GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 864 opinions finded in 2 websites

site_photo4

Nº 300 in 1409 in Kirklees

Nº 53 of 185 Other cuisines in Kirklees

CUSTOMERS TALK ABOUT DISHES WITH..saladcoffeevanillacookedcreamsandwichfishtapaseggpizzaladycakecheesebeautifulbaconchickensoupchocolatebean

comment_iconOpinions

Best little cafe in the Colne Valley

site_logo

Steve Blighton . 2024-12-07

MORE AT Google

What a lovely restaurant! So much more than a cafe. Staff really friendly and helpful. Even getting a bowl of water for the dog. The food is wonderful. I have been a few times. Today I had the land shank and it’s the best I have ever had with tasty veg and a delicious gravy ( but don’t say that to the chef as he says it a jus). Definitely worth a visit when walking the canal path

site_logo

Julia Clark . 2024-12-03

MORE AT Google

Beautiful vege breakfast. Excellent service.

site_logo

Kara McManus . 2024-11-19

MORE AT Google

Excellent food and service 🙌🏻 we'll be back

site_logo

Richard Clark . 2024-11-17

MORE AT Google

Always full, staff helpful to a tee and the food/beverages are always presented well and taste great!

site_logo

Daniel Lawton . 2024-11-14

MORE AT Google

Nice little coffee stop. Friendly staff.

site_logo

Dog walker . 2024-11-12

MORE AT Google

Excellent service. Called in by chance and had breakfast, eggs benny and salmon. Perfectly cooked. Excellent coffee. Very dog friendly too.

site_logo

J M . 2024-11-10

MORE AT Google

Came here to cheer a friend up who was struggling with a few issues. Had a great time and the food was fabulous. The lady who served us (sorry I can't remember the name) was brilliant even if she did serve my friend an energy drink at breakfast ( that was funny)

site_logo

Shaun Arrand . 2024-11-08

MORE AT Google

Myself, and some family including 8 children came to vanilla bean 2 weeks back and had such a pleasant experience. We all had dinner, drinks and pudding and every single meal was lovely. My 11 year old niece had the lamb shank and she said she loved it. The lady that served us, I believe her name was Carol Was such a delight. She was so happy, lovely with the children and nothing was too much. I know the food plays a massive part in eating out but so does the staff. If I was to go to a restaurant and have rude staff it would make me not want to go back. Carol was so welcoming so thank you for that. I was Carol in a shop not long after going to vanilla bean and she recognised me from our outing to vanilla bean and again she was just so pleasant and lovely! I’d definitely say she’s a credit to this place. We will definitely be back. Thank you x

site_logo

Jodie Brearley . 2024-11-08

MORE AT Google

When busy very rushed went with relative to eat and drink lunch. We couldn't use stairs. We ask the gentleman if we could ask a couple sat on a table for 4 to split into table for 2 twos he said ask them if you want.... I think it would have been better for him to ask not us as customers... We managed the stairs my aunt have a knee replacement only 6 weeks before and myself rheumatoid arthritis. Only to be told by a lovely lady serving upstairs we could have used entrance from the street instead of stairs. No toilets upstairs so back down for loo and up again to drink second coffee. Then I had to go down for salt and pepper to find out they are back upstairs on a windowsill. I would go back the food is fabulous we spent £40 for two people couple of drinks two amazing baguettes and chips really fab sat upstairs put condiments on tables and toilet.... And use that door.

site_logo

cazcrete . 2024-10-30

MORE AT Google

Walked in and was greeted by a server who was extremely rude. Looked my friend up and down and when she went for the alcoholic menu she stated ‘that’s the alcohol menu you’ll want the coffee one.’ Both me and my friend are 21 years of age and whilst she may have assumed we were underage it was extremely off putting. Not the service expected when walking in to a cafe

site_logo

Katie Sykes . 2024-10-23

MORE AT Google

The soup of the day at Vanilla Bean is UNREAL!!! (10 Oct) Head there now for a carrot and orange soup, OMG! You will regret missing this! As always exceptional service and great vibe. Thank you

site_logo

Bianca S . 2024-10-10

MORE AT TripAdvisor

Staff are incredible, food is divine & just an overall amazing place to go for a bite to eat or a lovely coffee.

site_logo

Yvonne Armitage . 2024-09-26

MORE AT Google

I used to be a regular a fair few years ago when I lived in the area, always used to have lovely food and coffee. I stopped by this weekend as I passed by to have a coffee. Was fairly disappointed in what I got. I pretty much just got a hot cup of milk. Perhaps the batista forgot to use new coffee grounds? Paid but felt bad about it. Café was clean and tidy and the seating is laid out well.

site_logo

Jordan Bamforth . 2024-09-24

MORE AT Google

Stopped here to get out of the rain whilst walking around town Really nicely decorated smart cafe with fun wallpaper, with friendly staff I had a good latte (very strong coffee but very nice) And my wife had a good Biscoff and caramel milkshake (although I think it had ice cream in, it was so blended that it was runny, but still tasted very nice) Also got a lovely Jammie dodger blondie which tasted really good, and had a lovely texture Would definitely return here

site_logo

flashsam7267 . 2024-09-17

MORE AT TripAdvisor

Stopped here to get out of the rain whilst walking around town Really nicely decorated smart cafe with fun wallpaper, with friendly staff I had a good latte (very strong coffee but very nice) And my wife had a good Biscoff and caramel milkshake (although I think it had ice cream in, it was so blended that it was runny, but still tasted very nice) Also got a lovely Jammie dodger blondie which tasted really good, and had a lovely texture Would definitely return here

site_logo

Sam Stone . 2024-09-17

MORE AT Google

Lovely cafe bistro bar right in the center of town . I had an urgent meeting there, great venue for that , menu looks great but I just had a pint

site_logo

malcolm benson . 2024-09-07

MORE AT Google

Lovely atmosphere. Matt and his team are very helpful and friendly. Food is great! Well cooked and tasty. Good choice of food and drinks. Not cheap but worth every penny. 👌

site_logo

Julie and Bob Shaw . 2024-08-30

MORE AT Google

Vanilla Bean is always our go to for breakfast or brunch when we are here. The atmosphere is proper village-like and everyone is so friendly. The food is just wonderful and the selection, whilst not overbearing, is everything you need. There is a full licensed bar as well as all your coffee and tea favorites. I wish Vanilla Bean was Stateside, but we will continue to visit each and every time we are in Blighty.

site_logo

Julian Grumley . 2024-08-22

MORE AT Google

100% percent my favourite place to eat! Absolutely delicious food, friendly staff & a brilliant atmosphere! I had the Crispy Chicken burger with side of pulled pork fries and my partner had the Chicken caesar salad & Halloumi fries, finished off with some coffees and try bakes with ice-cream, really all 5* with such a wide variety to choose from. Thanks to the staff for making our date night a memorable one.

site_logo

Josh S . 2024-08-19

MORE AT TripAdvisor

Lovely cafe/bar in the village close to the canal basin. Very friendly and the food was delicious

site_logo

Liz Armstrong . 2024-08-08

MORE AT Google

Lovely place Tasty affordable food Served with a ☺

site_logo

Josie Fretwell . 2024-08-05

MORE AT Google

Such a lovely place nestled in Slaithwaite. Food was delicious and the service was so friendly.

site_logo

Clairey Doodah . 2024-07-21

MORE AT Google

Just moved to the area a week ago, popped in for lunch, sharing platter. Excellent food, service really good. What made it was the team member who took our payment went into detail about various tapas evenings and discussed each dish. Really nice touch…. It will go our go to eatery

site_logo

Maisie Smith . 2024-07-10

MORE AT Google

A very different and varied menu. My seafood platter was to die for. As for the staff they were really chatty, friendly and involved. Made for a much better restaurant experience. ....And......then a surprise birthday cake for TWO 80th birthdays.

site_logo

sydandliz2022 . 2024-06-28

MORE AT TripAdvisor

Great menu and nice food. Dog friendly too.

site_logo

Adam Bennett . 2024-06-27

MORE AT Google

Just wanted to say thank you. We booked a table for 5 adults, just before you started your Father's Day Sunday Roast offering, so the cafe was very busy, the staff rushed off their feet and I would imagine the kitchen were frantic as they prepped for roast dinners whilst still serving breakfasts and brunch. Lovely, friendly, chatty chap in chef's whites seated and served us (owner?manager?) and was patient, funny and helpful throughout (we had a double-set of Dads plus a 40th birthday to celebrate so were rather scatty and disorganised). All the waiting staff were friendly, efficient, and helpful and it was a pleasure to be in such a nice atmosphere. Food took a while to come, as you would expect at such a busy time, but was so well worth the wait! It was all hot, super fresh, well presented and lovely quality. We had ordered 2 enormous breakfasts (maybe a 'mega' and a 'vb'), a crispy bacon sarnie (actual crispy bacon!), eggs royale and a bacon and scrambled egg bagel. The sausages and black pud on the breakfasts were exceptionally good but all the food was really really tasty. Our coffees and drinks were fast and well made too. One of the waitresses mentioned the tapas evenings the cafe offers (Thursday-Saturday?) and brought a menu for us to peruse, offering great advise and suggestions and pointing out that there is a 20% discount off bills on certain days (!!!WOW!) Menu looks amazing, reckon we'll be back for THAT! I've been before and been delighted by the service and quality food, but this time I really wanted to offer thanks for a lovely Sunday celebration. All the very best Guys! xx

site_logo

alison i . 2024-06-17

MORE AT TripAdvisor

Fabulous place to grab a coffee or a lovely lunch/ meal. The service and food is of a very high quality ; it may cost a few pennies more, but comparable to other such establishments, Vanilla Bean is a cut above . You can eat inside or outside in the small courtyard, where dogs are welcomed. Absolutely love it here. FIRST CLASS

site_logo

anna-marie clayton . 2024-06-14

MORE AT Google

Every time I call in, the staff are always very friendly and it has a good vibe

site_logo

Kathleen Buckley . 2024-06-11

MORE AT Google

Onestamente non ci vedo niente di speciale va bene per un pranzo veloce senza pretese i piatti sono un pò "pesanti" per un Italiano diciamo che non puoi fare un pranzo leggere con una semplice insalata se non condita con super salse o altro nel pieno stile Inglese La pulizia direi che lascia un pò a desiderare ma anche questo è sempre nel loro stile Da andarci solo se si è costretti e si è già in paese

site_logo

Luca012_10 . 2024-05-28

MORE AT TripAdvisor

Every Saturday, my brother and I take our dad, who has Alzheimer's, to this wonderful restaurant. Matthew, the owner, is a true family man and makes each visit a personal and comforting experience. The young staff are fantastic, always accommodating us with the utmost care and professionalism. They've been trained exceptionally well. The food is gorgeous, consistently exceeding our expectations. This place has become a cherished part of our weekly routine, thanks to the outstanding caring service and delicious meals.

site_logo

Chelsea S . 2024-05-25

MORE AT TripAdvisor

Excellent, best omelette I've ever had! Sat outside in the sun. Everything including staff perfect. If I was to make one tiny negative it was the loo, however this in no way would stop me from coming again! bit of a queue, but very clean, separated baby change area would be better.

site_logo

Toni Gaunt . 2024-05-19

MORE AT Google

Lovely place. Great friendly, accommodating chef.

site_logo

Kaz C . 2024-05-15

MORE AT Google

Booked a table for Sunday lunch a fantastic menu choice for all the family service was exceptional meals were freshly cooked and we loved them all. Finishing with a baked Alaska and a cheese cake to die for. Unhurried, a relaxing meal, highly recommend this place.

site_logo

Jon Talbot . 2024-05-12

MORE AT Google

Absolutely delicious breakfast, opted to change some items which wasn't a problem for them. All fresh with great quality produce. Really friendly service with a smile. The chap who served our breakfast and possibly cooked it then continued to serve when it got a little busier and was so cheerful. It really was refreshing and made me proud to be Northern to be honest! We was only passing through and we like to support local businesses so thank you for a lovely experience and creating a welcoming atmosphere for all. Keep doing what you! Would recommend!

site_logo

Helen Bowers . 2024-05-10

MORE AT Google

Had a couple drinks here one afternoon. Friendly staff with good service. There's a few tables outside to sit in the sun and people watch. Our only criticism would be that there is only one shared toilet.

site_logo

Nev Thomas . 2024-05-07

MORE AT Google

What a lovely cafe so friendly and welcoming. We had the most amazing food- crispy beef Asian noodle salad and chicken Caesar salad followed by very good coffee. We had been on a long walk with our dog and it was great to be able to eat indoors with him. The service and food was 5 star . Look forward to our next visit . Highly recommended

site_logo

GrandTour31281441521 . 2024-04-24

MORE AT TripAdvisor

Good food. Great service, staff friendly & efficient

site_logo

Pippa Townend . 2024-04-24

MORE AT Google

My wife and I booked the Vanilla Bean having heard good things about the place and we were not disappointed, we had a Sunday lunch and agreed it was the best we had tasted, everything from the 3 giant roasties, the Yorkshire pudding was cooked to perfection, and it was nice not to have to order and pay extra for cauliflower cheese which was delicious. The staff were brilliant and full of information and if you had room for dessert the lemon cheesecake was amazing. We will be back to taste from a very exciting looking menu

site_logo

RICHARD S . 2024-04-18

MORE AT TripAdvisor

First time eating here for lunch and we weren’t disappointed, top quality food well prepared and served by very friendly staff,will definitely eat here again soon. As recommended by Michael Owen 😉

site_logo

Michael Owen . 2024-04-16

MORE AT Google

Great place to stop of on bike ride and re charge the batteries

site_logo

david townsend . 2024-04-13

MORE AT Google

Great breakfast with excellent service

site_logo

Mark Severn . 2024-04-13

MORE AT Google

Staff are friendly and make you feel most welcome. My husband and I both had a full breakfast which was delicious and filling - the sausages are huge and the butter was gorgeous! The dinner menu looks superb and we will be back to sample it.

site_logo

Mrs W . 2024-04-11

MORE AT Google

Booked last minute for a party of ten there was actually 11 of us, they were very accommodating, the food and service was excellent and presented really well. Everyone in the party was very pleased and had a lovely relaxing time.

site_logo

Adventure21465196865 . 2024-03-26

MORE AT TripAdvisor

It was brilliant here, we originally went in as two adults and a baby on a really busy saturday, we had a small wait and Carol got us a perfect table with a high chair all of the staff were so so helpful and interacted with us and checked on us we then sat down and asked if they could find us a table of four adults with a baby as we had two more joining us, which they easily sorted thank you again to Carol - she was brilliant and kept us constantly updated the food was lovely with recommendations from staff, everyone was really friendly and helpful - we’re not local to the area but would be back!! highly recommend for all occasions for any groups!

site_logo

chlo_s926 . 2024-03-09

MORE AT TripAdvisor

Home from home. Food excellent, staff more than excellent and a lovely atmosphere.

site_logo

Sean Lyon . 2024-02-22

MORE AT Google

Excellent food, service and attentive staff. This was our first visit for a meal, but it won't be our last! Highly recommended.

site_logo

774AndrewR . 2024-02-18

MORE AT TripAdvisor

Food is always incredible. Staff are amazing! All very friendly and welcoming. Perfect place for a meal, lunch or just a coffee. Cannot recommend it enough.

site_logo

Andrew Carrington . 2024-02-17

MORE AT Google

I was in Slaithwaite for work and wanted to try a local café. I thought Vanilla Bean appeared to be a nice place. However the ingredients were subpar although I could see effort had gone into preparing them. The coffee again was well prepared but tasted like poor quality beans for the price. It tasted like Greggs coffee. It's a shame because it could've been so much better.

site_logo

Calum McCauley . 2024-02-14

MORE AT Google

An extensive menu. Good choice and something for everyone. A great place to meet and greet 🥇

site_logo

Margaret Wardle . 2024-02-08

MORE AT Google

Lovely cafe with delicious food, efficient service and a nice atmosphere. Dog friendly. It's worth noting there's a few tables benefiting from SSE aspect so a good place to visit on a sunny day to recharge. The coffee is delicious and right off the bat you are asked to choose between a single or a double shot to get it as strong as you like. Eggs were runny where they should be, bacon's fat was rendered and hashbrowns were not soaking wet from oil. There's a couple of free parking lots nearby which makes it quite a convenient spot.

site_logo

Sebastian Walak . 2024-02-04

MORE AT Google

Nicely decorated, clean and warm friendly staff. Visited on a busy Saturday morning/lunch. Asked for something not on the menu (yes I’m one of those people lol) and they was more than happy to make it for me. I wasn’t there long. A vanilla latte and a bacon and egg mayo on a brown tea cake. There was loads of bacon in it so I was well happy. I always feel bad not tipping when it’s deserved but I never have cash anymore. I’d happily go back when I’m next in the village.

site_logo

Luke G . 2024-01-27

MORE AT TripAdvisor

Lovely dog-friendly café that we happened across on a day out. I had the Yorkshire pudding wrap and my husband had the chicken Caesar salad, and our pups shared a sausage. Everything was delicious, and the portions were enormous. It took both of us, plus some dog assistance, to get through my chips and half the wrap. Staff was quite friendly. Highly recommended, looking forward to going back!

site_logo

Catherine Edwards . 2024-01-27

MORE AT Google

Went in early Sunday afternoon with my wife and son, even though it was busy, a table was found for us. The service was great, friendly staff. We each had a hot drink, I had the hot beef sandwich, wife had the BLT, son had pie of the day, all were delicious. Definitely worth a visit.

site_logo

L Newton . 2024-01-21

MORE AT Google

Vanilla Bean - you're great - but I beg you, please consult some vegetarians about your vegetarian offer. NO ONE wants a mushroom in a teacake. It's an insult. Yes, it's become a popular fad to fob us off with portobello mushrooms and, let me tell you, it's not because vegetarians want them - it's because its easy and cheap for restuarants to make 'em. See also: "vegetarian sausages" made out of mashed potatoes, peas and carrots. "Veggie Footlong" HAHAHAHAHAHA. Where's the protein? ARE YOU TRYING TO KILL US??? Please review your veggie offer. I cannot eat at your cafe anymore. Vegetarians need protein too.

site_logo

Fake Carol Vorderman . 2024-01-07

MORE AT Google

Stopped for brunch on a wet January day and we were really impressed by the quality of the food and great service. The cafe was busy -and seemed to have a lot of local customers which is testament to how good it is as there is a lot of competition. (I was amazed at how many cafes or coffee shops there are in Slaithwaite now, compared to when I lived there in the 1990s!)

site_logo

Domollie . 2024-01-04

MORE AT TripAdvisor

We visit this place a couple times a month and are always welcomed by lovely staff, the food never fails to impress. Looking forward to next year's outings

site_logo

Alison B . 2023-12-31

MORE AT TripAdvisor

Tried to call in for breakfast. Didn’t realise you had to have a reservation for breakfast?? Despite there being 3 empty tables (not marked as ‘reserved’ I may add) the member of staff we encountered kept repeating that we had to hold on before she decided whether we could be catered for. A couple on a small table spoke out to say they were leaving and we could have their table and other customers reminded her that there was an upstairs. But, alas she couldn’t seem to accommodate two extra people. We were made to feel that we were in the wrong for wanting to provide custom to this establishment and actually pay for this service! We are not from the area and so may have just encountered her on a bad day but will definitely NOT be wanting to provide any support to a place that does not appreciate customers when we visit family again. No company in these times should be turning away customers or making them feel embarrassed. By the way, we came out, walked a few doors down and had a lovely breakfast after being greeted by a lovely girl at the counter with a smile on her face…

site_logo

charliew2005 . 2023-12-26

MORE AT TripAdvisor

We held a birthday party here for about 40 people. It was a brilliant night, and Matt and Charlotte couldn’t have been more helpful in getting everything just right. Our daughter has coeliac and so all the food for the buffet was gluten free. There was a huge choice and many people commented on how good the food was without even realising it was all GF. We eat here frequently and it’s always really good. To do that for 40 was excellent and was very reasonably priced. Can’t say thank you enough.

site_logo

midgetgem45 . 2023-12-21

MORE AT TripAdvisor

Few of us had tapas which were gorgeous - very flavourful and good sizes. The hanging chicken kebab a bit dry, chocolate milkshake was lacking too. Staff super lovely

site_logo

BeeJay B . 2023-12-19

MORE AT Google

I'll keep this short, but simply put: Cosy Venue Delicious Food Wonderful Staff Do go, you will not regret it. I recommend the Eggs Benny 👌

site_logo

bobbydee1963 . 2023-12-18

MORE AT TripAdvisor

Very nice coffee, top quality spirits if you want alcohol. My friends food looked amazing, my only regret from the visit was not being hungry enough to try some of the delicious menu.

site_logo

Chelsea Seale . 2023-11-15

MORE AT Google

Average food and service, with prices a little higher than I’d expect.

site_logo

Carl Ellwood . 2023-11-11

MORE AT Google

Really nice coffee friendly staff. Our dog mafe welcome too

site_logo

kathryn holroyd . 2023-10-26

MORE AT Google

I ordered a club sandwich expecting bread cut into a triangle with some kind of skewer through it. It didn't come like that. It came in a tea cake. I felt like I was eating something from the fish and chip shop. Very disappointing

site_logo

Neil Crabtree . 2023-10-25

MORE AT Google

Very friendly staff and the coffee was nice..cake was a little dry for my liking

site_logo

Michael Bullas . 2023-10-24

MORE AT Google

Spot on food and coffee, though as per a few other reviews, they are a popular place, so when its busy, service is a little slow - so go early!

site_logo

Andy . 2023-10-22

MORE AT Google

Absolutely fantastic catch up with previous friend/ work colleagues. Tapas to die for, shared a meat and cheese board to start. Fabulous venue, atmosphere, staff, delicious food, amazing cocktails, perfect ambience, totally chilled, highly, absolutely recommend!!! 🥰🥰🥰🥰

site_logo

C8343UFcarolw . 2023-10-16

MORE AT TripAdvisor

What an absolutely charming place. Small enough to feel intimate but not in the least cramped. The staff are super friendly and attentive, management really do have the ratio of staff to customers spot on. The food was amazing. We had a selection of tapas, about 8-9 dishes, between four of us. Each dish delicious, and generous for tapas. They serve a good selection of drinks and cocktails too. The prices are very good. I would have paid more for the good cuisine we received. There’s a car park just opposite too. Can’t wait to go back.

site_logo

Paula S . 2023-10-15

MORE AT TripAdvisor

Vanilla Bean is on our old mans lunching village circuit. Aways, friendly and good food and atmosphere. We'll be back 😎

site_logo

Andrew Hall . 2023-10-12

MORE AT Google

Lovely place for a light lunch with friends.

site_logo

Wendy Cartwright . 2023-10-10

MORE AT Google

Lovely spot for food, breakfast, or lunch. The service was excellent 👌🏾. Faultless.

site_logo

Kofi Addison . 2023-10-07

MORE AT Google

Fantastic best Sunday dinner in a long time and pizza 🍕 on a Saturday is top notch 👌 n8ce beers and wine and I just love garlic and if you ask for lots you get lots We love the bean 💕

site_logo

Martyn Ashley . 2023-10-05

MORE AT Google

I visited Vanilla Bean today. Our last visit just over 3 years ago didn’t go well and we left before we could be served due to the rudeness of the owner. I have purposely not returned because of how we were treated but today I thought we would go. What a difference….. Staff were lovely and greeted us as we arrived and sat down. Food was delicious had a sharing board. This is want I expected as there are always good reviews. I will be back let’s hope we get the same quality

site_logo

joannewL6600JM . 2023-10-05

MORE AT TripAdvisor

Lovely food, wine friendly service. The salad I ordered was delicious and the loaded fries were good too. Nice atmosphere and the chef also asked us how our meal was.

site_logo

B4476EJvalentinam . 2023-09-06

MORE AT TripAdvisor

Came for my birthday brunch...and it was lovely!! I've eaten here a few times and enjoyed it everytime.

site_logo

Dawn Skrynnyk . 2023-09-06

MORE AT Google

Had tapas here and the food was delicious! Service was great. Would definitely go again and I would recommend.

site_logo

Helena . 2023-08-27

MORE AT Google

Nice food, beers. Outdoor tables if weather good.

site_logo

Tony Pummell . 2023-08-21

MORE AT Google

Went here for an evening meal on a Friday evening, we were lucky they squeezed us in as we both had the hanging kebabs, I had chicken and my husband had steak and prawn, they were delicious, we have also had tapas here previously which was lovely so will definitely be returning

site_logo

Maffmich . 2023-07-31

MORE AT TripAdvisor

Superb food. Go regular for ice-cream and coffees, but we also book there for family meals as the food is fantastic

site_logo

Joe Hipkins . 2023-07-30

MORE AT Google

Always a pleasure eating and having a coffee here. Matt and his staff are lovely, as are the surroundings

site_logo

Dave Kennedy . 2023-07-25

MORE AT Google

Lovely place. Sat upstairs. No waiting for a table. But if a wait for food, but it was delicious when served. Will definately return.

site_logo

Nana09 . 2023-07-24

MORE AT Google

Great place to stop for breakfast. Good service. Great coffee. Food well presented. Nice atmosphere. Would definitely recommend.

site_logo

Fozzie292 . 2023-07-19

MORE AT TripAdvisor

Went to Vanilla Bean on the off chance of getting a full English cooked breakfast, first time in Slaithwaite so was unsure of what was open, most Cafes in the area didn’t open till 10am, I must say we were all pleasantly surprised, the staff was so accommodating and the breakfast was absolutely amazing, we sat outside in an area to put our bikes with just one small shower of rain, the place was very busy and we could see why, definitely recommend 💪🙌🚴

site_logo

Departure11110503192 . 2023-07-15

MORE AT TripAdvisor

Fantastic service, outstanding breakfast, managed to get an outside table with on a sunny Sunday morning, the patio area is a real sun trap when it's shining,. The breakfast was superb along with the coffees and teas, came with 3 friends new to VB and they'll all be returning!

site_logo

Companion28293128519 . 2023-07-11

MORE AT TripAdvisor

Mac and Cheese delicious. We were welcomed by staff and received a great service. Can't wait to go back.

site_logo

YvonnePWitter . 2023-07-10

MORE AT Google

Good selection of tapas (other food is available too) some traditional and some more modern dishes. Ours was delicious! Dessert selection was limited to cakes (hence 4 stars for food, shame I can't give 4½ stars) but was still delicious!

site_logo

Rory Goodwin . 2023-06-15

MORE AT Google

Visited with my friend and my son for some lunch on a hot midweek day. The food and service was really good. Would definitely return here. They are so welcoming to children.

site_logo

Explore With Son & Me . 2023-06-12

MORE AT Google

Best vegetarian sausages ever tasted. these stood out above others I have ever had before. Shows care has been put into the recipe.

site_logo

david h . 2023-06-10

MORE AT TripAdvisor

Fresh and flavourful ice creams. Strong recommendation here 🦾🦾

site_logo

tomek dynak . 2023-06-08

MORE AT Google

Excellent brunch here with friends. The french toast was amazing and huge! Great service, friendly staff and good value. Will definitely return.

site_logo

Nomad68278687347 . 2023-06-04

MORE AT TripAdvisor

Called in with friends for brunch. Varied menu, good service & the coffee is excellent! Will definitely return when next in the area.

site_logo

Sally2464 . 2023-05-06

MORE AT TripAdvisor

I Would highly recommend a visit to vanilla bean for food if you are in the area even if just for a coffee and treat! There is Lots of space for customers and plenty of space for high chairs around the tables. The food is delicious and the staff are warm, welcoming and can’t do enough for you. The brisket / chillie Mac and cheese is amazing! Great portion sizes for meals and plenty of options for littles ones to eat. Did I also mention it’s dog friendly?!

site_logo

Danni C . 2023-04-29

MORE AT TripAdvisor

Good service, had a great bacon and egg butty, staff very helpful, the cafe is nice and clean

site_logo

John Anonymous . 2023-04-28

MORE AT Google

We have been going to vanilla bean often since having our twins. As a new mum it’s hard to find somewhere that feels calm, comfortable and welcoming when you have young children. They can’t do enough for you and the food is delicious. Would highly recommend a visit if you are in the area even for a coffee and a treat! There is Lots of space for customers downstairs and upstairs!

site_logo

Danni Charlotte . 2023-04-28

MORE AT Google

Fantastic breakfast, really recommend Coffee's great aswell, staff really friendly and very helpful

site_logo

FarAway55462717790 . 2023-04-27

MORE AT TripAdvisor

We went for Sunday lunch the vanilla bean we pre booked and when we arrived it was busy we were welcomed by the friendly staff who showed us to our table and gave us the menus we had a good look through and decided we were going to go with the Sunday lunch we took the offer of 3 courses the friendly waiter who came over to take our order went through the menu and told us what the soup was for the Sunday lunch menu and what the roast of the day was we gave our order for the soup roast pork and sticky toffee pudding The soup was amazing full of flavour well presented and served with lovely soft warm bread and butter we receive ld a check back to make sure everything was perfect and it was amazing second course we ordered the roast pork out it came with all the trimmings and the biggest Yorkie pud I’ve seen around lovely roasted potato’s and the best veg around we received another check back to make sure all food was to the standard and once again it hit the spot it was amazing last but not least the stp this was amazing best stp I’ve had in along time the Sunday lunch menu is a massive 10/10 for me fantastic value for money would definitely recommend this Fantastic meal served by fantastic staff who catered to all of our needs will definitely be returning give this play a visit you won’t be disappointed it’s amazing and fantastic

site_logo

kieronh840 . 2023-04-26

MORE AT TripAdvisor

Never had a bad experience here always been a first class experience and nothing has ever been too much. The staff are amazing so polite. One thing I love about this place you’re not hounded by staff! It’s a lovely environment rustic and just the place! We have been a few times lately and cannot say anything bad about this place! Oh and to top it all off food is amazing! We will be back!

site_logo

rebecca h . 2023-04-26

MORE AT TripAdvisor

Terrible food, ordered a Brie and cranberry sandwich, it came in a cheap white bap with the smallest amount of Brie, that and a dollop of slaw and garnish was just over £10! I felt robbed. Chips were extra at £4.50 and were nice, my...

site_logo

Claire B . 2023-04-25

MORE AT TripAdvisor

Very overpriced and not that great coffee not good either waitresses was nice untill we walked out without ordering then was loudly sarcastic

site_logo

jonathanhD9936CV . 2023-04-25

MORE AT TripAdvisor

Similary restaurants in Yorkshire and The Humber

restaurant_img
4.5

29 Opinions

location-iconThe Lawrence Batley Theatre, Queen's Square, Queen Street.
Other cuisines
outdoor_seating_227794takeaway_227794delivery_227794

Always a pleasure visiting here. Great range of soups and reasonably priced coffee £2 or pot of tea £1.60 (Dec '18). The staff are friendly and there's a outdoor seating area which in summer is a real sun trap.

restaurant_img
4.5

417 Opinions

location-icon95 Gomersal Lane
Other cuisines
outdoor_seating_332217takeaway_332217delivery_332217

Stunning food and gorgeous staff. Could not recommend enough. Absolute must visit for anyone who likes food

restaurant_img
4.5

395 Opinions

location-icon1 Rotcher
Other cuisines
outdoor_seating_230938takeaway_230938delivery_230938

Great selection of craft beers, always changing. Highly recommend 'Neck oil' when it's on. Loads of choice for non beer drinkers too. Not tried the food since it's changed, menu looks good though. Really friendly and helpful staff.

restaurant_img
4.5

374 Opinions

location-icon283 Halifax Road
Other cuisines
outdoor_seating_217689takeaway_217689delivery_217689

What a lovely place. Very welcoming. The food was amazing. Would highly recommend you try this place. The roast of the day was really good. The 1, 2 or 3 course lunch menu is really good value. With the generous portions we only managed a main course.

restaurant_img
4.5

244 Opinions

location-icon2 Market Place
Other cuisines
outdoor_seating_140397takeaway_140397delivery_140397

I can't praise this little cafe enough, lovely food, great service 😋