GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 2.204 opinions finded in 3 websites

site_photo4

Nº 744 in 2913 in Edinburgh, City of

Nº 89 of 413 British in Edinburgh, City of

CUSTOMERS TALK ABOUT DISHES WITH..applesausagechickenpiemustsnackpotatomacaronicoffeemeatsteakcheesepastryspinachroll

comment_iconOpinions

Precio asequible, buen servicio, y pastel maravilloso. Este lugar está en el puente sur y es hasta la tierra, fácil de encontrar y los pasteles son maravillosos. Eso es todo lo que hay que decir, así que como tengo que escribir 100 palabras, estoy gofreando como un idiota por el resto de ella

site_logo

LobbyGobbler123 . 2025-04-16

MORE AT TripAdvisor

Sugerido a mi hermana y a mí por un pariente que visitó Edimburgo recientemente, fuimos a The Piemaker para algo rápido, un viernes por la noche. Gloria en el mostrador no solo era útil, sino que también estaba muy interesado en explicar recetas y sabores. Ella era habladora, tanto como nosotros, y nos dio información adicional sobre cosas que estaban pasando en el centro de la ciudad esa noche, música en vivo y así sucesivamente. Los pasteles eran bastante buenos y aquí es donde tuve mi primer pastel de haggis apropiado.

site_logo

Orestis E . 2025-02-24

MORE AT TripAdvisor

Una parte fiable de cualquiera de mis visitas a Edimburgo. Bien situado junto a algunas paradas de autobús vagamente útiles, esta panadería barata y rápida me introdujo en los pasteles de whisky y sigue siendo uno de los mejores ejemplos de todo. Las pastas también son bastante buenas.

site_logo

tripleplay97 . 2025-02-02

MORE AT TripAdvisor

Solo uno rápido para aquí, pero este lugar sirve pasteles absolutamente preciosos, rollos de salchichas y otros productos horneados. Permaneció abierto durante una de las peores tormentas que azotaron Edimburgo, es un pequeño lugar lindo tipo, pero la comida era fuera de este mundo, agradable, cálido y a un precio muy razonable, es más de llevar - fuera que comer en tipo de lugar, pero ciertamente no me arrepentí de comer allí, un montón de comida tradicional y clásicos que conoces y te encanta y no demasiado lejos de la Royal Mile. Sin duda, a pocos pasos de los Greggs cerca.

site_logo

JustinPetersen . 2025-01-31

MORE AT TripAdvisor

It’s good for the price, I cannot say that it was incredible but for the price it is really a cheap and filling lunch!

site_logo

Selin Kaya . 2025-01-09

MORE AT Google

Small low key place with friendly staff and super tasty food. I don’t think you need more than that! Great to stop in for a quick bite or to take with you.

site_logo

Julie Cantrell . 2025-01-09

MORE AT Google

Great pies at great prices, a range of traditional options available. Great staff as well.

site_logo

Nikz . 2025-01-04

MORE AT Google

A spot to fulfill all your pie cravings. They have a bit of everything. Serves soup too

site_logo

Declan . 2025-01-02

MORE AT Google

13:44 on 2nd January 2025 Scotch pie and soup. Spot on.

site_logo

Glen Woolmore . 2025-01-02

MORE AT Google

Lovely service and extremely delicious food. Can recommend the steak scotch pie and traditional pasty.

site_logo

Bára Olšáková . 2024-12-07

MORE AT Google

nice place for a quick bite to eat near the royal mile

site_logo

Niaina Valisoa Ranaivo-Harisoa . 2024-12-04

MORE AT Google

Honestly, the apple turnover fresh out the oven has left me shook. I’ve seen the mountaintop. Nothing will ever be the same. 5 stars.

site_logo

Tom Strangward . 2024-11-30

MORE AT Google

Spontan hatte ich Hunger und Lust auf schottisches Fastfood. Da passte mir ein-zwei Pies sehr gut. Diese hier waren sehr schmackhaft und sättigend.

site_logo

bloodflowers01 . 2024-11-22

MORE AT TripAdvisor

Very good pie for the first day

site_logo

Guillaume Tardy . 2024-11-17

MORE AT Google

Amazing place if you are in hurry or need a little brake on your adventure in Edinburgh. The people working here are super friendly and the prices are good. They have soup of the day if you need something warm and great selection of tasty pies (chicken and mushroom is my favorite). Totaly worth visit at least once!

site_logo

Mariana Henzlová . 2024-11-08

MORE AT Google

really good pies! hot, flaky and tasty!

site_logo

Mark Seow . 2024-11-06

MORE AT Google

Absolutely amazing for a pie and a sausage roll!

site_logo

Trae . 2024-11-04

MORE AT Google

Excellent value, nice pies and pastys

site_logo

Benjamin Daly . 2024-11-04

MORE AT Google

Very, very tasty pies that are not overpriced.

site_logo

Tanja Wokitsiel . 2024-10-30

MORE AT Google

Very delicious and good price! Really close to Old Town and many varieties.

site_logo

Alexandre . 2024-10-27

MORE AT Google

The 'last of the batch' pasty we got at 9pm was so good that we went back again in the morning for something fresh! It did not disappoint

site_logo

Kieran Reck . 2024-10-26

MORE AT Google

Unrivaled amongst street food options in the old town, super tasty, filling, fresh and well priced

site_logo

Eva Butkovičová . 2024-10-24

MORE AT Google

It’s so cheap. I had Chicken Mushroom and Traditional Scotch, and the two together came to 5.4 pounds. The chicken has a creamy stew inside, while the scotch has large meatball-like meatballs inside. But it tastes like a lot of flour mixed in. Overall, it was salty, but considering the price, it was delicious.

site_logo

Seungchan Park . 2024-10-20

MORE AT Google

The Coffee will keep you coming back and breakfast treats are dunk able! Delicious ✌🏻✌🏻✌🏻

site_logo

Robert Moore . 2024-10-14

MORE AT Google

Nice place and very testy pies. Haggis and original scottish pies are recommended by me. But macaroni pie is something weird for me :) It's just pie with macaroni and chees

site_logo

Neuron N . 2024-10-10

MORE AT Google

The best pies and pastries, I wish I would have gotten more during my trip to Edinburgh because I'm still craving their food days later.

site_logo

Sterling Fraser . 2024-10-09

MORE AT Google

So good , amazing service , alot of choice , fresh and good

site_logo

Mw N . 2024-10-07

MORE AT Google

Tattie dogs! 😃 Haggis pie, mac n cheese pie also top notch.

site_logo

Rory Jordan . 2024-10-07

MORE AT Google

It's a great little place in Edinburgh, which is very affordable. Lovely service, very friendly. Highly recommended!

site_logo

Ramon Eriks . 2024-10-05

MORE AT Google

Cute shop to enjoy local Scottish pies. Tried traditional Scottish pies and a hot chocolate while looking out the window enjoying the Lothian bus ride past as well as pedestrians. I'd say it's a place to have a chill morning breakfast.

site_logo

Sylvester Philip Adu-Gyamfi . 2024-10-02

MORE AT Google

For a quick lunch it’s great! Everything is delicious! The meat pastas and other puff pastries are extra fresh and very generous The welcome is perfect, the young lady is adorable :) thanks to her I recommend

site_logo

Corinne Sarda . 2024-09-30

MORE AT Google

great place to taste traditional pies, with 1/2 pie you'll already be full, it's very cheap and has a wide choice of both meat and vegetarian/vegan options. The desserts are also very good, we tried the turnovers with apple

site_logo

I. R.E. . 2024-09-27

MORE AT Google

We discovered "The Pie Maker", pleasantly surprised by the variety of pies offered. The prices are very affordable, making it a great option for an affordable snack I particularly enjoyed the haggis pie, a local specialty that is worth trying The only downside would be the lack of indoor space in rainy weather, but it's definitely worth it

site_logo

Roux Christian . 2024-09-26

MORE AT Google

The flavor is magnificent! It's totally worth it!

site_logo

Ana Giulia . 2024-09-24

MORE AT Google

Nice little bakery, good variety of vegetarian and vegan options! The vegan haggis roll and spinach vargas were very tasty

site_logo

Jade Davies . 2024-09-24

MORE AT Google

Great place. We took different pies to try and all were good but my favorite was deffenately with haggis, my kid had a sausage roll what was also delicious and he got a chocolate cake or something as a gift anf it was also delicous

site_logo

Kärt Kann . 2024-09-14

MORE AT Google

Surprisingly good pies and a friendly, helpful guy at the counter to serve us. We were at least partially prepared for it to be an overpriced tourist trap because of the location but the pies are amazing. They were flavorful and the crust was flaky.

site_logo

Adam Mamrak . 2024-09-08

MORE AT Google

Stumbled upon this place during Fringe and basically dropped by everyday I was walking back from shows back to my hotel. The variety of pies and pastries is a marvel, and all pretty fresh and reasonably priced. I knew if I had £2 piece in my pocket I could count on a filling snack. Vegetarians (and even vegans) will find the availability of choice surprising and welcome. I tried something different each time I went and was never disappointed.

site_logo

Yuh Wen Ling . 2024-09-06

MORE AT Google

4.0⭐. We are international travelers. This shop was the one we looked for before visiting Edinburgh. The food is cheap and delicious. The food seems to be usually kept warm, and the meal comes out quickly, faster than fast food. It is a pie that has been made, but the crust is still very crispy. We ordered STEAK SCOTCH PIE 💰 £3.5, which is like a stewed beef puff pastry pie. The taste is not too strong, and the salty flavor of the stewed beef is the main one. There is also CHICKEN & MUSHROOM PIE 💰 £3.2, the chicken and mushrooms go well together, it tastes milky and sweet, and is delicious but not greasy (there are photos for reference). As for the environment, this place is actually more of a takeout shop, with fewer tables, and please note that the tables are a bit sticky. In addition, I changed the business hours, but it was not adopted by Google map. I took a picture of the business schedule, hoping that no passengers would be misled. 20240804

site_logo

Chang B. . 2024-09-06

MORE AT Google

Un local pequeñito pero con unos pasteles de carne exquisitos. Pedimos varios para probarlos y todos estaban muy muy buenos. El chico que nos atendió fue bastante amable, nos aconsejó un poco. Y el precio, bastante económico. Muy recomendable.

site_logo

Alfonso C . 2024-09-02

MORE AT TripAdvisor

Perfect place for a quick snack or dinner. Lots of options even shortly before closing. Tried many vegetarian and vegan pies, all were fresh and warm. We went there almost every day during our stay in Edinburgh

site_logo

M W . 2024-08-27

MORE AT Google

We grabbed breakfast here on our way out of Edinburgh and got the apple raspberry turnovers, the cheese and onion, the potato and herb, and the steak and ale pie. All of them were absolutely phenomenal, especially the cheese and onion. 12/10 would eat here every day if we could!

site_logo

Sierra Anderton . 2024-08-27

MORE AT Google

Went there twice a few years ago while I was visiting Edinburgh. Food was excellent. Everything on the menu was great. Had a rather uncomfortable interaction with a worker (or perhaps he was the owner I don't know) over how to pronounce the word Pasty (Paas-tee vs Paste-Tee) The worker was condescending enough he had to tell me that a paste-tee is a nipple cover (this was weird) and that I should learn this if I want to speak proper English. I am Asian American. I am also tri-lingual along with a few college degrees. We were speaking in English the whole time but I guess my Asian face was demanding a free English lesson from a piemaker. My wife, who is Caucasian, didn't get the same lecture even though she said the same thing. Not sure why. Learn to respect your customers. If I did not know how to pronounce some words the way you do, try to be polite. No need to be a douche.

site_logo

Numm S. . 2024-08-22

MORE AT Google

Casual place with fast tasty food. The food is rich, as one would expect with Pie in the title name, but if you can indulge, everything we tried was scrumptious-- chicken pie, beef ale pie, cherry turnover and apple raspberry pie. We had a good time eating and watching people out the windows. The owner(or staff) there was super friendly and helpful.

site_logo

Morelia H . 2024-08-22

MORE AT Google

This is an amazing place if you want to taste authentic Pies. The taste is really good. It's like a warm welcome on a cold day. You should definitely try the Stake Ale Pie and the Haggis pie. All of their Pies are served hot and fresh. The drinks are simple. Sitting is limited. But it's open late night on Fridays and Saturdays which is cool. For my Indian friends - in case you eat everything like me, you'll enjoy the food here. There are vegetarian options, but then the menu gets limited. But either way it's much more refreshing that the chicken patties we get back home.

site_logo

Anirban S (an1rb6n) . 2024-08-21

MORE AT Google

A great pie shop just a short walk from Waverley station. Tragically they had been cleared out of a few menu items though we found the Chicken and Mushroom Pie and the Sausage Rolls faultless! Amazing value for money and would highly recommend. Limited space inside the shop. Thank you Piemaker!

site_logo

Ben Barltrop . 2024-08-20

MORE AT Google

Cookie was thin and hard as if it had been sat for days, ask for a cup of tea to take away and was given hot water with a tea bag in and the words 'id love to offer you milk but we've run out' I said I wouldn't have bought it if I knew they had no milk, he then gets some from the coffee machine which he literally had to scrape out, when I asked for a lid, he went searching, no kids, so I had a really tough walk through the cobbled ram packed streets of Edinburgh during the festival with a cup of tea. I would NEVER go back there again! Be up front with customers before you serve them otherwise you'll get more reviews like this!

site_logo

Frank Conlan . 2024-08-18

MORE AT Google

Large selection of pies at good prices. However very minimally filled with protein and largeky gravy. Dissapointing

site_logo

Debby Markovic . 2024-08-17

MORE AT Google

La selección es diversa: pastelería tradicional, tartas de olla y vegetariana. Pasteles horneados frescos todo el día. El servicio es muy amable Situado a solo unas cuadras al sur de la Royal Mile.

site_logo

Rieka L . 2024-08-10

MORE AT TripAdvisor

Exceptional and phenomenal pies and pastries by this establishment. Unfortunately, the steak and ale pie ran out by the time we came here, so we opted for the Chicken and Mushroom Pie and Steak Scotch Pie instead. The Chicken and Mushroom Pie was absolutely delicious and phenomenal. Without a doubt, one of the best pies we’ve ever eaten! Flavour was overflowing, and the crust had a great texture. It is very clear that it is a popular shop as there were many customers and the pastries ran out when we went! There are limited seating areas as well, so you can relax and enjoy the pie if you are lucky.

site_logo

Nahshon . 2024-08-05

MORE AT Google

Very affordable pies and other goodies. The pies were very delicious and come at a low price so I’ve tried multiple ones. The steak pie was my favorite but not the biggest fan of the scotch pie. Otherwise a great shop when you just want to grab something quick for home but don’t want to go to a restaurant.

site_logo

Wai Man Cheong . 2024-08-03

MORE AT Google

Small little pie shop, fast service and very limited seating. All the pies were pretty bland/ordinary pie filling flavors, nothing special but cheap.

site_logo

C Yager . 2024-08-02

MORE AT Google

The service was amazing and I felt like I was at home here. The pie crust was incredibly flaky and the fillings were so tasty. Our entire group loved everything they ordered and we’ll definitely be back!

site_logo

Emily . 2024-08-02

MORE AT Google

Looked on their menu in their window and had to enquire about what their "vergas" were. Ad I'm glad I did! Had their feta cheese and gouda which was stuffed full and absolutely delicious. They were even kind enough to heat it up for me. Definitely worth a visit for a light bite in town. And very reasonably priced too!

site_logo

Simon Boyd . 2024-07-30

MORE AT Google

Tuvimos un par de pasteles (un filete y el otro haggis) y ambos eran increíbles. Buena comida. El servicio fue rápido y preciso. El lugar es fresco y ordenado. Habiendo estado tan cerca del centro de la ciudad, es un lugar que recomiendo absolutamente

site_logo

isobr . 2024-07-30

MORE AT TripAdvisor

The sausage wrapped in potatoes (?) was more delicious than the original Scotch pie. hehe

site_logo

Sophia Lim . 2024-07-30

MORE AT Google

The pie is cheap and delicious. I liked it so much that I went twice. I recommend the Original Scotch Pie, Chicken and Mushroom, Macaroni Pie, and Cheezy Dog👍🏻👍🏻 I tried the Steak Bake, but it just tasted like soybean curd bread.

site_logo

ᄋᄌᄋᄂ . 2024-07-29

MORE AT Google

Amazing pies, hats off in front of the cook.

site_logo

Costa Blancca . 2024-07-25

MORE AT Google

Durante mucho tiempo no tuve delante un pastel tan grande. Quítate el sombrero delante de su cocinero. Es algo diferente y te hace el día más brillante.

site_logo

Cristi C . 2024-07-25

MORE AT TripAdvisor

So many pies to choose from but limited stomach space. We had the Scotch pie and Haggis pie with coffees. Perfect breakfast for us! Sit by the windows to people watch!

site_logo

Bel . 2024-07-22

MORE AT Google

Pies were pre-made but all tasty and served hot. Seating is very limited.

site_logo

Jake Marshak . 2024-07-10

MORE AT Google

We loved this little shop when we visited Edinburgh. We tried several of their savory meat pies and loved them.

site_logo

Det R . 2024-07-06

MORE AT Google

Tasty, hearty pies, in really good prices.

site_logo

L.A. Dimi-Tsiami . 2024-07-02

MORE AT Google

What a gem of a shop! As an Aussie, it’s hard to beat traditional Aussie pies however this place puts up a good fight. Excellent food, very reasonable prices and friendly staff - what more could you ask for? 5 stars

site_logo

Nathan Smith . 2024-07-01

MORE AT Google

Recommended for people on a budget who want to try something with a local flavour. Ordered the scotch steak pie and the tattie dog (mashed potato hot dog) and they both tasted great! The steak pie was soupy and chunks of beef. The tattie dog was fantastic, a perfect combination of hash brown and sausage.

site_logo

regina . 2024-06-30

MORE AT Google

Go to place for giod quality value meals. Friendly staff makes for pleasant transactions. Taste was not great only because I prefer mine aggressively seasoned.

site_logo

ed bunyi . 2024-06-28

MORE AT Google

Very good veggie and vegan options! My fav was the vegetarian haggis pie.

site_logo

Francisca Weiner . 2024-06-26

MORE AT Google

the best breakfast you can have in Edinburgh. the working man was very interested. We ordered; Steak Pie, Haggis Pie, Potato and Jalapeno stick, Chicken and Mushroom Pie. Best one was Beef Pie.

site_logo

Michel Baskan . 2024-06-25

MORE AT Google

Ordered a Tattie Dog (hotdog wrapped in mashed potatoes potato), original scotch pie (minced beef) as well as steak pie. Flavours were good and the steak pie was exceptionally savoury. Total damage: £8.6

site_logo

Janet Chin . 2024-06-24

MORE AT Google

Super tasty pies at good prices. Highly Recommended

site_logo

Tobias Fuhrmann . 2024-06-19

MORE AT Google

Hot fresh pies. Good prices, you can either take away or eat quickly at the available seats. I tried several types and they were all delicious.

site_logo

Delia D . 2024-06-18

MORE AT TripAdvisor

I never had a pie before trying one here and I came back every day to this place for the weekend that I was in Edinburgh. Amazing! I’d recommend the Macaroni pie but honestly I’d say everything on offer here is great!

site_logo

Alex C . 2024-06-16

MORE AT Google

Lots and lots of pie options. Good spot for a quick bite. Not many places to sit but people move quickly. Easy to eat, larger than it looks.

site_logo

I H . 2024-06-16

MORE AT Google

The pies here were really good and the prices were good too. We got the steak and ale pie, traditional pasty, original Scotch pie, tattie dog, macaroni pie, haggis pie and sausage roll. I would recommend the steak and ale pie, tattie dog, haggis pie and original Scotch pie but honestly you can't go wrong with any of their baked goods. The tattie dog was mind blowingly sinful and the steak and ale pie was so hearty and savoury. Everything was flavored correctly and goes so well with beer.

site_logo

Stephanie . 2024-06-15

MORE AT Google

Super small place with amazing prices on good pies. I’m dreaming of eating another one while writing this review. Don’t forget to try a fruit tart, too.

site_logo

Christopher Graham . 2024-06-08

MORE AT Google

Lovely pies for an affordable price! The lady at the register was also lovely and did a good job! Definitely will visit again whenever I find myself in Edinburgh!

site_logo

Filip Andersson . 2024-06-07

MORE AT Google

Savory or sweet meat or vegetarian pies to recharge your batteries during your visit

site_logo

jean paul Gaube . 2024-06-06

MORE AT Google

must come in Edinburgh! great local pies for affordable prices. also, the ladies were so kind to me when i lost some personal stuff in the site, and were ready to help! wish you guys the best :)

site_logo

Aurora . 2024-06-03

MORE AT Google

Mostly takeaway joint with limited seating options. Wide ranges of Scottish pies available and very popular among locals so be quick. In late hours most of the pie are sold out. Prices are also reasonable and taste is great. I tried the traditional Scottish LaMb pie and really liked it.

site_logo

Dibyojeet Bagchi . 2024-05-30

MORE AT Google

Cheap and delicious. Best pies I’ve ever had in the UK

site_logo

Ambiguous. . 2024-05-29

MORE AT Google

Piemaker makes great authentic pies 👍 tried the vegetarian haggis pie for the first time in my life and really liked it, the mash potato at the top and the crispy crust were a yum combo with rich flavour and texture! had to buy it and ran for my train so wish I had it in store when it’s warm, the service was great and I got lots of information about the vegetarian haggis a

site_logo

Lin Q . 2024-05-27

MORE AT Google

Great & truly authentic traditional pies. Crust is delicate multi-layers of flaky, buttery goodness. Huge selection of fillings from traditional to wonderful pepper steak. Sweet turnovers are equally good. A very popular place with good food, great price, & friendly service. Definitely a “must stop” in Edinburgh.

site_logo

L H . 2024-05-26

MORE AT TripAdvisor

We were looking for a cheap place to eat quickly and local, and that totally made the deal. We paid £15 (18.5€) for 5 pieces, we even took 1 piece away as we were full (2 each was enough). The waiter was very patient and careful regarding my allergies, and super nice. Could not leave extra tip as we did not have cash anymore but we try to compensate with this comment because they are great and it is worth the price! Also there are plenty Vegetarians and Vegans options.Highly recommend !

site_logo

Manon Delaunay . 2024-05-14

MORE AT Google

Always my first stop in Edinburgh! Fresh and delicious savory and sweet pies. The staff is friendly and professional. Also fun to watch life on the street passing by. 🙂

site_logo

Lou Hull . 2024-05-14

MORE AT Google

Very very good and wide choice of dishes. I recommend !

site_logo

Louis TRIQUET . 2024-05-13

MORE AT Google

Really great place. Very tasty vegan options (the vegan haggis and potato rolls were really good!), friendly staff. Definitely recommended!!

site_logo

Gian Noah Ludwig-Morell . 2024-05-06

MORE AT Google

Very good for a quick meal. Try the vegetable HAGGIS pies, the mushroom pie and the spinach pie. All very good

site_logo

Denise Baiano . 2024-05-04

MORE AT Google

This is a low frills joint serving hot and fresh meat pies at a great price. We were very satisfied with our meals!

site_logo

JD McQueen . 2024-05-04

MORE AT Google

The place itself is not great and the atmosphere is a little bit old. But damn the salty pastry is good. And cheap too!

site_logo

Giovanni Balzi . 2024-04-30

MORE AT Google

He didn't let us sit even when he had half the room empty because he had to clean. It was therefore eight o'clock in full working hours. The quantity of food was very poor, the quality questionable. Rude.

site_logo

Marco Lastrucci . 2024-04-27

MORE AT Google

A quaint place with lots of options. My first time trying haggis and safe to say I was not put off. Ideally, the pastry could have held together a bit more. In addition, the tattie dog was something I had never seen before. It was something that I was skeptical about beforehand, but really enjoyed. Can’t wait to return on my next trip to have it again.

site_logo

Daryl Monserrate . 2024-04-27

MORE AT Google

Ordered a few pies but found them to be slightly underwhelming. They were good and decent, but nothing to scream about. However, it is a warm hearty bite that we would recommend anyone to try!

site_logo

Cheryl Y . 2024-04-25

MORE AT Google

What a feed. Best pie in Edinburgh. Chicken Mushroom pie the highlight. Wow.

site_logo

Mick Comerford . 2024-04-17

MORE AT Google

Basically böreks. quite a few vegan options. nice staff. good on the go food. nothing special but not bad

site_logo

Fadime Duran . 2024-04-15

MORE AT Google

Really great vegan and vegetarian options here and all labeled well on the menu! I got lunch here twice on my trip to Edinburgh just so I could try more of their menu. The pastry for everything I got was perfect. The vegan haggis roll was really nice - I’ve never had regular haggis so not sure how it compares but the flavor was really enjoyable. The Moroccan spiced bean bake had a really great filling. The potato roll was the perfect texture and so good. The mushroom vergas and the vegan sausage roll were both really good but nothing special - don’t get me wrong, I enjoyed them and would get them again but the other things that I tried I just liked better. I thought the prices for everything were very fair. The only thing that was a bit of an issue was that there is not much seating. Fortunately most of their pies/rolls look easy to eat on the go so you don’t necessarily need to sit to eat them.

site_logo

Celine Russell . 2024-04-13

MORE AT Google

I love the pies here have been enjoying the vegan options for years! Have always had friendly service too

site_logo

Amy R . 2024-04-09

MORE AT Google

In passing, we tasted some pretty good Ale Pies. Good raw material, hot, good variety. Recommended for a snack in the center of Edinburgh.

site_logo

Carmine Mastrorocco . 2024-04-08

MORE AT Google

We tried 3 different pies, all of them were delicious. The prices are good and the food is great

site_logo

Nikica Nikolić . 2024-04-07

MORE AT Google

From the flaky crunchy crusts to the savoury fillings, every bite was a delight. Friendly service and cozy ambiance for a quick bite in a rainy day. Can't wait to come back!

site_logo

Valentina F . 2024-04-07

MORE AT TripAdvisor

Lovely pies and coffee. I highly recommend the Scotch and Haggis pies. Sets you up for the day and the price is very reasonable. A must try when in Edinburgh.

site_logo

Nigel CHARLES . 2024-04-05

MORE AT Google

Similary restaurants in Edinburgh and Lothian

restaurant_img
4.5

1404 Opinions

location-icon34 North West Thistle
British
outdoor_seating_93495takeaway_93495delivery_93495

Ha sido un deseo mío venir aquí a cenar durante algún tiempo, y finalmente pude hacerlo con mi prometido mientras visitaba Edimburgo. Tuvimos una cena maravillosa, tuve el bacalao y las almejas y mi prometido tuvo el cordero. Ambos cocinados a la perfección, y acompañados de una encantadora botella de vino, elegido de una interesante carta de vinos. El servicio era excelente - atento y profesional y no tuvimos prisa. Ambiente encantador en el restaurante, y sin duda estábamos muy contentos de cenar allí. Gracias por una velada maravillosa

restaurant_img
4.5

1178 Opinions

location-icon57 Broughton Street
British
outdoor_seating_93545takeaway_93545delivery_93545

Love this little bolthole on Broughton Street, coffee is excellent, atmosphere is calm and welcoming. Highly recommended.

restaurant_img
4.5

398 Opinions

location-iconkirk loan
British
outdoor_seating_94877takeaway_94877delivery_94877

This is an enjoyable quaint local pub

restaurant_img
4.5

275 Opinions

location-iconPrestonfield House
British
outdoor_seating_94479takeaway_94479delivery_94479

I come here for my birthday and loved it, the sandwiches and cakes in the afternoon tea are plentyful and fresh. The tea selection is amazing I had the summer afternoon and it was fab, the views so stunning and their is highland cows on the grounds 😍 and the customer services was literally the best and I do alot of afternoon teas in many places and Derek who worked there was amazing so kind and welcoming the guy makes the experience 100%.

restaurant_img
4.5

3004 Opinions

location-icon29-35 Niddry Street
British
outdoor_seating_96899takeaway_96899delivery_96899

Best place anywhere. Good sound if there is a show happening.