small thing but the fact that they are happy to knowingly mislead customers indicates that they do not really care about them.

site_logo

Michael Nguyen-Kim . 2023-09-27

MORE AT Google

Very efficient snd friendly Vietnamese. I emailed them early one morning to amend my reservation and had a friendly response within seconds. It’s steps from Piccadilly and theatre land and opens at 5 PM so it’s a great pre theatre choice, especially as the food comes out of the kitchen so quickly. Lots of vegetarian choices and healthy broth (pho) options. The green papaya salad is a standout—I had two! Very reasonably priced. Waitress was very careful checking with the kitchen after being advised of a shellfish allergy which we really appreciated. We’ll be back.

site_logo

Karin Sinniger . 2023-09-20

MORE AT Google

Un petit restaurant qui peut sembler être comme tous les autres, mais la bouffe est vraiment savoureuse! La salade de papaye en entrée était vraiment bonne. Nous avons pris deux plats de la carte un peu au hasard, mais l'équilibre des saveurs était remarquable. On a même bu la sauce à la fin! De la bouffe vietnamienne de haut niveau! Service attentif et rapide

site_logo

E2730VEjuliev . 2023-09-14

MORE AT TripAdvisor

Amazing food and service. Staff extremely friendly with lots of recommendations of what to order and why. Ideal location too

site_logo

David T . 2023-09-06

MORE AT TripAdvisor

Delicious, lovely atmosphere, great location! Doesn’t disappoint, every time! Super convenient for pre-theathre or post-gallery visit.

site_logo

Liory F . 2023-08-24

MORE AT TripAdvisor

The food is really not good. It's bland & totally not authentic at all. The beef broth is sweet & has no beefy flavour whatsoever. The so-called Vietnam wheat noodles are just instant noodles. As an accompaniment to Viet noodles dishes, bean sprouts, cilantro, basil & mint leaf should be given, instead we had spring onions. I asked for homemade spicy chilli instead of sriracha & was given 1 tiny dollop in a small sauce dish, and when I wanted more I was told No.

site_logo

Sharon Theng . 2023-08-20

MORE AT Google

We went there for early supper and received friendly and efficiently service. Starters of Spring rolls and Papaya salad were both good. The Bun main course was ok - I would say the sweet and sour taste was not as complex and deep as some of the other Vietnamese food in the area. My husband's rare beef Pho was also lacking in spice and flavour. We have eaten a lot of Vietnamese so our palate is quite sophisticated though... All in all it was fine. Service was very good, starters were good, main courses were lacking. Price was fair, portion size good.

site_logo

Wanony . 2023-08-17

MORE AT TripAdvisor

First time trying wheat noodles in a Vietnamese restaurant and it was delicious! The summer rolles were also lovely. Good service.

site_logo

GD Hong . 2023-08-11

MORE AT Google

Awesome find in Piccadilly Circus! Super affordable eats, and the food was scrumptious! Top-notch service too! Highly recommend!

site_logo

Real Sam . 2023-08-06

MORE AT Google

Very good dishes. True Viet flavor. 100% recommended

site_logo

A P . 2023-08-05

MORE AT Google

Absolutely tasteless food. Summer roll was bland. Seafood noodles was tasteless too. Quality of food is very cheap but prices are quite high for so bad food.

site_logo

Rakhim Gerikhanov . 2023-08-01

MORE AT Google

La nourriture était excellente et le rapport qualité/prix est incroyable car le prix était si peu élevés les Serveurs étaient très très souriant et bienveillants! Ils nous ont donnés des conseils pour Londres et les meilleurs endroit a visités

site_logo

raph cucumber. . 2023-07-27

MORE AT Google

Booked this restaurant for a pre theatre meal. Reasonably priced main courses at around £13-£15. Food very tasty. Food prepared quickly. Friendly staff. Would highly recommend if your after a quick tasty meal before the theatre.

site_logo

Jonnym_7 . 2023-07-23

MORE AT TripAdvisor

Came across this little place accidentally. We had delicious food. Duck fried rice and a duck noodle soup dish. Lots of duck, mine was crispy and son had the soup noodle dish. It was a generous size and so tasty. Staff were super friendly. It was a good find in this bustling city. Very reasonably priced too.

site_logo

Liz S . 2023-07-16

MORE AT TripAdvisor

Really good meal, pleasant atmosphere and a lovely way to start our evening out at the the theatre. Thank you

site_logo

Pip Kings . 2023-07-06

MORE AT Google

런치세트로 주문했고 맛나고 친절하세요 내셔널갤러리갔다 들르기 좋아용

site_logo

Heesu Yoo . 2023-06-24

MORE AT Google

I came to this restaurant many years ago but I felt that the quality of food had come down and was a little disappointed on my recent visit.

site_logo

Ai . 2023-06-16

MORE AT Google

Still great, still friendly, still very reasonably priced. Loved it pre covid and wrote about it. Went back this month and pleased to find all still intact. Nice to see it has received Trip Advisor 2022 recognition as well.

site_logo

HreThrEverywhere . 2023-06-05

MORE AT TripAdvisor

Just popped in for a sunny day snack. Had both cold and hot spring rolls. Cold spring rolls had no flavour (mostly shredded lettuce with no fresh herbs), hot spring rolls greasy and also no flavour. Sauces are clearly store bought so a bit disappointing. Basement seating a bit of a let down on a sunny evening.

site_logo

Chris Upfold . 2023-06-03

MORE AT Google

Love this place. Wonderfully charming people in a part of London where good service, food and value are rare.

site_logo

Matthew Durdy . 2023-06-01

MORE AT Google

Great food and wonderful service. The Calamari was second to none. 👍🏽

site_logo

Rohan Richards . 2023-05-30

MORE AT Google

I ordered beef pho. Compared to quality and quantity of food, the price is expensive (£12.5; including VAT). It seems like the price increased recently.

site_logo

신범준 . 2023-05-30

MORE AT Google

Great place in London for Viet food, super tasty, good price in comparison whith other places around the area. I had the duck Pho and it was 10/10

site_logo

miguel franco . 2023-05-20

MORE AT Google

Great food. Staff are friendly and there prices are reasonable.

site_logo

Calvin Gittens . 2023-05-15

MORE AT Google

The lunch meal deal is a good option.

site_logo

Frog Fat . 2023-05-01

MORE AT Google

Little gem. Had calamaris and prawns for starter and glass noodles and vermicelli noodles with lemon grass source. All was really excellent.

site_logo

Mirek Tokaj . 2023-04-30

MORE AT Google

Highly recommended!! Pho is so great! Summer roll and fried instant noodle are also great. We really love the food. And the staff is so nice and kind! Thank you that lovely girl we met 🥰 Highly recommended especially before watching the opera!

site_logo

Chan Serene . 2023-04-25

MORE AT Google

I had the pho bo tai. It tasted authentic and was excellent value for London—£12.26 with a weekend service fee. If you're Australian like me, it has similar flavours to the pho you can get in Cabramatta. I would maybe tone down the MSG though (had to drink all the water after finishing the bowl)! Staff were kind and thoughtful.

site_logo

Brenda Nguyen . 2023-04-23

MORE AT Google

Went pre theatre. I have never had Vietnamese food before, and googled it and it said it was not spicy but it really is. Amazing flavours and the chicken was so tender. Service was good, quick and friendly. Prices reasonable. small menu means options limited though.

site_logo

vincemN2021OR . 2023-04-12

MORE AT TripAdvisor

Decent food, good value, friendly staff and a pleasant venue close to the West End. Recommended for a quick and healthy meal.

site_logo

Andrew Spells . 2023-03-29

MORE AT Google

Got seated really quickly, the food was prepared rapidly and was beautiful! If you're in a hurry to get to the theatre, I was in and out in 15min after having chicken vermicelli noodles and a beer.

site_logo

Oli J . 2023-03-24

MORE AT TripAdvisor

Viet Café is a great little place for lunch in the Westminster/St James area. If you like Vietnamese food, you’ll be happy to find authentic dishes here with a good selection of dishes plus protein options. The prices are a bit higher than we thought was strictly appropriate for the meals we received, but this is an independently owned restaurant that has had to increase its prices to cope with inflation and rising costs of operation, so we understood and were not deterred. If you have cash, the restaurant prefers this payment method as they lose some of their profits in card transactions, but they do take cards. Overall, I might come here again if I were craving Vietnamese and in the area, but it’s not something to travel for unless you’ve got your heart set on it.

site_logo

varyab11 . 2023-03-20

MORE AT TripAdvisor

Chicken Pho noodle soup was very nice. My partner had the stir fry, pancake starter and side of rice. Reasonable prices Lovely waiter

site_logo

liltravs . 2023-03-14

MORE AT TripAdvisor

Nice and close to The Criterion Theatre and not a chain! A compact menu but a good choice of authentic food with vegan options efficient+ friendly service. Lovely spring rolls. 2x2 courses and a beer each £54. Will return

site_logo

lynnhB63HW . 2023-03-04

MORE AT TripAdvisor

Nice and quick option before theatre. Pho was good but not super impressive. Could have done better with their starters with the portion.

site_logo

Joanne . 2023-03-03

MORE AT Google

A really excellent little gem, in the heart of theatreland and Haymarket. Great options for starters and main courses (no desserts available at present when we were there). I had the grilled pork with egg fried rice and salad for mains, and the chicken and prawn spring rolls (they had run out of vegetable ones) - both were excellent. Washed down with some Saigon Special beer, can't go wrong! Great quick service and presentation. Friendly place. Small, but cosy (they have some extra seating downstairs). Soon got busy, and deservedly so. Do book in advance.

site_logo

2Sweeties . 2023-02-27

MORE AT TripAdvisor

Cosy restaurant with ground and basement seating. A good selection of Vietnamese food. We ordered the usual pho with raw and cooked beef. The broth was clear with depth of flavour. The noodles were medium thickness right size to soak up the broth. The portion was a little small for one person. You definitely need another portion or other dish. Overall, I would recommend it.

site_logo

Sinon Luong . 2023-02-19

MORE AT Google

Delicious food and friendly staff.

site_logo

Pesciolina . 2023-02-19

MORE AT Google

Absolutely amazing food, quick delivery as we went in early (4.50pm ish), good value for what you get, the pho is amazing

site_logo

Joe munday . 2023-02-15

MORE AT Google

Went for early evening meal before going to the theatre. The website has advertised an early dinner set meal offer of £16.50 per person from 5 pm. This prompted our booking. Only when we looked at the menu when we were there, there was no...

site_logo

Linda S . 2023-02-15

MORE AT TripAdvisor

Excellent quality food, highly recommended.

site_logo

Islam Aghayev . 2023-02-13

MORE AT Google

Excellent food and tasty. If you like or have never tried Vietnamese food a great place to visit.

site_logo

Ray Sadd . 2023-02-12

MORE AT Google

I went here with my girlfriends and we had a great authentic Vietnamese meal. Service was awesome and prices very cheap for the area. Highly recommend

site_logo

Cathy Diver . 2023-02-11

MORE AT Google

Absolutely what it is supposed to be! A practical, laid-back, conveniently located vietnamese restaurant with clean, tasty, reasonably priced/generously portioned food, served super fast and fresh! Only 1 min walk from the Her Majesty's Theatre literally across the street and just a couple mins walk from the Piccadilly Circus tube station. Staff really smiley and welcoming. The dining area and their toilets were clean. Would be going back.

site_logo

Ece Sengun Filiz . 2023-02-02

MORE AT Google

Very nice Vietnamese food a stone throw away from Leicester square. The service was very friendly, facilities very clean and the food came literally a few minutes after we ordered, it was impressive. Overall, a pleasant and swift dinner.

site_logo

Ameer Afridi . 2023-01-27

MORE AT Google

Papaya salad is good. Rolled beef is fantastic. Pho noddles is okay.

site_logo

Connie Chan . 2023-01-24

MORE AT Google

Very nice Vietnamese cafe in the heart of London, had chicken and prawn spring rolls and stir fried glass noodles with beef,beautiful flavours and of course jasmine tea on a cold winter day. Service very good and friendly and reasonable price for central London. Toilets all very clean as well..well done ✔ 👌 👏 👍

site_logo

David Porter . 2023-01-24

MORE AT Google

Interesting tasty food. The restaurant was virtually empty when we walked in which was slightly off putting but the greeting was warm and friendly and the food was quite sublime. This was our first foray into Vietnamese cuisine and the freshness and flavours were fantastic....

site_logo

JP_the_JP . 2023-01-12

MORE AT TripAdvisor

the pho and the salt and pepper prawns were really good. there's a lunch special including appetizer, main, and drink for only 17

site_logo

David Fu . 2023-01-10

MORE AT Google

Super authentic, cozy and one of more delicious (if not the most one) pho broth I ever tasted. I wish that I could have more noodles as the soup was so delicious however I was completely full after eating the prawns summer rolls. Also I saw a lot of locals around even though the restaurant sits on a quite touristic area.

site_logo

Tahiba Melina . 2023-01-07

MORE AT Google

the most expensive instant noodles ive ever had in my life. plain tasteless beef with instant noodles. the staff also confirmed this it is instant noodles.

site_logo

Sid R . 2022-12-23

MORE AT Google

Three of us went in for lunch that was very good, fast service and the spring rolls and the Pho exceptional

site_logo

Stephen A . 2022-12-21

MORE AT TripAdvisor

A lovely spot to get away from the crowds of the area. Expected the food to be bad because of the touristy area but it was actually really good. Would recommend. Service was also very nice.

site_logo

K . 2022-12-10

MORE AT Google

My friend and I had dinner here yesterday. The food is so tasty. We liked it because we really wanted to have a catch up without loud music or lots of other conversations. It was perfect to be able to talk and eat without being rushed to get out. There is secondary seating downstairs which goes unnoticed from outside. The staff were lovely. We would be happy to return again. My friend had this filtered coffee which was strangely satisfying to watch : )

site_logo

Natalie Louise . 2022-12-06

MORE AT Google

Nice cosy place, fresh and tasty food. Pho was a bit salty for me, but the service was lovely.

site_logo

Richard Fila . 2022-12-05

MORE AT Google

Similary restaurants in London

restaurant_img
4.3

2658 Opinions

location-icon65a Long Acre
Vietnamese
outdoor_seating_82395takeaway_82395delivery_82395

Love this place especially their spring rolls, chicken pho and soups. Wish they'd keep the prices down though, other than that, it's a good place to eat and central to everything nearby in Covent Garden and Leicester Square. Good front window to eat, chat and people watch.

restaurant_img
4.4

2455 Opinions

location-icon2-4 Garrick Street
Vietnamese
outdoor_seating_87466takeaway_87466delivery_87466

Great Vietnamese cuisine. The pho was brilliant - hearty and warm.

restaurant_img
4.5

540 Opinions

location-icon17 Ironmonger Lane
Vietnamese
outdoor_seating_70875takeaway_70875delivery_70875

Good food. Not suitable for friends chatting because just limited seats . Suitable for take away

restaurant_img
4.5

1148 Opinions

location-icon1 the Arches, Villiers Street
Vietnamese
outdoor_seating_75198takeaway_75198delivery_75198

Well hidden gem under the arches. Martini lichee for a start! The goat was an unexpected choice, but not the only original dish on the menu. Well cooked and light. Hearty Beef Pho soup. Ticking all the boxes. Nice chat with the waitress and the owner. Even had space for lovely dessert. Recommending it!

restaurant_img
4.0

4 Opinions

location-iconCovent garden area
Vietnamese
outdoor_seating_112459takeaway_112459delivery_112459

as always, we always love to try diffrend type of food, so we love going to covert garden and we saw this restaurant, i think thery have many branches, i am not sure 100%, anyway, we went to eat here and we like it, we have fun and lovely meal.