Based on 841 opinions finded in 2 websites
Based on 841 opinions finded in 2 websites
Opinions
Lovely cafe bistro bar right in the center of town . I had an urgent meeting there, great venue for that , menu looks great but I just had a pint
malcolm benson . 2024-09-07
MORE AT Google
Lovely atmosphere. Matt and his team are very helpful and friendly. Food is great! Well cooked and tasty. Good choice of food and drinks. Not cheap but worth every penny. 👌
Julie and Bob Shaw . 2024-08-30
MORE AT Google
Vanilla Bean is always our go to for breakfast or brunch when we are here. The atmosphere is proper village-like and everyone is so friendly. The food is just wonderful and the selection, whilst not overbearing, is everything you need. There is a full licensed bar as well as all your coffee and tea favorites. I wish Vanilla Bean was Stateside, but we will continue to visit each and every time we are in Blighty.
Julian Grumley . 2024-08-22
MORE AT Google
100% percent my favourite place to eat! Absolutely delicious food, friendly staff & a brilliant atmosphere! I had the Crispy Chicken burger with side of pulled pork fries and my partner had the Chicken caesar salad & Halloumi fries, finished off with some coffees and try bakes with ice-cream, really all 5* with such a wide variety to choose from. Thanks to the staff for making our date night a memorable one.
Josh S . 2024-08-19
MORE AT TripAdvisor
Lovely cafe/bar in the village close to the canal basin. Very friendly and the food was delicious
Liz Armstrong . 2024-08-08
MORE AT Google
Lovely place Tasty affordable food Served with a ☺
Josie Fretwell . 2024-08-05
MORE AT Google
Such a lovely place nestled in Slaithwaite. Food was delicious and the service was so friendly.
Clairey Doodah . 2024-07-21
MORE AT Google
Just moved to the area a week ago, popped in for lunch, sharing platter. Excellent food, service really good. What made it was the team member who took our payment went into detail about various tapas evenings and discussed each dish. Really nice touch…. It will go our go to eatery
Maisie Smith . 2024-07-10
MORE AT Google
A very different and varied menu. My seafood platter was to die for. As for the staff they were really chatty, friendly and involved. Made for a much better restaurant experience. ....And......then a surprise birthday cake for TWO 80th birthdays.
sydandliz2022 . 2024-06-28
MORE AT TripAdvisor
Great menu and nice food. Dog friendly too.
Adam Bennett . 2024-06-27
MORE AT Google
Just wanted to say thank you. We booked a table for 5 adults, just before you started your Father's Day Sunday Roast offering, so the cafe was very busy, the staff rushed off their feet and I would imagine the kitchen were frantic as they prepped for roast dinners whilst still serving breakfasts and brunch. Lovely, friendly, chatty chap in chef's whites seated and served us (owner?manager?) and was patient, funny and helpful throughout (we had a double-set of Dads plus a 40th birthday to celebrate so were rather scatty and disorganised). All the waiting staff were friendly, efficient, and helpful and it was a pleasure to be in such a nice atmosphere. Food took a while to come, as you would expect at such a busy time, but was so well worth the wait! It was all hot, super fresh, well presented and lovely quality. We had ordered 2 enormous breakfasts (maybe a 'mega' and a 'vb'), a crispy bacon sarnie (actual crispy bacon!), eggs royale and a bacon and scrambled egg bagel. The sausages and black pud on the breakfasts were exceptionally good but all the food was really really tasty. Our coffees and drinks were fast and well made too. One of the waitresses mentioned the tapas evenings the cafe offers (Thursday-Saturday?) and brought a menu for us to peruse, offering great advise and suggestions and pointing out that there is a 20% discount off bills on certain days (!!!WOW!) Menu looks amazing, reckon we'll be back for THAT! I've been before and been delighted by the service and quality food, but this time I really wanted to offer thanks for a lovely Sunday celebration. All the very best Guys! xx
alison i . 2024-06-17
MORE AT TripAdvisor
Fabulous place to grab a coffee or a lovely lunch/ meal. The service and food is of a very high quality ; it may cost a few pennies more, but comparable to other such establishments, Vanilla Bean is a cut above . You can eat inside or outside in the small courtyard, where dogs are welcomed. Absolutely love it here. FIRST CLASS
anna-marie clayton . 2024-06-14
MORE AT Google
Every time I call in, the staff are always very friendly and it has a good vibe
Kathleen Buckley . 2024-06-11
MORE AT Google
Onestamente non ci vedo niente di speciale va bene per un pranzo veloce senza pretese i piatti sono un pò "pesanti" per un Italiano diciamo che non puoi fare un pranzo leggere con una semplice insalata se non condita con super salse o altro nel pieno stile Inglese La pulizia direi che lascia un pò a desiderare ma anche questo è sempre nel loro stile Da andarci solo se si è costretti e si è già in paese
Luca012_10 . 2024-05-28
MORE AT TripAdvisor
Every Saturday, my brother and I take our dad, who has Alzheimer's, to this wonderful restaurant. Matthew, the owner, is a true family man and makes each visit a personal and comforting experience. The young staff are fantastic, always accommodating us with the utmost care and professionalism. They've been trained exceptionally well. The food is gorgeous, consistently exceeding our expectations. This place has become a cherished part of our weekly routine, thanks to the outstanding caring service and delicious meals.
Chelsea S . 2024-05-25
MORE AT TripAdvisor
Excellent, best omelette I've ever had! Sat outside in the sun. Everything including staff perfect. If I was to make one tiny negative it was the loo, however this in no way would stop me from coming again! bit of a queue, but very clean, separated baby change area would be better.
Toni Gaunt . 2024-05-19
MORE AT Google
Lovely place. Great friendly, accommodating chef.
Kaz C . 2024-05-15
MORE AT Google
Booked a table for Sunday lunch a fantastic menu choice for all the family service was exceptional meals were freshly cooked and we loved them all. Finishing with a baked Alaska and a cheese cake to die for. Unhurried, a relaxing meal, highly recommend this place.
Jon Talbot . 2024-05-12
MORE AT Google
Absolutely delicious breakfast, opted to change some items which wasn't a problem for them. All fresh with great quality produce. Really friendly service with a smile. The chap who served our breakfast and possibly cooked it then continued to serve when it got a little busier and was so cheerful. It really was refreshing and made me proud to be Northern to be honest! We was only passing through and we like to support local businesses so thank you for a lovely experience and creating a welcoming atmosphere for all. Keep doing what you! Would recommend!
Helen Bowers . 2024-05-10
MORE AT Google
Had a couple drinks here one afternoon. Friendly staff with good service. There's a few tables outside to sit in the sun and people watch. Our only criticism would be that there is only one shared toilet.
Nev Thomas . 2024-05-07
MORE AT Google
What a lovely cafe so friendly and welcoming. We had the most amazing food- crispy beef Asian noodle salad and chicken Caesar salad followed by very good coffee. We had been on a long walk with our dog and it was great to be able to eat indoors with him. The service and food was 5 star . Look forward to our next visit . Highly recommended
GrandTour31281441521 . 2024-04-24
MORE AT TripAdvisor
Good food. Great service, staff friendly & efficient
Pippa Townend . 2024-04-24
MORE AT Google
My wife and I booked the Vanilla Bean having heard good things about the place and we were not disappointed, we had a Sunday lunch and agreed it was the best we had tasted, everything from the 3 giant roasties, the Yorkshire pudding was cooked to perfection, and it was nice not to have to order and pay extra for cauliflower cheese which was delicious. The staff were brilliant and full of information and if you had room for dessert the lemon cheesecake was amazing. We will be back to taste from a very exciting looking menu
RICHARD S . 2024-04-18
MORE AT TripAdvisor
First time eating here for lunch and we weren’t disappointed, top quality food well prepared and served by very friendly staff,will definitely eat here again soon. As recommended by Michael Owen 😉
Michael Owen . 2024-04-16
MORE AT Google
Great breakfast with excellent service
Mark Severn . 2024-04-13
MORE AT Google
Great place to stop of on bike ride and re charge the batteries
david townsend . 2024-04-13
MORE AT Google
Staff are friendly and make you feel most welcome. My husband and I both had a full breakfast which was delicious and filling - the sausages are huge and the butter was gorgeous! The dinner menu looks superb and we will be back to sample it.
Mrs W . 2024-04-11
MORE AT Google
Booked last minute for a party of ten there was actually 11 of us, they were very accommodating, the food and service was excellent and presented really well. Everyone in the party was very pleased and had a lovely relaxing time.
Adventure21465196865 . 2024-03-26
MORE AT TripAdvisor
It was brilliant here, we originally went in as two adults and a baby on a really busy saturday, we had a small wait and Carol got us a perfect table with a high chair all of the staff were so so helpful and interacted with us and checked on us we then sat down and asked if they could find us a table of four adults with a baby as we had two more joining us, which they easily sorted thank you again to Carol - she was brilliant and kept us constantly updated the food was lovely with recommendations from staff, everyone was really friendly and helpful - we’re not local to the area but would be back!! highly recommend for all occasions for any groups!
chlo_s926 . 2024-03-09
MORE AT TripAdvisor
Home from home. Food excellent, staff more than excellent and a lovely atmosphere.
Sean Lyon . 2024-02-22
MORE AT Google
Excellent food, service and attentive staff. This was our first visit for a meal, but it won't be our last! Highly recommended.
774AndrewR . 2024-02-18
MORE AT TripAdvisor
Food is always incredible. Staff are amazing! All very friendly and welcoming. Perfect place for a meal, lunch or just a coffee. Cannot recommend it enough.
Andrew Carrington . 2024-02-17
MORE AT Google
I was in Slaithwaite for work and wanted to try a local café. I thought Vanilla Bean appeared to be a nice place. However the ingredients were subpar although I could see effort had gone into preparing them. The coffee again was well prepared but tasted like poor quality beans for the price. It tasted like Greggs coffee. It's a shame because it could've been so much better.
Calum McCauley . 2024-02-14
MORE AT Google
An extensive menu. Good choice and something for everyone. A great place to meet and greet 🥇
Margaret Wardle . 2024-02-08
MORE AT Google
Lovely cafe with delicious food, efficient service and a nice atmosphere. Dog friendly. It's worth noting there's a few tables benefiting from SSE aspect so a good place to visit on a sunny day to recharge. The coffee is delicious and right off the bat you are asked to choose between a single or a double shot to get it as strong as you like. Eggs were runny where they should be, bacon's fat was rendered and hashbrowns were not soaking wet from oil. There's a couple of free parking lots nearby which makes it quite a convenient spot.
Sebastian Walak . 2024-02-04
MORE AT Google
Nicely decorated, clean and warm friendly staff. Visited on a busy Saturday morning/lunch. Asked for something not on the menu (yes I’m one of those people lol) and they was more than happy to make it for me. I wasn’t there long. A vanilla latte and a bacon and egg mayo on a brown tea cake. There was loads of bacon in it so I was well happy. I always feel bad not tipping when it’s deserved but I never have cash anymore. I’d happily go back when I’m next in the village.
Luke G . 2024-01-27
MORE AT TripAdvisor
Lovely dog-friendly café that we happened across on a day out. I had the Yorkshire pudding wrap and my husband had the chicken Caesar salad, and our pups shared a sausage. Everything was delicious, and the portions were enormous. It took both of us, plus some dog assistance, to get through my chips and half the wrap. Staff was quite friendly. Highly recommended, looking forward to going back!
Catherine Edwards . 2024-01-27
MORE AT Google
Went in early Sunday afternoon with my wife and son, even though it was busy, a table was found for us. The service was great, friendly staff. We each had a hot drink, I had the hot beef sandwich, wife had the BLT, son had pie of the day, all were delicious. Definitely worth a visit.
L Newton . 2024-01-21
MORE AT Google
Vanilla Bean - you're great - but I beg you, please consult some vegetarians about your vegetarian offer. NO ONE wants a mushroom in a teacake. It's an insult. Yes, it's become a popular fad to fob us off with portobello mushrooms and, let me tell you, it's not because vegetarians want them - it's because its easy and cheap for restuarants to make 'em. See also: "vegetarian sausages" made out of mashed potatoes, peas and carrots. "Veggie Footlong" HAHAHAHAHAHA. Where's the protein? ARE YOU TRYING TO KILL US??? Please review your veggie offer. I cannot eat at your cafe anymore. Vegetarians need protein too.
Fake Carol Vorderman . 2024-01-07
MORE AT Google
Stopped for brunch on a wet January day and we were really impressed by the quality of the food and great service. The cafe was busy -and seemed to have a lot of local customers which is testament to how good it is as there is a lot of competition. (I was amazed at how many cafes or coffee shops there are in Slaithwaite now, compared to when I lived there in the 1990s!)
Domollie . 2024-01-04
MORE AT TripAdvisor
We visit this place a couple times a month and are always welcomed by lovely staff, the food never fails to impress. Looking forward to next year's outings
Alison B . 2023-12-31
MORE AT TripAdvisor
Tried to call in for breakfast. Didn’t realise you had to have a reservation for breakfast?? Despite there being 3 empty tables (not marked as ‘reserved’ I may add) the member of staff we encountered kept repeating that we had to hold on before she decided whether we could be catered for. A couple on a small table spoke out to say they were leaving and we could have their table and other customers reminded her that there was an upstairs. But, alas she couldn’t seem to accommodate two extra people. We were made to feel that we were in the wrong for wanting to provide custom to this establishment and actually pay for this service! We are not from the area and so may have just encountered her on a bad day but will definitely NOT be wanting to provide any support to a place that does not appreciate customers when we visit family again. No company in these times should be turning away customers or making them feel embarrassed. By the way, we came out, walked a few doors down and had a lovely breakfast after being greeted by a lovely girl at the counter with a smile on her face…
charliew2005 . 2023-12-26
MORE AT TripAdvisor
We held a birthday party here for about 40 people. It was a brilliant night, and Matt and Charlotte couldn’t have been more helpful in getting everything just right. Our daughter has coeliac and so all the food for the buffet was gluten free. There was a huge choice and many people commented on how good the food was without even realising it was all GF. We eat here frequently and it’s always really good. To do that for 40 was excellent and was very reasonably priced. Can’t say thank you enough.
midgetgem45 . 2023-12-21
MORE AT TripAdvisor
Few of us had tapas which were gorgeous - very flavourful and good sizes. The hanging chicken kebab a bit dry, chocolate milkshake was lacking too. Staff super lovely
BeeJay B . 2023-12-19
MORE AT Google
I'll keep this short, but simply put: Cosy Venue Delicious Food Wonderful Staff Do go, you will not regret it. I recommend the Eggs Benny 👌
bobbydee1963 . 2023-12-18
MORE AT TripAdvisor
Very nice coffee, top quality spirits if you want alcohol. My friends food looked amazing, my only regret from the visit was not being hungry enough to try some of the delicious menu.
Chelsea Seale . 2023-11-15
MORE AT Google
Average food and service, with prices a little higher than I’d expect.
Carl Ellwood . 2023-11-11
MORE AT Google
Really nice coffee friendly staff. Our dog mafe welcome too
kathryn holroyd . 2023-10-26
MORE AT Google
I ordered a club sandwich expecting bread cut into a triangle with some kind of skewer through it. It didn't come like that. It came in a tea cake. I felt like I was eating something from the fish and chip shop. Very disappointing
Neil Crabtree . 2023-10-25
MORE AT Google
Very friendly staff and the coffee was nice..cake was a little dry for my liking
Michael Bullas . 2023-10-24
MORE AT Google
Spot on food and coffee, though as per a few other reviews, they are a popular place, so when its busy, service is a little slow - so go early!
Andy . 2023-10-22
MORE AT Google
Absolutely fantastic catch up with previous friend/ work colleagues. Tapas to die for, shared a meat and cheese board to start. Fabulous venue, atmosphere, staff, delicious food, amazing cocktails, perfect ambience, totally chilled, highly, absolutely recommend!!! 🥰🥰🥰🥰
C8343UFcarolw . 2023-10-16
MORE AT TripAdvisor
What an absolutely charming place. Small enough to feel intimate but not in the least cramped. The staff are super friendly and attentive, management really do have the ratio of staff to customers spot on. The food was amazing. We had a selection of tapas, about 8-9 dishes, between four of us. Each dish delicious, and generous for tapas. They serve a good selection of drinks and cocktails too. The prices are very good. I would have paid more for the good cuisine we received. There’s a car park just opposite too. Can’t wait to go back.
Paula S . 2023-10-15
MORE AT TripAdvisor
Vanilla Bean is on our old mans lunching village circuit. Aways, friendly and good food and atmosphere. We'll be back 😎
Andrew Hall . 2023-10-12
MORE AT Google
Lovely place for a light lunch with friends.
Wendy Cartwright . 2023-10-10
MORE AT Google
Lovely spot for food, breakfast, or lunch. The service was excellent 👌🏾. Faultless.
Kofi Addison . 2023-10-07
MORE AT Google
Fantastic best Sunday dinner in a long time and pizza 🍕 on a Saturday is top notch 👌 n8ce beers and wine and I just love garlic and if you ask for lots you get lots We love the bean 💕
Martyn Ashley . 2023-10-05
MORE AT Google
I visited Vanilla Bean today. Our last visit just over 3 years ago didn’t go well and we left before we could be served due to the rudeness of the owner. I have purposely not returned because of how we were treated but today I thought we would go. What a difference….. Staff were lovely and greeted us as we arrived and sat down. Food was delicious had a sharing board. This is want I expected as there are always good reviews. I will be back let’s hope we get the same quality
joannewL6600JM . 2023-10-05
MORE AT TripAdvisor
Lovely food, wine friendly service. The salad I ordered was delicious and the loaded fries were good too. Nice atmosphere and the chef also asked us how our meal was.
B4476EJvalentinam . 2023-09-06
MORE AT TripAdvisor
Came for my birthday brunch...and it was lovely!! I've eaten here a few times and enjoyed it everytime.
Dawn Skrynnyk . 2023-09-06
MORE AT Google
Had tapas here and the food was delicious! Service was great. Would definitely go again and I would recommend.
Helena . 2023-08-27
MORE AT Google
Nice food, beers. Outdoor tables if weather good.
Tony Pummell . 2023-08-21
MORE AT Google
Went here for an evening meal on a Friday evening, we were lucky they squeezed us in as we both had the hanging kebabs, I had chicken and my husband had steak and prawn, they were delicious, we have also had tapas here previously which was lovely so will definitely be returning
Maffmich . 2023-07-31
MORE AT TripAdvisor
Superb food. Go regular for ice-cream and coffees, but we also book there for family meals as the food is fantastic
Joe Hipkins . 2023-07-30
MORE AT Google
Always a pleasure eating and having a coffee here. Matt and his staff are lovely, as are the surroundings
Dave Kennedy . 2023-07-25
MORE AT Google
Lovely place. Sat upstairs. No waiting for a table. But if a wait for food, but it was delicious when served. Will definately return.
Nana09 . 2023-07-24
MORE AT Google
Great place to stop for breakfast. Good service. Great coffee. Food well presented. Nice atmosphere. Would definitely recommend.
Fozzie292 . 2023-07-19
MORE AT TripAdvisor
Went to Vanilla Bean on the off chance of getting a full English cooked breakfast, first time in Slaithwaite so was unsure of what was open, most Cafes in the area didn’t open till 10am, I must say we were all pleasantly surprised, the staff was so accommodating and the breakfast was absolutely amazing, we sat outside in an area to put our bikes with just one small shower of rain, the place was very busy and we could see why, definitely recommend 💪🙌🚴
Departure11110503192 . 2023-07-15
MORE AT TripAdvisor
Fantastic service, outstanding breakfast, managed to get an outside table with on a sunny Sunday morning, the patio area is a real sun trap when it's shining,. The breakfast was superb along with the coffees and teas, came with 3 friends new to VB and they'll all be returning!
Companion28293128519 . 2023-07-11
MORE AT TripAdvisor
Mac and Cheese delicious. We were welcomed by staff and received a great service. Can't wait to go back.
YvonnePWitter . 2023-07-10
MORE AT Google
Good selection of tapas (other food is available too) some traditional and some more modern dishes. Ours was delicious! Dessert selection was limited to cakes (hence 4 stars for food, shame I can't give 4½ stars) but was still delicious!
Rory Goodwin . 2023-06-15
MORE AT Google
Visited with my friend and my son for some lunch on a hot midweek day. The food and service was really good. Would definitely return here. They are so welcoming to children.
Explore With Son & Me . 2023-06-12
MORE AT Google
Best vegetarian sausages ever tasted. these stood out above others I have ever had before. Shows care has been put into the recipe.
david h . 2023-06-10
MORE AT TripAdvisor
Fresh and flavourful ice creams. Strong recommendation here 🦾🦾
tomek dynak . 2023-06-08
MORE AT Google
Excellent brunch here with friends. The french toast was amazing and huge! Great service, friendly staff and good value. Will definitely return.
Nomad68278687347 . 2023-06-04
MORE AT TripAdvisor
Called in with friends for brunch. Varied menu, good service & the coffee is excellent! Will definitely return when next in the area.
Sally2464 . 2023-05-06
MORE AT TripAdvisor
I Would highly recommend a visit to vanilla bean for food if you are in the area even if just for a coffee and treat! There is Lots of space for customers and plenty of space for high chairs around the tables. The food is delicious and the staff are warm, welcoming and can’t do enough for you. The brisket / chillie Mac and cheese is amazing! Great portion sizes for meals and plenty of options for littles ones to eat. Did I also mention it’s dog friendly?!
Danni C . 2023-04-29
MORE AT TripAdvisor
We have been going to vanilla bean often since having our twins. As a new mum it’s hard to find somewhere that feels calm, comfortable and welcoming when you have young children. They can’t do enough for you and the food is delicious. Would highly recommend a visit if you are in the area even for a coffee and a treat! There is Lots of space for customers downstairs and upstairs!
Danni Charlotte . 2023-04-28
MORE AT Google
Good service, had a great bacon and egg butty, staff very helpful, the cafe is nice and clean
John Anonymous . 2023-04-28
MORE AT Google
Fantastic breakfast, really recommend Coffee's great aswell, staff really friendly and very helpful
FarAway55462717790 . 2023-04-27
MORE AT TripAdvisor
Never had a bad experience here always been a first class experience and nothing has ever been too much. The staff are amazing so polite. One thing I love about this place you’re not hounded by staff! It’s a lovely environment rustic and just the place! We have been a few times lately and cannot say anything bad about this place! Oh and to top it all off food is amazing! We will be back!
rebecca h . 2023-04-26
MORE AT TripAdvisor
We went for Sunday lunch the vanilla bean we pre booked and when we arrived it was busy we were welcomed by the friendly staff who showed us to our table and gave us the menus we had a good look through and decided we were going to go with the Sunday lunch we took the offer of 3 courses the friendly waiter who came over to take our order went through the menu and told us what the soup was for the Sunday lunch menu and what the roast of the day was we gave our order for the soup roast pork and sticky toffee pudding The soup was amazing full of flavour well presented and served with lovely soft warm bread and butter we receive ld a check back to make sure everything was perfect and it was amazing second course we ordered the roast pork out it came with all the trimmings and the biggest Yorkie pud I’ve seen around lovely roasted potato’s and the best veg around we received another check back to make sure all food was to the standard and once again it hit the spot it was amazing last but not least the stp this was amazing best stp I’ve had in along time the Sunday lunch menu is a massive 10/10 for me fantastic value for money would definitely recommend this Fantastic meal served by fantastic staff who catered to all of our needs will definitely be returning give this play a visit you won’t be disappointed it’s amazing and fantastic
kieronh840 . 2023-04-26
MORE AT TripAdvisor
Terrible food, ordered a Brie and cranberry sandwich, it came in a cheap white bap with the smallest amount of Brie, that and a dollop of slaw and garnish was just over £10! I felt robbed. Chips were extra at £4.50 and were nice, my...
Claire B . 2023-04-25
MORE AT TripAdvisor
Very overpriced and not that great coffee not good either waitresses was nice untill we walked out without ordering then was loudly sarcastic
jonathanhD9936CV . 2023-04-25
MORE AT TripAdvisor
I was given a table upstairs at the back, and it felt like I was in a 'back room'. I had to ask for pepper then ask for salt as it wasn't offered together. The lighting was poor - two ceiling lights were out it wasn't a pleasant lunch experience.
Susan Robinson . 2023-04-23
MORE AT Google
Lovely friendly atmosphere Just had drinks Will return when in the area again
Jean Whitfield . 2023-04-19
MORE AT Google
Friendly welcome. Very very clean. Amazing food and drinks. Atmosphere perfect
Sharon H . 2023-04-18
MORE AT Google
Just popped in briefly for an excellent coffee in a friendly relaxed environment. A great place to meet friends or relax.
brighton70 . 2023-03-29
MORE AT TripAdvisor
We are regulars here , great place to eat or if you just fancy a drink you will be greeted with a warm welcome from the friendly staff, it's also dog friendly which is a bonus. You can also get a takeaways which are amazing...
JULIE L . 2023-03-26
MORE AT TripAdvisor
Great hot coffee and full breakfasts including vegetarian option. Prompt service and pleasant staff - thank you.
Anna-Lee Hymas . 2023-03-25
MORE AT Google
I’m a frequent visitor to Vanilla Bean and always enjoy the food and the service is good. Unfortunately the last few times I have been the smell of dirty cooking oil has overwhelmed the dining area. I’m not the only person who has noticed this friends have commented about this to me. I really hope that they can rectify this issue because it really is a nice place to eat or just have a coffee.
Linda Wilson . 2023-03-23
MORE AT Google
We visited for Mother’s Day. Booked in advance and our table was ready for us when we arrived. All the food we ordered was delicious - a wide variety from sausage and mash to a Mediterranean platter. We were all super impressed. Cakes and crumble was also delicious! The staff were so friendly and attentive. They couldn’t have done more to try and accommodate everyone on a very busy day! Would absolutely recommend to anyone.
Alice Bickerdike . 2023-03-22
MORE AT Google
It is a very nice place to have a family get-together.. food was cooked beautifully for a special Sunday lunch day for all Mums... a little busy on the day, but that to me shows Vanilla Bean has a good reputation.. I am told the weekly menu is very nice indeed with lots of speciality dishes on offer.. very well worth a visit..
Stephen Whiteley . 2023-03-20
MORE AT Google
Brilliant cafe but you need to book, not that big and always busy. Great menu and coffee. Nuff said👍
Mark Lawson . 2023-03-17
MORE AT Google
First visit and my choice of good, the Gammon was a good one. My colleagues had various other dishes and were likewise happy.
Norman Booth . 2023-03-08
MORE AT Google
Called in for lunch. Staff were friendly and welcoming, served quickly with drinks. We ordered sandwiches which were overpriced and nothing special. The chips seemed like oven chips which did surprise me. That being said, the hot food coming out looked very good and everyone...
handbagsruleM . 2023-02-25
MORE AT TripAdvisor
Lovely food - ultimate loaded fries mmm! Best grub I've had for a while. Great place - love the building.
Robert Goodman . 2023-02-18
MORE AT Google
Had a really enjoyable lunch a full breakfast which was cooked well and service was really good too
Maria . 2023-02-15
MORE AT Google
1st class food and service staff wonderful and friendly good value for money well worth a visit even if you only want a drink
johncP9747BG . 2023-02-15
MORE AT TripAdvisor
Best Sunday lunch around absolutely gorgeous. Well worth a visit eaten here a few times recently and it’s exceptional.
Bertha101 . 2023-02-12
MORE AT TripAdvisor
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in Yorkshire and The Humber
138 Opinions
Excellent spot for a coffee, milkshake or light lunch. We visited on a Sunday on one of the hottest days of the year. Lovely as usual. It's not cheap but if you want somewhere a bit different and sp
pizzacakevanillaeggchickenladysandwichtapassaladcookedfish21 Opinions
We did not have a booking but the place was not busy so quickly found a table. Menu is via a QR code on the table then order at the counter. There is a good range to choose from including Full Englis
pizzacakevanillaeggchickenladysandwichtapassaladcookedfish