GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.5

Based on 172 opinions finded in 2 websites

site_photo3

Nº 260 in 330 in Sevenoaks

Nº 73 of 92 Other cuisines in Sevenoaks

CUSTOMERS TALK ABOUT DISHES WITH..cookedlambhamprawnspiechickencheesevegetablesoldeggpaypotatoesfishsteakroast

comment_iconOpinions

Great lunch and food excellent with so much choice . Lovely restaurant Staff were so friendly and very welcoming. Good quality lunch at an excellent price. The Inglenook Restaurant is so very comfortable and the pub itself is a great place just to have a nice drink with friends.

site_logo

Susan M . 2023-08-11

MORE AT TripAdvisor

Went for dinner with family, sea bass was so lovely and presented beautifully. Husband had the steak and kidney pudding. Will definitely be back again and again

site_logo

Mandie W . 2021-11-01

MORE AT TripAdvisor

Please read our review on the Rising Sun Fawkham as its same property . The Meal we had on this occasion was far from appealing the full details and experience can be seen on our other review under Rising Sun Fawkham

site_logo

KenFromKent . 2021-09-27

MORE AT TripAdvisor

The food served here is second to none, but it is so popular you must book to avoid disappointment. There is parking on site. The prices are reasonable.

site_logo

brkttp . 2020-10-09

MORE AT TripAdvisor

Lovely to be out and about again, good selection on the menu and the daily specials made this early trip out with friends extra pleasant. Staff were very helpful and couldn't do more for us.

site_logo

colin995 . 2020-08-04

MORE AT TripAdvisor

This pub is so welcoming its staff and food cannot be faulted. To say there was 11 of us all meals came out together hot and beautifully cooked. I / we Would recommend to anyone to visit this place. We will definitely be returning very soon

site_logo

461trevord . 2020-02-16

MORE AT TripAdvisor

a varied menu with some unusual dishes, including a spicy version of the traditional prawn cocktail, but try their fillet steak - absolutely divine!

site_logo

Brian C . 2019-05-28

MORE AT TripAdvisor

Over 30 of us at a large birthday party, lots of different orders, which the restaurant handled with no fuss at all, lovely food, really nice service. Never been to this place before but will definitely be back. Thanks for making it a lovely day!

site_logo

A3282 . 2019-04-28

MORE AT TripAdvisor

We had a family meal here. 13 of us were all catered for exceptionally well. The waiter was very attentive and cheerful. The food was good and everything about the restaurant was great. Cannot fault it. Thank you so much.

site_logo

Ess-Aitch . 2019-03-01

MORE AT TripAdvisor

Super Brie and Bacon Baguette with side salad, sat outside in shade and watched the world go by. Excellent table service and really topped up filling in baguette - they could not fit any more in!

site_logo

Amateur-Artist . 2018-06-25

MORE AT TripAdvisor

My husband and I visited this cosy pub and enjoyed the food very much. The fish was very fresh and the chips were lovely and crispy. The chicken and mushroom pie had a good flavour and the pastry was nice and short. Great service, the staff were very attentive and friendly

site_logo

sophlaw121 . 2018-06-04

MORE AT TripAdvisor

Following good reviews on Trip Advisor 6 of us attended the Restaurant Saturday lunchtime to celebrate Mothers 90th birthday. Lovely little Pub & Restaurant with friendly staff. Extensive menu to fit all budgets & great choices. Food quality & portions were very good & meals were nice & hot & washed down with two bottles of wine. Overall this was an extremely good choice for our first visit & enjoyed by all. Clearly a venue to return too.

site_logo

xbanker49 . 2017-11-16

MORE AT TripAdvisor

This was our third visit with a group of friends who had not been to this lovely restaurant before .Everyone was very impressed with both the food and the service; as always the staff came up trumps for us and there is no way that the food could be faulted both for presentation and taste. well done again.

site_logo

John M . 2017-09-12

MORE AT TripAdvisor

Excellent as always. Went with 6 friends, had the lunch menu which was 2 courses Waitress very helpful, quick service too.

site_logo

jefflee125 . 2017-08-09

MORE AT TripAdvisor

lovely little pub with very friendly staff. Small outside seating area but very clean & lots of seating. The restaurant was clean & the food was fabulous. Look forward to going back

site_logo

twiggy2470 . 2017-06-01

MORE AT TripAdvisor

This is a great place for lunch or dinner great menu, friendly staff and great value for money been a few times and never disappoints can't wait to go back .

site_logo

7neilp . 2017-04-17

MORE AT TripAdvisor

We enjoyed a lunchtime meal there today. I recommend the home made fish pie followed by cheese board. Another had the Skate light bite and my wife the ploughman's lunch. All the food was excellent. We have eaten there several times,and always really enjoyed it.

site_logo

Swanleyjon . 2017-03-11

MORE AT TripAdvisor

Hier onverwachts neergestreken... Heerlijk gegeten. Zeer correcte en vriendelijke bediening. Prachtige variatie aan gerechten. Mooie authentieke locatie. Top!

site_logo

gonneke07 . 2017-01-26

MORE AT TripAdvisor

Este tiene que ser el mejor pub en la zona y la comida es de buena calidad y buena relación calidad-precio no pretencioso - han tenido un gran número de comidas y recientemente un excelente uno - el personal es amable y nada es demasiado problema - simplemente fantástico, pero no te olvides de reservar de lo contrario te decepcionará.

site_logo

dmansfield2016 . 2017-01-04

MORE AT TripAdvisor

Buen menú y muchas verduras. Mi vieiras eran un poco raro. Combinaciones de sabores elegantes, con agua caliente y fría no funcionaba para mí. El precio de la carne parece que han subido tan pegada al pescado y patatas fritas. No me puedo quejar. Para...

site_logo

happyeater631 . 2016-12-20

MORE AT TripAdvisor

Have eaten in this pub restaurant for may years. Quality of food and service always very good. Sometimes difficulty in finding somewhere to park when it is very busy.

site_logo

Captainbob11 . 2016-12-16

MORE AT TripAdvisor

Food is always hit and miss at the Rising Sun today the food was better than normalPortion sizes vary depending which chef is on dutyThis pub could be a lot more customer friendly but sorry to say it is not the case Ordered the fish and chip asked for tartar sauce literary thrown on the table Waitress by the name of Charlotte could learn a few manners and how to serve customers properly.Won't be back pity

site_logo

Lalamandi0308 . 2016-12-09

MORE AT TripAdvisor

This is a friendly pub with an inglenook fireplace and a small cosy restaurant. Having reached the age when my appetite is not as big as in my youth quality rather than quantity is my priority. The food here was absolutely delicious and although I was quite full before I had finished I couldn't possibly have left any of the main part so had to leave some vegetables and potatoes. I had the smoked salmon and cod Wellington. The Wellington was cooked perfectly and the sauce complimented it perfectly. My partner had the chilli and they happily added more chilli at his request. Our friend had the lamb shank and both were delighted with their meals. I would imagine it would be an ideal place to spend a cold winters evening

site_logo

JANICE B . 2016-11-10

MORE AT TripAdvisor

We eat regularly here at least once a month and usally not a problem in fact the t bone steak a couple of weeks ago was perfect ,so did I choose a bad week ate here Monday lunchtime with friends and 3 out of 4 people had minor complaints chips under cooked and still hard my ploughmans was ok but the bread provided with it was a plain boring uninteresting pale white baguette so many different artisan breads available now ,so gave it a go on Sunday for a roast lunch phoned and checked availability all ok so ordered 2 roasts not cheap at £12-40 each when they arrived meat gravy Yorkshire puddings fine and the vegetables are always good but the 2 saddest pale anemic pathetic roast potatoes on my plate was a disgrace and I felt undervalued that the cook/ chef thought it was ok to serve this to a customer I complained and asked for them to be removed and they was replaced with sautéed potatoes also my wife left hers when receiving the bill £4 was deducted,in my opinion all the staff seemed very young and part time and maybe a lack of quality control.

site_logo

hammer-bill . 2016-10-24

MORE AT TripAdvisor

I have stopped in here a few times with either friends or family. The staff are always welcoming and attentive whether you are eating in the resturant or the bar.The range of food is not as expansive as some more modern pubs, but then you know that what you are going to get is fresh. There should though be something for every palette and the fish options are particularly good. They are also not fussy about people having food from the bar snacks menu in the main resturant. On my latest visit I had the lamb burger and found it to be delightfully spiced and a very filling meal. The food can often be too much so desert it not always necessary, but these are still good if you have room for them.There is a good range of drinks at the bar, often with some of the more traditional longer standing beers being offered that more modern pubs elect not to serve any more.

site_logo

Whitewash1970 . 2016-10-23

MORE AT TripAdvisor

Walking into the Rising Sun is like stepping back into the 1960's (which isn't a bad thing at all). Notice saying no under 2's allowed, no music pounding out and a range of beers on tap.Friendly staff and the place had quite a few locals in it (another sign of a proper 'local')Booked a table for 3 for dinner and the three course meal was OK - not great by any stretch of the imagination but it was adequate. We all had steak (2 T bones and a Sirloin) - all were cooked 'roughly' to what was ordered but presentation and general quality was again adequate not great.Staff were very friendly and the service itself was fine. This isn't a place I would rush back to and my only comment to try and help them would be to pay a litlle more attention to quality and presentation.

site_logo

Martin C . 2016-10-21

MORE AT TripAdvisor

We arrived at 12.40 and ordered quite quickly from the two courses for £12.50 menu. After about 25 minutes two of the three meals were brought to the table and I told my companions to start without me. My husband and his friend politely waited and then their food was whisked away. It was like something from Fawlty Towers but not funny. Waited another 20 minutes and all three meals were brought again. My lamb burger was disgusting, overcooked just tough meat and gristle. I pushed it to one side planning to complain at the end of the meal. Because of the delay we didn't have time to order a pudding. When we paid we were charged the full £12.50 for the two course meals and £8.90 for my awful burger and £11.00 for two and a half pints of beer and 2 halves of soda a lime. We couldn't complain about the way the bill had been charged at the desk because we were treating a friend and didn't want to make a fuss or have enough time to make a fuss. Very Very Poor. Quite apart from that the shepherds pie was average and covered in cheese (why?) and Mediterranean Chicken looked anaemic and didn't taste much better.

site_logo

KentBev . 2016-09-28

MORE AT TripAdvisor

A good range of choices of food from bar snacks to sandwiches to full blown four course dinner. Excellent service but food only served until 21.00hrs

site_logo

Amateur-Artist . 2016-09-18

MORE AT TripAdvisor

Prachtig om ter plaatse te slapen, rustiek en alles werkte perfect, van douche tot haardroger. Het restaurant was normaal ingericht, maar de keuken, schitterend. Vergeet gewone Engelse keuken en eet een keuken met de positieve invloeden van her en der. Een weekend dat volgend jaar weer op onze agenda staat.

site_logo

Claudia K . 2016-09-01

MORE AT TripAdvisor

Went here for Sunday lunch on 29 August. For starters, my husband and I had the baked Camembert sharing platter for 2 people – we were so disappointed when it came out, firstly is was only half a Camembert and only 3 very small slices of French bread, the red onion jelly was very watery and not very nice - at £11 it was a total rip-off. For mains we both had the roast beef (£13) OMG we thought that they had brought out children’s meals as the portions were so tiny; two small slices of the thinnest beef which tasted awful, 3 small hard and tasteless roast potatoes and two (frozen) Yorkshire puddings – the only saving grace for this meal was the cauliflower cheese which was very nice but that was it. My husband and I are not overweight but do want a decent meal for our money and not to be served sub-standard food at an over inflated price. The staff were pleasant but very slow, they preferred to hang around the till area just talking amongst each other rather than serving. It’s such a shame as the overall appearance of this pub is lovely, it’s just the food that really does let this place down. Definitely would not return, spend your money elsewhere.

site_logo

EssexCheekyMonkey . 2016-08-30

MORE AT TripAdvisor

My wife and I and group of 31 people from our club had a lunch here today 25th.September 2016 and we had a great time the food was wonderful and the portions were big with plenty of vegetables. The service was very quick and attentive, you could not ask for anything better.

site_logo

John M . 2016-08-25

MORE AT TripAdvisor

Visited on the off chance and managed to get a table with my oh.. we got given a table in the pub area as the restaurant was fully booked.. we both ordered the lamb shank and oh my it was amazing.. the meat fell off the bone.. the mash was perfect and the red wine jus was so rich.. vegetables were great to.. We even returned the following week with the family.Great food.. parking us not great but well worth walking to the pub and back!

site_logo

Mrsdibs79 . 2016-08-23

MORE AT TripAdvisor

I have only visited once and that was a for a Group dinner which was handled very well. I looked at the board menu which was very varied and the food I saw looked good and was well received. My own group meal was also very good. I think the main menu is at least 10% overpriced but that is nothing compared to the drinks. I ordered a a Pinot Grigio and a St Clements. £9.60!!!! I asked them to check and they said it was right. That order would have cost me £6.50 to £7 at any other of my local haunts.It is that rip off that has put me totally off going again. The ambience and the food would have enticed me back but it is the price of the drinks that left the bad taste in the mouth not the food.

site_logo

57hotmail . 2016-08-19

MORE AT TripAdvisor

Nice food and drink. Maybe a bit overpriced. Nice to sit outside in the non smoking area with the family. Will be returning.

site_logo

Jim T . 2016-08-12

MORE AT TripAdvisor

Lovely country Inn, welcoming smiling staff, offered the summer special menu, great selection of 2 or 3 courses, including prawns , steak. Fast service freshly cooked food, plenty of parking.Even though they had a pre booked table of 20 for lunch, it did not interfere with any other diners, efficient and well organised. We sat outside in the dapple shade and lovely surroundings.Excellent place, fantastic value, great staff Spot on.

site_logo

kentteam . 2016-08-10

MORE AT TripAdvisor

Nice little pub, very popular! Food was good, maybe a little over-priced for pub food but still good all the same. Would visit again.

site_logo

CharX88 . 2016-07-26

MORE AT TripAdvisor

Stopped off here whilst passing through as it looked very nice but wish i had not bothered.I opted for a all day Sunday lunch of beef for £12.90, as everything else seemed overpriced on the menu but as I am doing slimming world i requested to swap the roast potato's for new and to omit the yorkshire pudding, respectfully requesting maybe some extra veg.Three very small slices of roast beef that did not seem like they had come from a freshly roasted joint of beef,more like pre-sliced from Iceland, 5 very small new potato's and an abysmal very small shallow dish of mixed vegetables that at least did seem fresh, but for the grossly overpriced dinner i would have expected to have had more of !I sat outside as it was a beautiful summers evening and was presented with the 3 snall slices of beef and a very small gravy boat, followed by the new potato's a little while later and eventually the vegetables.I then had to wait for a request of salt and pepper and some horseradish.The whole dinner took me around 5 minutes to eat as there was so very little of it, and left me feeling still hungry and somewhat fleeced with no value for money whatsoever !Overall a very disappointing experience that i would not recommend !

site_logo

andy s . 2016-07-19

MORE AT TripAdvisor

Not sure if I came here on a off day - It was the Wimbledon mens final. Came for Sunday Lunch. I'm a pescatarian so went for the fish pie, my partner had the roast lamb. My pie was very poor value for money at nearly £13 I expected something excellent akin to Nigel Slaters smoked fish pie or something of its kind but No! It was very average with a runny sauce. The potatoes with the roast were undercooked and the meat had inedible parts. So, two main courses for £25, we didn't bother with the desserts. I'm always happy to pay for good food and wouldn't have minded the price at all had it been of good quality. We weren't meal checked until paying the bill. This is something that should be done before then. I'm going to put it down to an 'Off' day in the kitchen as clearly some people enjoy this place.

site_logo

Elizabeth M . 2016-07-14

MORE AT TripAdvisor

Was optimistic on the outside but when you go inside it is a massive let down! Awful decor, generic sticky pub tables/bar and needs a massive over haul. Service was pretty poor and at times quite rude, with no personality, something I would expect from bar staff. Also the locals kept staring, as if we was on their turf! The only saving grace was the bar snacks (garlic bread, nachos etc), but not something that is a really drawing attraction.

site_logo

Edward M . 2016-07-13

MORE AT TripAdvisor

Friends were extremely complimentary about this pub so I was looking forward to our Saturday night meal. The place was completely full which was a good sign. The staff were very friendly but clearly overworked. The food was very good but in 2016 rather boring. I had a steak. (I asked for medium rare and got medium to well). The steak was accompanied by onion rings, mushrooms and grilled tomatoes. No fault here but a bit lacking in imagination. My apple and pineapple crumble was excellent.I am sorry but otherwise than for the convince to Brands Hatch I am not sure I would go again.

site_logo

michael a . 2016-07-03

MORE AT TripAdvisor

Had a lunchtime meal in this very pleasant pub/restaurant. I had never been to this place before and now wonder why on earth I hadn't. Its very pleasing on the eye and the beautiful hanging baskets were a sight to behold. On entering the pub we were greeted by the bar staff in a very friendly manner, we said we were going to eat there and they offered to put it on a tab. We ordered are meal, there was plenty of choice especially on the specials board. I had a fish pie served with new potatoes and vegetables and it was the best fish pie I have ever had, usually they are bulked up with mashed potatoes, this pie was lovely with so much salmon, cod and prawns and a delicious white sauce, toped with cheese and a herb crust. My boyfriend had the chilli con carne, which he also said was very good. We didn't have desert as we were both full so had a floater and a calypso coffee. Would I recommend this pub, yes indeed I would. The prices are much the same as any other pub but the quality was brilliant.

site_logo

SallyJo28 . 2016-06-28

MORE AT TripAdvisor

We called in for dinner and were greeted by a friendly barman and some of his patrons. A tasty dinner was served quicky. What more could you want?

site_logo

cremoinfo . 2016-06-28

MORE AT TripAdvisor

Food is to high standard, lovely old pub n staff are really nice. This is my 3rd visit and each time I've been impressed. Will continue to visit

site_logo

mannsrus . 2016-06-26

MORE AT TripAdvisor

Typisch Engels pub. Ruim donker en .gezellig.. niet te duur en vriendelijke service. Typische Engelse maaltijden. Lekker én niet duur

site_logo

Luc V . 2016-06-11

MORE AT TripAdvisor

been here two sat lunch times in the last four, my wife had fish n chips and I had the sea bream with king prawns,everything was cooked to perfection and the service was spot on,will be back soon

site_logo

andy k . 2016-05-09

MORE AT TripAdvisor

We enjoyed a very nice family meal for five on a Saturday evening.The presentation is impeccable and the food extremely tasty. There are plenty of meat and fish dishes to choose from.Gluten free choices are clearly marked which is great. Unfortunately there was only one gluten free starter and a lack of desserts for me.Overall a very good evening but missed out on five stars as it was far too hot and stuffy in the restaurant.

site_logo

Corinne H . 2016-05-02

MORE AT TripAdvisor

I love this place, everything you can expect from a local, country pub. In the winter they have real fires, it has such a beautiful atmosphere. In the summer it is a suntrap, perfect for al fresco! The staff are amazing and very friendly nothing is too much trouble. The food is always spot on and is definitely my most favourite place to eat.

site_logo

Katie W . 2016-04-22

MORE AT TripAdvisor

A nice, warm old school country pub, with pleasant staff attending to our table. A good choice of dishes on the menu and good beer (good pint of Doombar), however I gave this experience an average because my starter (mussels gratin) had to be sent back as it was stone cold.

site_logo

SuperKPD1 . 2016-04-14

MORE AT TripAdvisor

Fabulous food, staff very friendly, had a very good night, Fish menu is very extensive, the specials were varied

site_logo

Karen F . 2016-03-15

MORE AT TripAdvisor

Food was good, as was the service and price. Not complaints. Quite an old school pub, but we like that. London Pride and Directors ales on draft.

site_logo

gppowis . 2016-02-28

MORE AT TripAdvisor

Went here last night with my partner, have popped in for a drink over the years but haven't eaten in there for around 4 years. The food was amazing and best customer service i've had in ages!I had the 16oz T-bone steak with all the trimmings and my partner had the sea bream and king prawns, both meals were of a great size and of great quality.Would highly recommend this pub/restaurant, great customer service and great food will be back for sure!

site_logo

Mike M . 2016-02-25

MORE AT TripAdvisor

We really enjoyed the atmosphere of this old pub, enjoyed reading about the history in one of the wall hangings. The staff were super friendly and the service was good. Although we enjoyed our meals we did find the portions quite small for the price add didn't come away totally satisfied. However high rating for the ambience and staff.

site_logo

BeaksLondon . 2016-02-21

MORE AT TripAdvisor

You always take a bit of a gamble returning to somewhere after 20 years!My wife and son returned after a very long absence having moved away many years ago. What a pleasant surprise, local folk enjoying their local pub and welcoming mid week "strangers" to their domain, thank you!The food was as good as ever, a good choice of well prepared and well presented food. A pub base with a restaurant angle that is pitched just about right. The Rising Sun deserves to continue to succeed, pleased to have returned and been so well catered for!

site_logo

Robert S . 2016-02-21

MORE AT TripAdvisor

Staying at nearby Brandshatch hotel, went into nearby village and found this diamond of a pub.The reviews for this place were good and they definitely lived up to its name.Restaurant was extremely busy ,we had to wait 30 minutes which was fine as I was able to drink a pint of the local Fawkham Guzzler . Eventually seathed II went for one of the dish of the day offers,the smoked haddock, superb. The food order was taken and delivered by The same lady of mature age ,she was very friendly and helpful with the menu.Would recommend to others but get there early

site_logo

Mike H . 2016-02-15

MORE AT TripAdvisor

The Rising Sun is a lovely local's village pub with fantastic food and amazing staff. The setting and atmosphere of the pub is cosy and welcoming, especially in the winter! The landlady is amazing and you always see familiar faces which is clearly testament to the place. I would strongly recommend a visit!

site_logo

James D . 2016-01-13

MORE AT TripAdvisor

My Mum and Dad have always loved this pub and even though my Mum died 13 years ago my Dad is still a regular. He took our whole family there for his 75th birthday and it was lovely. The menu was comprehensive without being over the top - a nice mixture of roasts, steaks, traditional English fayre and fish. I had smoked salmon, which was lightly dusted with paprika, which was delicious, followed by seabream. The steak and kidney pudding looked really tasty and I will certainly be returning for a roast. Our party of 12 was served promptly and really well. The pub itself is quite small, so can get rather congested but head there on the right day it's lovely to get a seat by the fire.

site_logo

1967BSN . 2015-12-30

MORE AT TripAdvisor

We had an enjoyable dinner with friends here between Christmas and New Year, the restaurant wasn't particularly busy so the service was excellent. There's an extensive menu to choose from, including about 8 or 9 fish main course dishes. It's a bit more than 'pub grub', a bit short of gastro dining but nonetheless very good.

site_logo

DrDarwin . 2015-12-28

MORE AT TripAdvisor

I came for lunch, with a large group of 12, and the staff could not have been more helpful and efficient. The pub does reasonably good pub food? I had a generous sweet and sour scampi starter, followed by lambs liver and bacon. The waitress brought an extra dish of liver and bacon, because two of us had small portions, by mistake. It was more than enough.

site_logo

dvdgurr04 . 2015-12-03

MORE AT TripAdvisor

Not been here before but would return. Visited for lunch with a friend. We both had the omelette which was very tasty and with the chips and garnish was very filling. Open fire in pub area which would be lovely on a cold winters day.

site_logo

JPA-2009-SEA . 2015-11-08

MORE AT TripAdvisor

What a poor standard, food was to say the least very average in its quality, it's was warm not hot due to waiting 10 minutes for vegatables after the main course had been put in front of us.One of our party didn't receive their meal until 30 minutes after the rest of us had finished.When we asked for the bill it wasn't itemised so we questioned it and asked for an adjustment due to the discusting service, the bill was adjusted on the food by £3 and the drinks increased by £3.The attitude and verbal of the manager / owner was I don't care plenty of other people if you don't like it don't come back.No I won't but I will be contacting trading standards and forwarding both bills to them as on checking the menu that I photographed we were over charged.Go to the Rising Sun at your peril it's the most discussing service I've received ever.

site_logo

Rob S . 2015-11-07

MORE AT TripAdvisor

You must try this restaurant, cozy atmosphere, great service,can't praise the waitress Debbie enough attentively served us the whole evening, and the food what can I say superb.

site_logo

Caroline H . 2015-11-07

MORE AT TripAdvisor

Had an impromptu stop here whilst out cycling and couldn't resist having lunch. Fabulous choice on the printed menu then even more on a specials board Very friendly staff and lovely ambience. Not cheap though.

site_logo

AngGravesend . 2015-11-06

MORE AT TripAdvisor

Taking here by a friend who visited regularly. Lovely pub and would be especially nice in the winter as they have an open fire. The staff were friendly and the food was good and plentiful. Would visit again.

site_logo

SEA-2009-JPA . 2015-11-05

MORE AT TripAdvisor

Ok but service not as good as my previous visit considering it was pretty quiet. Pleased with food choices but will give it a miss for a while as expensive £20 plus per head for two mains for the service and tired surroundings. P

site_logo

sam2319 . 2015-10-19

MORE AT TripAdvisor

We stopped here for a spot of lunch during the week, we ate in the inglenook restaurant which is really just a dated and tired part of the pub.Service was polite but food was slow to arrive considering the amount of people there. The food is ok but priced far too high for the type of dining experience you have. I wouldn't return as there are many other pubs around which in my opinion exceed this one offering food at a better price and standard.

site_logo

david p . 2015-10-13

MORE AT TripAdvisor

Recommended to and table booked by Jackie at The Old Stable Yard. Cannot recommend this venue highly enough. What appears at a glance to be an olde world pub with a dining area is so much more.The food is outstanding, the selection is just enough to keep you interested with a few standard pub dishes but some stand out dishes that were cooked to perfection.Thank you to all the staff and Chefs who made our dining experience an awesome one.

site_logo

Mike G . 2015-10-13

MORE AT TripAdvisor

Fantastic staff who couldn't do enough, Great selection of food that tasted perfect, wonderful feel and décor. Cant wait to re-visit..

site_logo

rich5452015 . 2015-10-05

MORE AT TripAdvisor

Food is average,nice but not fantastic.Some meals are dearer than other places in the area.Staff okay,nice pub.Other local pubs for meals are better and serve food all day.

site_logo

Labras4 . 2015-10-04

MORE AT TripAdvisor

I recently went to the rising sun for a Sunday roast. The food was lovely, but you may find yourself waiting for over half an hour for your food. However, it is worth the wait.Check the bill carefully as they added ours up wrong twice!!!!!!All in all, a really meal. ☕️

site_logo

Izzy F . 2015-09-28

MORE AT TripAdvisor

We had a really great meal here. The food was delicious and served by enthusiastic and well trained staff.We both had mussels followed by skate in butter sauce and I had the spotted dick pudding to follow. The beer and wine were also very good. This is high end pub food at its very best.Thanks to all for a great evening. There was a buzz about the place and the owners and staff were excellent.

site_logo

grumbleweed1 . 2015-09-16

MORE AT TripAdvisor

I have to commend tthe Rising Sun for many things. friendly service, nice atmosphere, quality food but a limited vegetarian menu. the overall pub is warm and inviting with the restaurant almost hidden away giving it a little exclusivity. The menu seemed initially expensive but you get what you pay for and the quality could not be faulted. As a starter I would recommend the duck parcel a joy to behold that lives up to expectation. worth a venture off the beaten track.

site_logo

snap65 . 2015-09-15

MORE AT TripAdvisor

We had to book early as very popular although not cheap, we had great food, well cooked and hot. We have been a number of times and always had good food with friendly and helpful staff, good range of beers and also has accommodation if required on site

site_logo

ChelmsfordPhilm . 2015-09-14

MORE AT TripAdvisor

Used to live in Kent, hadn't been to a Kent pub for years.What a great revisitation on my part! There was a even a good guitarist/singer on. Very friendly pub/staff/customers and good food too. They even have Doom A&R on draught! The next time I see the mate who lives nearby I will definitely suggest we come back here.

site_logo

OrgasmicCry . 2015-08-28

MORE AT TripAdvisor

Recommended to eat here by our friends. The pub was very busy, so glad that we booked a table. Food and service was very good. Lovely friendly atmosphere. Tip: Make sure that you pre-book taxi, especially on a Sat night!

site_logo

Linda L . 2015-08-23

MORE AT TripAdvisor

We had a table booked at 7.30 there were many items on the menu thet they had run out of. It didn't effect us but the favourites had gone!!Shows how popular the restaurant was.

site_logo

Flavell63 . 2015-08-15

MORE AT TripAdvisor

a friendly village pub overlooking the village green with cheerful helpful staff serving fantastic home cooked food in both the restaurant and bar with a great range of real ales and wines food served all day

site_logo

Chrisscudder . 2015-08-13

MORE AT TripAdvisor

Use this place a lot, good food in the bar or restaurant , friendly staff can't ask for more really, reasonable prices ......

site_logo

carolpri . 2015-07-26

MORE AT TripAdvisor

Have been here a few times and have to say the food has become boring overpriced and a very sad menu, specials are nothing special. What happened to good pub food. The presentation is awful and greasy. Ploughmans is the smallest piece of sprinkle with water and oven bake roll a mean slice of sometimes very discoloured ham and cheese, if the burgers are home made then so are mcdonalds and they are full of fat. Sausages are burnt to a crisp, potatoes come out lumpy and have just been micowaved, fish is really awful. The only thing they do well is a sandwich if the bread is not stale. The staff are very nice. This nice pub is let down by a very expensive and stale menu.

site_logo

Amanda J . 2015-07-22

MORE AT TripAdvisor

What a lovely pub. Atmosphere and stuff was fantastic very friendly lots of seating area inside and out.walked into two lovely women behind the bar straight away we were being served.ordered our drinks and was told we could sit anywhere we wished as we had asked if food was still being served as we didn't get there till 4ish.we sat in a small area near the bar and started to look at menu. Everything sounded nice and they also had a fish menu on the wall that looked very appealing but we went with the roast 1 having lamb 1 having turkey.other options where nut roast and beef.ordered at bar and within 10mins our dinner was on the table and it didn't stay there very long. All I can say is YUMMY. Very reasonable prices. I will definitely be going back and telling lots of people about."I want to try everything on the menu"

site_logo

Dionne Y . 2015-07-21

MORE AT TripAdvisor

Local pub to us and in the past had very good meals but in last few months service has been poor and the menu is very dated. In last year pretty much hasn't changed. Now going to other local pubs where better value for money and selection.

site_logo

Graham N . 2015-07-12

MORE AT TripAdvisor

Very disappointed, in the past we have had some great meals. Terrible food and service, everything seemed to of been reheated and greasy, except the soup which was cold!! Couldn't get out quick enough, can only think it has changed hands!! It was expensive bad food :(

site_logo

Cozawoky . 2015-07-05

MORE AT TripAdvisor

Went here for Sunday lunch. Quite busy as the weather was lovely. Sunday lunch was very nice. Reasonable prices. Probably wouldn't write home about it but would definitely return.

site_logo

rustonkaren . 2015-06-23

MORE AT TripAdvisor

Four of us have just had a very enjoyable lunch in the Inglenook restaurant (not sure why Ester H had problems). We were going to eat in the bar but were told we could have choice of all menus in restaurant. Our meals were plentiful, nicely presented and hot. Attentive Staff. It wasn't very busy so cannot comment as to how it would be if it was busy. Two of us have often had lunch in the bar. Meals are substantial and well cooked. The seafood platter to share more than enough. Baguettes large enough to share with a bowl of chips. Close to Brandshatch and there is accommodation on offer at the Rising Sun as well.

site_logo

holseateriesrus . 2015-06-22

MORE AT TripAdvisor

My partner and I were staying in one of the local hotels but unfortunately when it came to dinner and me being a fussy eater, I didn't fancy anything on their menu. My partner looked online for other places to eat and found this restaurant near by. After looking at the sample menu online, we decided to give it a try and we are so glad we did. The food here is so delicious! We had starters and mains and trust me if we could have fitted in dessert we would of but we were just too full!The staff were really friendly and the service was very prompt. We left feeling very full and completely satisfied with the whole experience! Definitely value for your money unlike most places!If your passing by, you should definitely go in! Thank you for a gorgeous meal!!!

site_logo

CMS019 . 2015-06-21

MORE AT TripAdvisor

Basic worse than home cooked food evidence of microwaves being used in kitchen with slow service and expensive for what we had wont be going again

site_logo

Esther H . 2015-06-20

MORE AT TripAdvisor

Very friendly pub with good food. Numerous visit and always reliable. Main menu may be taken in bar or restaurant. Pub food is bar only. Good value with generally prompt service. Log fire in winter and cosy all year.

site_logo

Hotfrog99 . 2015-06-09

MORE AT TripAdvisor

We have eaten here a few times now. Food has always been consistently good. Staff were very helpful in adapting a dish for my fussy child.

site_logo

Jools1404 . 2015-06-04

MORE AT TripAdvisor

I dined at the Inglenook restaurant and was not disappointed. My starters, three giant plump prawns swimming in a garlic, chili, and lemon butter sauce, accompanied by well-made garlic bread and a generous pinch of microherbs, was mouthwateringly delicious. For my main, a 16oz rare steak did the job nicely, and the trimmings - home-made onion rings, grilled tomato and portobello mushroom - all had depth of flavour. The chips were crispy on the outside and light and fluffy inside. Sad to say, after that lot I was unable to fit a dessert in. Waitress Sam (?) could not have been more helpful.One minor point: why play commercial radio as the soundtrack to this high quality of food? The music itself hit the right note, but the news, traffic reports, DJ woffle and car insurance adverts, less so ... 'nuff said - but easily fixed.

site_logo

FoodieHugh . 2015-05-05

MORE AT TripAdvisor

Over all the weekend was great.staff were really friendly and helpful.we had room five which had a four poster bed which was very comfortable food was good but a little expensive.we were also charged £90 a night instead of which we were told on booking the room it was £80 a night .Another phone call later we were given our £20 back

site_logo

Graham G . 2015-04-22

MORE AT TripAdvisor

Scampi a Gooey mess. Chewy, Luke-warm. Could not eat it. We were hurried out of restaurant area although not near closing time. Perhaps other dishes are better. Maybe we visited on a 'bad' night.

site_logo

Lynda G . 2015-04-15

MORE AT TripAdvisor

Love this pub, location and staff. But fodd and menu need revamping. Good is not as nice as it used to be and had same menu for quite some time so we have stopped going recently which is a shame. Also decor could do with updating as its been the same for some time and not as modern as other places nearby

site_logo

Stacey W . 2015-04-14

MORE AT TripAdvisor

We stopped here after a busy weekend at the BTCC races. There were 3 of us. This is a typical old pub with a dining area. The service was slow but since we were on vacation it was not a problem for us. We started the meal with salads and crusty french bread. The green salads were baby lettuce with julienne bell peppers, zucchini and cucumbers. The salad is not dressed and you have to make a special request if you want dressing. There is a menu and a board with daily specials. For mains my daughter ordered the daily special of caprese salad. The serving was large enough to be a main meal for her as she is a light eater. I had a chicken pie which was served in a deconstructed manner. It was nice and was served with new baby buttered potatoes and a trio of fresh vegetables, broccoli, carrots and red cabbage. My husband had a Tbone steak with chips and he had an apple tart and ice cream for desert. The produce was exceptional and I understand is locally sourced. We felt that for the amount of food we ordered the bill of 61 pounds was very reasonable. We would go there again.

site_logo

Rmeen022 . 2015-04-13

MORE AT TripAdvisor

We were a family party of six, plus one four-year old, for Sunday lunch. I should add that this pub welcomes children only when they are well-behaved and kept under control - I wish more pubs would follow this example.The menu ranged between a choice of traditional roasts and a-la-carte items; all were excellent, including the child's roast dinner.Although it was not our intention to stretch to three courses, the quality of the food induced us to sample the cheesecake, profiteroles and ice cream.Service was friendly, efficient but unhurried, and courteous.Prices were pretty much what one expects to pay for a Sunday lunch in a pub.Altogether, we could not find fault with any aspect of our visit; the management are clearly working extremely hard to make sure the Rising Sun represents the very best of its kind. If you are looking for a traditional pub restaurant serving unpretentious food on real china plates (as opposed to unhygienic slates or wooden boards), look no further.

site_logo

Peter W . 2015-03-30

MORE AT TripAdvisor

I am usually quite nervous about eating fish in a restaurant following several unfortunate meals in good restaurants both in UK and Jersey ( all in highly rated establishments.) However without fail the fish I have eaten here has been excellent. We have chosen most dishes off the menu over the years we have been visiting this restaurant, and often bring friends with us, always well served by attentive staff. I do not hesitate in recommending The Rising Sun.

site_logo

Susan T . 2015-03-17

MORE AT TripAdvisor

Just spent the afternoon here for Mother's day lunch. Food, service, atmosphere, prices... excellent. They must have seen Mr and Mrs Duck paté coming in Nov 2014. How any one could have had such a bad experience here I'll never know, but as my title says 'there's always one' ;) well done Rising Sun Inn for making my Mothers day lunch sooooo good!!

site_logo

Barbara A . 2015-03-15

MORE AT TripAdvisor

Staff were helful and the food was adequate although we would have liked a slightly wider choice. Wine was reasonable and value for money OK . We will return here.

site_logo

brianwjelley . 2015-03-04

MORE AT TripAdvisor

Food was good, log fire very welcoming on a cold day.Only problem was lady behind bar (landlady???) was not so welcoming.Don't thing she was having a bad day as we have been before and she was much the same. Why be in business when you deal with the public??? I am in business and would never speak to people like she does Bad attitude!!! Shame really when the other ladies are very nice.

site_logo

sandra T . 2015-02-26

MORE AT TripAdvisor

We had a meal and the food was superb the staff were friendly and the service goodThey had load of choice on their specials board and we could not fault this little gem Highly recommend

site_logo

Lalamandi0308 . 2015-02-21

MORE AT TripAdvisor

Stopped in for lunch on Saturday: fish and chips, chicken wrap, mixed fish grill - all very good. Quite broad range of food options. Lovely setting and really friendly hosts. Felt like a very welcoming local. Definitely recommend - proper English pub.

site_logo

MCP247 . 2015-02-18

MORE AT TripAdvisor

4 of us had an excellent dinner at this pub/restaurant.The food service and general ambience is absolutely first class.Very good selection of beers and very good choice of food.I had the beef and mushroom pie which was delicious.My wife and friends thoroughly enjoyed there meals.Highly recommended.

site_logo

Kenneth Keith C . 2015-02-12

MORE AT TripAdvisor

Similary restaurants in South East

restaurant_img
3.5

777 Opinions

location-iconHever Road
Other cuisines
outdoor_seating_171207takeaway_171207delivery_171207

Brilliant Place ! Highly recommend to visit! , Friendly Service ;-) Nice atmosphere Ollie is the BEST Host .... I been visiting with friends and staying at Hever Castle B&B and we decided for a dinner at this pub then at closing time local taxi companies was not willing to take us back to our accommodation as been too busy... and Ollie SAVED us :-) Top Man ...! Will definitely coming back again , and my friends who was 1st time in England and staying in London before this countryside visit was very impressed with English Hospitality... Many Thanks! Alex

restaurant_img
3.5

46 Opinions

location-iconKnole Park
Other cuisines
outdoor_seating_132996takeaway_132996delivery_132996

Add coffees before we went around the house and there were plenty of tables both inside and outside. Having visited the house we then went back for some lunch and had a variety of items from the menu. All items were very tasty and well presented. The staff on the counters were fine. They could’ve been a bit more efficient doing hot drinks when there was a big queue, else food and service was really good.

restaurant_img
3.5

8 Opinions

location-icon5 Carlton Parade, St John's Hill, Sevenoaks TN13 3NZ England
Other cuisines
outdoor_seating_241749takeaway_241749delivery_241749

I had a couple of hours to kill while on business in Sevenoaks, and fancied an all day breakfast. I googled and found this little place off the beaten track (didn't want to pay for parking!). Really tasty full English breakfast and a good cup of coffee, and ever so great value at £8.00. Maybe not the greatest venue, but definitely worth it for the food.

restaurant_img
3.5

19 Opinions

location-iconMain Road
Other cuisines
outdoor_seating_186313takeaway_186313delivery_186313

I’ve been going to this cafe on and off for 10 years. I have to say my experience has gone downhill since Covid. My recent visit has been very disappointing . I ordered a Spinach and Mushroom Quiche with salads. First of all, the Quiche was still frozen in the middle. Secondly, I didn’t even have time to argue because my daughter has been stung by a wasp. Totally understood this is normal in warm weather but the Cafe’s reaction has been shocking. I went to the counter to ask for some ice. It took at least 5 mins for the waiter to get it despite I can see a bag of ice lying on the table with 1 waitress standing next to it chatting to another lady. I asked can someone just give me the ice as my daughter is crying in pain. I was told someone has gone to get first aid and they can’t “just give me the ice”. After another 5 mins, the first aid has finally showed up. After asking what happened, his words are: oh…..I’m afraid there is not much I can do. I said can you grab me some ice please? It is at that point we finally got the ice!!! I washed my daughter’s wound with some soapy water after a quick google on what to do. I’m not a fully qualified first aid by no means. The cafe has an outside sitting area and wasp sting would be very common. Pleas train your staff on what to do or get some wasps trap like Polhill did. Very disappointing and I would have to end my visit after 10 years. Service standard has gone down too. Most of them look like they don’t want to work there and have a terrible attitude.

restaurant_img
3.5

278 Opinions

location-icon64 High Street
Other cuisines
outdoor_seating_201281takeaway_201281delivery_201281

Costa Café is a gem! From the moment we walked in, we were welcomed by the friendly staff, especially the one with the amazing tattoos, Nina--they were so warm and attentive. The atmosphere felt relaxed and inviting, with locals chatting and even offering great suggestions on places to visit and things to do in the area. The coffee was perfectly brewed, and the treats were delicious, making it the ideal spot to relax and recharge. Highly recommend stopping by for a cozy, welcoming vibe and top-notch coffee!