GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 722 opinions finded in 1 websites

site_photo3

Nº 462 in 940 in Doncaster

Nº 62 of 131 British in Doncaster

CUSTOMERS TALK ABOUT DISHES WITH..fishroastpigsteakbeautifulcoffeecookedsandwichsaladcakepaychickenlambbellycheesepork
Score
OpinionsNoteTripAdvisor7224.0

comment_iconOpinions

It’s very easy to find, and from the beginning the staff were brilliant. The atmosphere is lovely too. The menu is extensive and good sized portions. If you are disabled be aware it’s pebble drive and parking. 😡 The signs aren’t clear for disabled access. The building itself isn’t very will signed up. The disabled access is via the doors to the hotel. Which is not signed up either. The drive way is very bad for wheelchairs and buggies.

site_logo

IzzyHyde . 2025-02-14

MORE AT TripAdvisor

Nos dieron vales de regalo de la familia después de que habían disfrutado a fondo de una comida a la hora del almuerzo 'The Fish & Chip' té de la tarde. Reservamos el mismo menú, como siempre el pescado rebozado se mide por la calidad de la masa primero, no hay preocupaciones aquí estaba colocado, no hay capa pegajosa entre la masa y la carne, crujiente, justo y el pescado fresco y blanco. Se obtiene pescado, patatas fritas bien cocinadas, pan de té y mantequilla, acompañado de guisantes mushy un curry dulce y salsa tártara. Para completar la tabla también obtienes una selección de pasteles si puedes manejarlos bastante, pero no te preocupes si no puedes manejarlos proporcionan una caja (El equivalente humano de una bolsa de perro). Sin duda ninguna queja del servicio, especialmente dado que el lugar estaba muy ocupado, el personal muy educado y atento. El único problema era que tenían un cambio precioso en la caja y yo no tenía cambio y no quería insultarlos con los pocos bob en mi cambio como una gratificación. Gracias por una agradable comida de la tarde.

site_logo

Josie W . 2025-01-29

MORE AT TripAdvisor

Very unfriendly greeting, we were relunctantly offered a table in the empty restaurant (apart from 2 other customers) we hesitated and then left as we were made to feel like a nuisance!

site_logo

Cheryl F . 2025-01-27

MORE AT TripAdvisor

What a fantastic place .. Gemma (my partner) and I can for burns night. The reception staff(debbie) were fantastic.... the couldn't do enough. We had a few drinks before our meal. We were escorted to the yurt! What a setup! (Debbie again star!) Millie is an absolute character and so friendly ! She kept us in stitches all night! Owen is an absolute dream ... he shouldn't be on baywatch .....

site_logo

Andrew C . 2025-01-25

MORE AT TripAdvisor

Been to this restaurant a few times for breakfast, lunch and dinner. Beautiful food and great service. Had a waiter called Owen Broom the last few times we've been, he's really friendly, nothing is too much trouble for him and very helpful. Really lovely young man. Would highly recommend a visit

site_logo

Roam62945580677 . 2025-01-14

MORE AT TripAdvisor

Been for the afternoon tea fish and chips, which I can’t even shout about enough! The food was amazing, nothing to fault, went above and beyond my expectations!

site_logo

Jacob S . 2024-12-05

MORE AT TripAdvisor

Estábamos buscando un lugar para el desayuno en un largo viaje a casa, y sucedió en este lugar. Éramos los únicos visitantes como era el lunes por la mañana. Buen servicio. El desayuno era bueno. Tamaño de porción decente. Opciones sin gluten disponibles pero no completas. El sistema de sonido es pequeño - que se ha mencionado en otras revisiones. Por lo demás encantador edificio y mobiliario.

site_logo

MissMaimz . 2024-11-04

MORE AT TripAdvisor

Tuvimos nuestra boda en julio y fue literalmente el mejor día de la historia. Todos nuestros huéspedes se quedaron impresionados con lo impresionante que el lugar estaba hecho para verse y comentaron todo el día sobre que era la mejor boda en la que habían estado. Nuestro viaje comenzó desde el jueves anterior donde Debbie estaba allí para saludarnos dejando la primera camioneta cargada de cosas de boda, diciéndome que dejara las cosas a un lado donde yo quería y ella lo arreglaría todo, pero siendo el loco del control que soy, no iba a suceder jaja , el viernes era el día 2 carga de camionetas y preparando . . el personal estaba allí para ayudar , Debbie zumbando sobre todavía queriendo quitarme la presión, pero de nuevo yo siendo yo y queriendo hacer cosas . . ¡Salí del lugar sabiendo que estaba en buenas manos con ellos! ¡Día de la boda! Todo salió perfectamente El personal era increíble y tan amable con los huéspedes nada era demasiado! Debbie se aseguró de que nuestro día transcurriera sin problemas y todos comentaron lo genial que era... A los invitados les encantó la hora del cóctel y mi ahora marido tuvo un trato especial ( pusieron su favorito John Smiths en la yurta ) La comida era de 5 * en el desayuno de bodas y las pizzas por la noche me dijeron que somos fabulosos, pero yo estaba demasiado ocupado bailando para comer ... Yo me las arreglé un poco de pastel de bodas sobrante al día siguiente, sin embargo ... con todo el mejor día de la historia , y lo recomiendo a todos los que buscan un lugar el desayuno al día siguiente es genial para su resaca ! Muchas gracias a todos en The Peppered Pig

site_logo

Kerry P . 2024-11-03

MORE AT TripAdvisor

La primera vez aquí y las primeras impresiones fueron un lugar encantador. 10 de nosotros para una comida de cumpleaños familiar. Ya habíamos reservado nuestras comidas. Algunos de nuestra fiesta ya habían llegado antes de que llegáramos y habían pedido sus bebidas. La camarera vino de inmediato para tomar nuestra orden de bebidas, pero no estábamos listos, así que pedimos un cupé de minutos, 15 pasaron y todavía no habíamos pedido nuestras bebidas y no estaba tan ocupado, así que mi marido fue al bar. Mientras él estaba en el bar vino nuestra comida. 10 minutos en el bar y finalmente tomamos nuestras bebidas. La mayoría de nuestra comida era agradable, algo promedio y el pescado y patatas fritas eran lo que puedo decir bien hecho y seco (ojalá hubiera dicho algo) la masa no sabía nada bien. Esperamos una edad para que nos preguntaran si queríamos algún desierto. Cinco de nosotros tuvimos postres y a £ 9 cada uno era bastante caro. La camarera más madura era encantadora. En general, un lugar agradable, caro, servicio lento, probablemente no volvería de nuevo debido al costo.

site_logo

grover_acs . 2024-10-13

MORE AT TripAdvisor

Cuatro de nosotros tuvimos un delicioso almuerzo de domingo aquí. Todos tuvimos asados y dijimos que queríamos una visita de regreso lo antes posible y que el postre con Yorkshire Parkin y helado de regaliz valía la pena un premio! Recomiendo encarecidamente este lugar para el almuerzo del domingo. Nos dijeron que tendríamos que salir de la mesa después de dos horas, que estaba bien, aunque esperamos 25 / 30 minutos para nuestro postre, así que, no es de extrañar que nos quedamos durante ese tiempo. El personal fue encantador durante todo el transcurso de nuestra visita.

site_logo

Sharon L . 2024-10-01

MORE AT TripAdvisor

A friend and I called in here for lunch while on a canal trip. We sat outside as the weather was so good (and I had my dog with me). We had a vegan option of sausage with bubble and squeak. The food was hot, well-cooked and very tasty. The staff were friendly and attentive. I definitely recommend this restaurant.

site_logo

Edward H . 2024-09-21

MORE AT TripAdvisor

We booked a table of 10 + kids for Sunday lunch, to celebrate our kids being baptised earlier in the day. We arrived about an hour earlier than planned but the staff were amazing and welcoming, it was cozy and comfortable in the lounge areas. We also had some last minute changes to the pre-order & extra people that came on the day, but the staff dealt with this perfectly and everything was spot on - despite the usual chaos my family brings! Most of us had 3 courses, the food was incredible and there was no waiting time between courses - it was a flawless service. We will definitely be back (and we promise not to be quite as chaotic!) 10/10

site_logo

Luke P . 2024-09-15

MORE AT TripAdvisor

Myself and my daughter arrived for breakfast, we walked in there was no staff to be seen, stood for a while near the bar area a few staff passed us, didn't even acknowledge us so we grabbed a seat and waited to be served. 10 minutes later still no acknowledgement so I went up to the till area and asked how we order do we order from counter or does someone come to us, lady on counter asked if we had a booking, I said no, no one had come to us so we just took the nearest table, she moved us onto another table which was fine. We then received menus and waited another 20 minutes or so for someone to take our order in the end we had to ask one of the staff passing as we were just going to get up and leave, she took the order and our hot drinks came around 10 minutes later. Then the food came in about another 20 minutes by this time we had drank our hot drinks. I have not experienced such bad customer service in many years and will definitely not be back.

site_logo

skybabe007 . 2024-09-09

MORE AT TripAdvisor

Sweet little spot serving breakfast through dinner. Food was great - tasty & well presented, with a good range of wines to accompany. Our visit was for lunch & there’s a full offer of cooked main course dishes, in addition to lighter bites, or…. just come for cake - they looked absolutely epic! Service was delightful - warm & down to earth. And they have rooms too.

site_logo

mrstraveller1 . 2024-03-19

MORE AT TripAdvisor

Outstanding. Friendly, helpful staff, excellent tasty food (wide range of interesting options) and drink (decent real ale). Pleasant, clean premises. Reasonable prices. Very good indeed. Looking forward to returning.

site_logo

shaggyd0g1 . 2024-03-10

MORE AT TripAdvisor

Lovely setting with great views of the countryside. Service great, quick and friendly. Breakfasts delicious, great quality food.

site_logo

kathp85 . 2024-02-25

MORE AT TripAdvisor

Parked right outside door to make it easy for my husband walking in.We havent been since last year, when we were sat outside in the sun looking out onto lovely fields.My husband steak pie was lovely & my salmon fishcake with salad also very nice.Puddings so tasty we will 100% return

site_logo

karenfQ1065AI . 2024-02-23

MORE AT TripAdvisor

The restaurant is clean and smart, the menu was great and for those of us who need gluten free options, there was a good choice to choose from. The fish and chips were lovely, and the portion was huge. The GF brownie was moist inside with the perfect crunch. Breakfast GF options are also available if you stay over, the scrambled eggs are freshly made and super creamy. The only suggestion for improvement is to look at stocking some of the local Yorkshire beers, that happen to be gluten free (rather than imported GF Peroni), for example from World Top Brewery or Hambleton Brewery - the stuff that everyone would drink, so there's no risk of it going off, but us GF folk can also enjoy. The bedroom was really spacious, good sized desk for doing some work, very comfortable king sized bed, and I even had a roll top bath in the bedroom. The missus would have been in heaven. The big walk in rain shower was great in the morning too. I love personalised and friendly customer service too, credit to the team here. Next time my work projects bring me down to this part of the world, the Pig Inn will be my first choice to stay again.

site_logo

L E . 2024-02-23

MORE AT TripAdvisor

Went for my brothers birthday a few months ago. The food was average, I have gone to this place several times over the years and I am never hugely blown away with the meals. They tend to look nice but lack taste and texture.

site_logo

Mary228386 . 2024-01-14

MORE AT TripAdvisor

Absolutely beautiful afternoon tea - excellent service and lovely attentive staff. Thankyou from Vicky and Megan 😍🌲

site_logo

Terry H . 2023-12-22

MORE AT TripAdvisor

Had a lovely evening meal. Place has a good atmosphere and the staff were excellent. The food was brilliant, really tasty. My only criticism is the seating. The chairs have lost all padding and are very uncomfortable. Please sort this out as it spoils the evening.

site_logo

juliewL2201HN . 2023-12-20

MORE AT TripAdvisor

Great service. Delicious food. Beautiful setting. A regular visitor, this place never let's me down.

site_logo

BetteBooo . 2023-11-28

MORE AT TripAdvisor

We were a table of 7 with a mix of adults and children. Pros; Great menu with a variety of food Excellent food quality, which was well cooked - clearly some good chefs behind the scenes. Lovely wine menu Nicely decorated restaurant Cons; A couple of the waitresses were clueless what was on the menu (didn’t know the soup or the fish) The sound system was terrible; would have preferred no music.

site_logo

Emilyofyork . 2023-11-21

MORE AT TripAdvisor

The Peppered Pig recently hosted a 21st birthday meal for our son. The Bridge Room was the perfect venue, lovely private entrance and bar providing exactly the right setting. Nothing was too much trouble for Debbie and her fantastic team, with Davina looking after us on the night. Great service and food, so many guests commenting on how good it was. A couple of guests stayed over and were so impressed with their rooms and breakfast …. First class. Can not recommend the Peppered Pig highly enough - thank you

site_logo

MarshallsDoncaster . 2023-10-27

MORE AT TripAdvisor

Nice little spot catering for families and couples a like New menu when we got there so could do with some refining but still a great meal

site_logo

bevh22 . 2023-10-25

MORE AT TripAdvisor

Celebrating a family birthday From the welcome to the goodbye the service was excellent A delightful private room very comfortable and relaxing Food and service excellent Staff pleasant and friendly This all made the evening most enjoyable

site_logo

Sheila E . 2023-10-22

MORE AT TripAdvisor

The staff were over familiar with regular customers - sharing phone photos, laughing loudly and making everyone else feel uncomfortable. 1 lady staff member, with a tee towel draped over her shoulder even sat on a comfy chair in the bar, chatting to 2 regulars. Another 2 women staff were shouting across the restaurant to each other, talking over us. They were so loud we left and chatted in our car! We were 3 adults on a Monday evening. It was such a shame as the food was delicious & beautifully presented.

site_logo

SusanHornby . 2023-10-18

MORE AT TripAdvisor

Food is always good - not amazing but ok for a developed out of something small and unique to a bigger concern. They have lost one of the next most important aspects of a restaurant and that of service. Shocking: we arrived mid Sunday morning for brunch- 3 ladies who ignored us while they finished their chat and it went on from there - one lovely young lady who smiled and wanted to help - the others were indifferent to the point of asking for sugar was an inconvenience- some grubby uniforms but we will go back cos it’s just down the road and the staff change frequently so here’s hoping the HR are better form next time.

site_logo

Rowy B . 2023-10-08

MORE AT TripAdvisor

Had a lovely meal at the peppered pig. Food was lovely, staff friendly and attentive and the restaurant has a real relaxing Atmosphere. Will definitely be back

site_logo

davewI5837SE . 2023-10-03

MORE AT TripAdvisor

Both me and my partner really enjoyed a relaxed evening with a great meal the bistro cut steak was 👌🏽 See you again soon

site_logo

Jamie B . 2023-09-24

MORE AT TripAdvisor

Excellent food, staff and atmosphere. The menu is very good with a twist on classics. Extensive drinks menu and a lovely place to visit .

site_logo

deng321 . 2023-09-20

MORE AT TripAdvisor

Planned my sister's 30th Birthday lunch with family here at the beginning of September. The process of it all was very smooth and all staff were friendly and helpful. One lady in particular on the day was so helpful, attentive and just so friendly. Josie made the day so much more special with how friendly and caring she was of everyone there. Definitely make sure Josie is working when you go! The food was gorgeous, well seasoned and looked so professional. Thanks for a great experience!

site_logo

Holly M . 2023-09-18

MORE AT TripAdvisor

As we had arrived early we ordered coffees and sat outside in a very beautiful and relaxing space . Now to the rest ! Waited for at least an hour for food to arrive , meagre portions! I had duck which was quite bland overcooked ,and a small bowl salad and if I wanted an extra portion that would cost extra ! So to sum it all ! Unprofessional service ! Food maybe cooked by a novice. Overpriced. Won’t be going again ! Maybe we came wrong time as it was lunchtime . I would have left after having coffee which I had to sent back because it was tepid and lukewarm if I had been alone .

site_logo

Barbara jean G . 2023-09-06

MORE AT TripAdvisor

Fantastic place for food and relaxing. Eaten here several times over the years and never been disappointed. Great food, fantastic service, beautiful setting.

site_logo

Daniel A . 2023-08-01

MORE AT TripAdvisor

We went for a meal for two on Saturday evening (29th July). We live local, but hadn't been before so we thought we'd give it a try. Lovely venue. We both ordered the steak burger with pulled pork. Took a while coming and when it did it was very dry. So dry I had to ask for sauce half way through as we were having trouble swallowing it. Decided to give dessert a chance, we both opted for the treacle tart...the waitress returned to tell us there was no treacle tart, or peaches. So out of a choice of 5 desserts we now had 3. I had a dark chocolate roulade, and was rather underwhelmed by it (especially for £8). Service was poor and slow - asked for the bill and she ignored our request, we had to get up to pay. Overpriced, poor service, and the burger is still lodged somewhere in my chest. Won't be going back.

site_logo

Rebecca H . 2023-07-29

MORE AT TripAdvisor

From its stunning decor, the friendliest service and pure quality of dishes it’s my favourite place of the North! Do not miss an opportunity to visit this hidden gem x

site_logo

Jessie G . 2023-07-28

MORE AT TripAdvisor

We have been to the peppered pig before and it was lovely today not as good. I.looked on line and there was chicken on the menu but just beef and pork for the Sunday dinner mains. My husband's beef was lovely but my pork cut into thick slices and tough and fatty. The Yorkshire pudding not good but the veg and gravy lovely. The family we were with all had fish n chips which were superb. Not a bad experience but not the best. Anne walker

site_logo

Anne W . 2023-07-16

MORE AT TripAdvisor

Authentique place, very nice room, in the countryside I will certainly stay here another time Hosts are very friendly Breakfast is also very good. I didn 't try the restaurant for diner, but certainly next time.

site_logo

1benoitd . 2023-07-10

MORE AT TripAdvisor

Great place to stay. Room was great! Looked beautiful outside. We checked in, room wasn’t available as we didn’t request an early check in, however they was very accommodating with us, we got changed downstairs and the lady (can’t remember her name) she steamed my...

site_logo

Gemma S . 2023-06-21

MORE AT TripAdvisor

Meant to be a special treat for my birthday, we visit the restaurant occasionally but this time it was a huge disappointment. The place begins to look grubby and uncared for, the service was nearly enough non existent, we ordered drinks, waited and waited, then...

site_logo

Elena R . 2023-06-19

MORE AT TripAdvisor

Oh where to begin? I had an email from The Peppered Pig which confirmed my booking of afternoon tea. The validity of the email and even it's existence failed to be acknowledged. Well anyway, we thought that lunch at The Peppered Pig was a bit...

site_logo

Vivien W . 2023-06-06

MORE AT TripAdvisor

We booked this usually good (if expensive) restaurant for a 2 x ruby wedding treat for us and 2 friends. The menu was very limited with virtually all the meals requiring additional potatoes and veg at extra cost. The restaurant now seems to suffer from...

site_logo

ian_taylor090659 . 2023-05-29

MORE AT TripAdvisor

The food was lovely, however the staff require more training. Water glasses were removed before we had the opportunity to look at the dessert menu. One of our party ordered haddock and chips and requested tartar sauce, but surprisingly they didn't have any .Nice atmosphere...

site_logo

Discover526458 . 2023-05-08

MORE AT TripAdvisor

The food was fantastic but unfortunately one member of staff were absolutely appalling. Wrong main course came and she made out as if it was our mistake and walked off. Felt very uncomfortable and couldn’t wait to leave.

site_logo

Ronberry . 2023-04-26

MORE AT TripAdvisor

An incredibly disappointing Sunday lunch especially for the vegetarians in our group. Their vegetarian option was a meatless roast which turned out to be a plate of uninspiring oversalted veg.Not an iota of protein in sight. Foolishly we expected a nut roast of some sort....

site_logo

C7430KGanthonyg . 2023-04-23

MORE AT TripAdvisor

Very poor vegetarian options for Sunday lunch. Literally get the Sunday roast minus the meat. We obviously don't need protein! The vegetables were salty and the cauliflower cheese we paid extra for, was vile and watery.

site_logo

Claire B . 2023-04-23

MORE AT TripAdvisor

Booked for afternoon tea for partners Birthday.. Beautiful place but unfortunately wasn't the best afternoon tea experience .. We were shown to our table and the food arrived .. presented very nice but sandwiches very dry & poor selection and quantity . Equivalent to 3...

site_logo

Windermere21 . 2023-04-18

MORE AT TripAdvisor

Food was amazing and people. However considering that when we booked and mentioned a SEVERE NUT Allergy and been in contact with 3 times about it when the staff have rang us asking about the allergy. Been seated down and asked again when staff changed...

site_logo

Charmaine A . 2023-04-15

MORE AT TripAdvisor

Dined in the restaurant whilst staying in The Pig Inn. The food was absolutely delicious both in the evening and at breakfast. Fantastic service and a great espresso martini too! We really enjoyed our evening here.

site_logo

ExploringAndReviewin . 2023-04-02

MORE AT TripAdvisor

Had a lovely day here yesterday at a friend's wedding. The staff were absolutely fantastic, very helpful and friendly. The food served was absolutely gorgeous and good time was had by all. Great venue and facilities. I haven't given 5 stars only because I have...

site_logo

Climber726890 . 2023-04-01

MORE AT TripAdvisor

Birthday meal with family. All had fish and chips. Fish was nice but “twice cooked chips” were stale, many were green and just not good. I ate my fish but put family off theirs so didn’t finish their meals. Beautiful environment and surroundings but appears...

site_logo

juliehL5086KV . 2023-03-18

MORE AT TripAdvisor

Came for afternoon tea, prebooked and prepayed for as an early Mother’s Day treat for my mum. There was myself, my mum and my daughter. I have been before for afternoon but pre covid… and sadly it was much better that time. Weren’t an overly...

site_logo

amandaljony . 2023-03-11

MORE AT TripAdvisor

We went for a large family meal to celebrate a birthday. Pork T-Bone sounded lovely and for £18 we expected a large plate full. However it was tiny, over cooked and dry. Not worth £18 and not pleasant to eat. The fat wasn’t rendered properly...

site_logo

LunasWorld . 2023-03-07

MORE AT TripAdvisor

Review Very limited vegan or vegetarian options available. As I am pescatarian I was able to order the fish & chips. I did ask if there were any other veggie options to be offered mushroom stroganoff, which wasn’t on the menu and no Sunday lunch...

site_logo

lynsey747 . 2023-02-26

MORE AT TripAdvisor

Give praise where praise is due! Excellent through and through. Stayed here with family at a surprise 60th wedding anniversary party. The staff were FANTASTIC as was the accommodation, food and facilities Thank you for making this such an eventful stay. Well done Would recommend...

site_logo

ChrisJ85 . 2023-02-19

MORE AT TripAdvisor

We stayed in the house next to the Peppered pig for a friend’s birthday and the staff couldn’t have done more to make us feel welcome. Matron was class and the chef (Jake we think?) was exceptional. The best fish cake I’ve ever tasted!!! Lovely...

site_logo

Traveller27697 . 2023-02-15

MORE AT TripAdvisor

Just to say last night meal was outstanding! Thank you for making our evening memorable, mum and dad were so surprised to see everyone celebrating there 50th Wedding Anniversary... All staff last night were just fantastic and could not do any more for us.. so...

site_logo

adeleb923 . 2023-02-11

MORE AT TripAdvisor

First visit today. We both had the full English. Had to pay extra for hash browns. The quality was top notch. Lovely surroundings, and lovely staff. We had 3 coffees each. The bill for two of us was £37:00. Quite pricey, but we'll worth it....

site_logo

Loiner3570 . 2023-02-08

MORE AT TripAdvisor

The first time we've been to the peppered pig but it won't be our last will definitely be back. The place is beautiful lovely setting with fairy lights on the ceiling. The staff were very helpful.and polite. We were served quite quickly and the food...

site_logo

davidwE657EC . 2023-01-30

MORE AT TripAdvisor

I visited here today for the second time. Both times the staff have been really lovely - made us feel relaxed, never a feeling of being rushed even though it took me too long to make an order because each time they came I had...

site_logo

TomoRKT . 2023-01-20

MORE AT TripAdvisor

The Peppered Pig We’ve had a couple of visits towards the end of 2022 with friends to this lovely rural restaurant. It’s a great place with friendly staff and good food. The restaurant is open with lots of light and windows giving an inside/outside feeling....

site_logo

PMC-Trecker . 2023-01-11

MORE AT TripAdvisor

I booked here after rummaging around on Google Maps to find a different dinner venue with my best friend. The website and menu looked good, so we gave a try. Not in the least disappointed. Waiting staff were attentive but unobtrusive. Tge food was exquisite...

site_logo

omipalone . 2023-01-11

MORE AT TripAdvisor

We booked a table for dinner here as we were staying in the Pig Inn. We were visiting my Uncle and had come from France, really looking forward to a good English dinner. The menu was good and obviously well thought out. The starters were...

site_logo

sjp19682018 . 2023-01-07

MORE AT TripAdvisor

Booked for a nice family breakfast, but unfortunately, we had a very disappointing experience. The Full English can only be described as pretty miserable. 2 slices of bacon, 1 sausage, 1 slice of toast, I mushroom, half a tomato and a micro small pot of...

site_logo

Milano76 . 2022-12-28

MORE AT TripAdvisor

Very disappointed . I rang and booked and asked if they were doing Christmas dinner to which they said they were. On arriving no Christmas dinner and a very poor menu. Orderd steak pie to then be told they had none left . All in...

site_logo

michaela s . 2022-12-19

MORE AT TripAdvisor

Took mum yesterday for Sunday. Having seen some of the reviews I was a little worried. I didn't need to worry. The venue is beautiful clean the staff were perfect and the food was better than excellent. Thank you to all the staff. I've just...

site_logo

Bigjonnyfromdonny . 2022-11-28

MORE AT TripAdvisor

My husband and I booked a table here on the spur of the moment and had a lovely evening. There was a warm welcome and we were shown to our table. The menu isn’t huge, but we made our choices. We both had the steak...

site_logo

Yorkshire-Diner1 . 2022-11-25

MORE AT TripAdvisor

We went to our son's wedding at The Peppered Pig and we could not fault anything all was perfect from the staff to the meal, it was that nice we went the next day for a lunchtime meal and that was all perfect and we...

site_logo

LoveTravel5466 . 2022-11-17

MORE AT TripAdvisor

Really disappointed. Booked a table for my husbands birthday at 12 o’clock. Travelled over to be greeted with ‘were you told it’s only the brunch’ menu today. Nope! If I wanted a breakfast I would’ve booked for breakfast and not travelled 30 mins to get...

site_logo

TParsl . 2022-11-14

MORE AT TripAdvisor

Beautiful local hotel with great staff and beautiful clean room. Fantastic food with an amazing selection of sweet treats. What really makes this place special is the staff they are welcoming and so friendly. This is a great place to stay

site_logo

davidwG2506QK . 2022-10-06

MORE AT TripAdvisor

Love our little local restaurant me and my mum love fish Fridays here with a bottle of pink Prosecco

site_logo

rhondan961 . 2022-09-23

MORE AT TripAdvisor

My husband and I called in and had a late lunch. Wow, fantastic food, service and staff. We'll definitely be calling in again XX.

site_logo

susanjI4514KR . 2022-08-17

MORE AT TripAdvisor

Lovely first time visit to the pig inn with my life long friend for a catch up. Able to sit outside in the perfect weather with lovely views over the cornfield. Very relaxed atmosphere with friendly service. The food was delicious and a great choice...

site_logo

janninea2019 . 2022-08-10

MORE AT TripAdvisor

We celebrated the 80th 😱 birthday of my father. I wanted to give them a mention following some ‘not so nice’ reviews I read on tripadvisor. We were a demanding table of 14 and it was 29degrees outside. Both my husband and I had a...

site_logo

mrsg459 . 2022-07-12

MORE AT TripAdvisor

Went for lunch with a friend. We didn't book it was an off the cuff decision. I thought the lunch menu was quite limited and overly expensive. I ordered the homemade fish fingers in bloomer. I was, disappointed to say the least. No side salad...

site_logo

Salannlee . 2022-05-16

MORE AT TripAdvisor

Had lunch - 3 adults and 2 young children. We had eaten there last year on several occasions and had always enjoyed the meals. This time we were disappointed. The fries supplied with the burger were not as described as had no truffle oil added....

site_logo

bikemadlancs . 2022-05-03

MORE AT TripAdvisor

Very limited menu, two choices of roast, second sitting, one choice. Nice setting but food needs massive improvement to match surrounding venues, didn’t think value for money , left feeling hungry

site_logo

546nee . 2022-03-27

MORE AT TripAdvisor

Visited with the other half. Saturday night. Busy but service quick and efficient. Steak for my other half. 'Fish pie' for me. Flavours and presentation amazing. Portion size just right. Finished off with cheesecake. Staff were professional, friendly and pleasant. Ambience great. Can't wait to...

site_logo

Dawn H . 2022-03-26

MORE AT TripAdvisor

Eleven of us for lunch. The service was impeccable. The setting was amazing. The menu was delicious. Oh and the banter was on point. Nothing to dislike or moan about here. Well done everyone. Thoroughly enjoyed by all. Thank you.

site_logo

JRT1960 . 2022-03-01

MORE AT TripAdvisor

My wife treated me to a birthday lunch at this venue - and I was looking forward to it, as I heard good feedback. Unfortunately, the food on offer was hit and miss. The front of house wasn't all that great either. I know about...

site_logo

LB6931 . 2022-02-18

MORE AT TripAdvisor

We went for brunch at The Pig Inn (as it’s now called) today. We ordered the Full Yorkshire which was swimming in olive oil - who wants a fried egg floating in a green oil slick? . It wasn’t good at all. The portion sizes...

site_logo

DK2009England . 2022-01-29

MORE AT TripAdvisor

We celebrated my aunts 90th Birthday with dinner for 16 at the Peppered Pig and it was brilliant. The food was amazing and we all thoroughly enjoyed ourselves. The staff were amazing and so helpful and attentive. An excellent night

site_logo

Isabel A . 2022-01-20

MORE AT TripAdvisor

This was the second time we visited here, we visited with my parents and the food was amazing. If you like quality homemade food then you will not be disappointed. The staff are very friendly and helpful. We will definitely be returning.

site_logo

Y1947JHkevino . 2021-12-25

MORE AT TripAdvisor

I have eaten here numerous times over the years, and it had been fantastic food every time. Sadly prices have stayed the same and the food was to say the least, mediocre. The first visit straight after lockdown was up to it’s usual standard, slightly...

site_logo

Z6161LVsoniap . 2021-11-07

MORE AT TripAdvisor

Visited last night for an evening meal and catch-up with a good friend. Fantastic tasty food that was very filling and good value for money. The service was great and the staff were really friendly and helpful; making us feel really welcome from the moment...

site_logo

hctb . 2021-10-07

MORE AT TripAdvisor

Came here as a recommendation from a friend and have heard others talking highly of TPP. We arrived slightly early but was shown to our table, drinks were taken as soon as we were seated - probably a little too soon as didn’t have chance...

site_logo

Kolakubez83 . 2021-09-26

MORE AT TripAdvisor

Excellent food & service! Afternoon tea for 4 was absolutely amazing. Couldn’t have been any better. Would highly recommend, and will definitely be back to try the regular menu, as the meals been served looked incredible. Lovely relaxed atmosphere, staff exceptional, attentive but not overpowering,...

site_logo

Clarkh2010 . 2021-09-11

MORE AT TripAdvisor

Couldn’t have been better. Fantastic food, generous portions, lovely staff. Would recommend the beef carpaccio starter and the steak and ale pie especially. 10/10 highly recommend

site_logo

JBow16 . 2021-09-01

MORE AT TripAdvisor

Me and my partner stayed at the peppered pig for the night with a three course meal and breakfast the next morning as the peppered pig had a deal on where we got an overnight stay, 3 course meal and breakfast for 2 for £165!!...

site_logo

Maisie B . 2021-08-29

MORE AT TripAdvisor

Have wanted to book to eat here for ages so what better time than our wedding anniversary to finally visit. Over all the staff were lovely and the food was amazing. Unfortunately some of the meals listed on the very limited menu were not available....

site_logo

DaniellaSmith17 . 2021-08-26

MORE AT TripAdvisor

Booked a meal for 4 on the way home from York races. The chairs were a little low for one of our party and one of the staff members, Eileen, was immediately on hand to provide a couple of cushions to sit on. Another of...

site_logo

MikeO1737 . 2021-08-22

MORE AT TripAdvisor

Stayed here 1 night as we cycled form Scotland to Norfolk. Arrived late afternoon on a Sunday having made a same day booking. Our twin share room wasn't ready so the manager on duty simply put us into two separate bedrooms for no additional cost....

site_logo

nw05250 . 2021-08-11

MORE AT TripAdvisor

Our favourite restaurant before lockdown proved very disappointing yesterday. A bowl of lettuce leaves tossed in Caesar sauce topped with half a boiled egg and a few croutons costing £12:95, was what I consider an expensive joke. Then a few slices of chicken increasing the...

site_logo

DayTrip621036 . 2021-08-05

MORE AT TripAdvisor

Returning to one of our previous favourite restaurant prior to lock down . A surprise birthday meal arranged , 4 of the diners had travel a considerable distance and what a disappointment we had .Menu given and items on it nothing like the sample menu...

site_logo

andynaylor61 . 2021-07-30

MORE AT TripAdvisor

Had a friends get together as this had been recommended. Waited over an hour to get drinks after been told someone would be us shortly when arriving at 7pm as table was booked for 7.30. Went to the table at 7.45 at 8.30 had to...

site_logo

1234mmecd . 2021-07-14

MORE AT TripAdvisor

Simple plate of savoury items with scones for afters. Lovely view with nice seating area outside. Didn’t book but just turned up and they accommodated us with a small selection of goodies. Overall very good 👍🏻

site_logo

mark7242 . 2021-06-10

MORE AT TripAdvisor

Ok food but for what we had it felt overpriced. Service ok, no one unpleasant but neither very welcoming. First outing in 18 months so felt a bit disappointing. Won't be rushing back. On a positive, the surroundings were very nice.

site_logo

Jane C . 2021-06-08

MORE AT TripAdvisor

Went for breakfast. Had to wait a long time for anyone to come and seat us. Service slow all the way through. Restaurant not very clean- crumbs and dead flies noticeable on floor. Had to brush chair of crumbs before sitting down. Food delicious. Then...

site_logo

Belvederesloegin . 2021-06-03

MORE AT TripAdvisor

From start to finish this little gem of a restaurant didn’t disappoint !! This was my first visit and it certainly won’t be my last . The welcome was warm and the service was perfect. The food was perfectly cooked by… clearly a top chef,...

site_logo

Pioneer52086768946 . 2021-05-30

MORE AT TripAdvisor

Absolutely excellent cuisine. A while back now, but never-the-less, my memory of this establishment was of superbly excellent servings and the waitress service could not be better. They really made me feel at home. My wife got a tiny thing wrong with her order (no...

site_logo

Ouralan1 . 2021-05-13

MORE AT TripAdvisor

Similary restaurants in Yorkshire and The Humber

restaurant_img
4.0

735 Opinions

location-icon20 - 28 Cleveland Street
British
outdoor_seating_168398takeaway_168398delivery_168398

Good pub with friendly staff cheep as chips you can get a good pint and change out of £2:50 There's live music in the afternoons about 3 or 4 times a week + Dj and karaoke that enjoyed by 30years and above it has its regulars but anyone is maid Welcome If your in town get your self down

restaurant_img
4.0

1066 Opinions

location-iconDoncaster Leisure Park
British
outdoor_seating_168498takeaway_168498delivery_168498

Lovely meal before the cinema.Friendly atmosphere. Would definitely recommend. Thank you Sally G for your photography 😆

restaurant_img
4.0

5 Opinions

location-icon5 Kingsgate
British
outdoor_seating_168475takeaway_168475delivery_168475

Nice friendly service. Free toilet for customers. A bacon meal deal was 3 pounds and includes a free coffee or tea. Free WiFi if you use the BT town centre WiFi.

restaurant_img
4.0

1984 Opinions

location-iconGainsborough Road
British
outdoor_seating_172745takeaway_172745delivery_172745

We popped in for late lunch and had the house wine merlot which was a perfect temperature and delicious The bar staff were friendly and helpful We ordered and the food was wonderful The steak pie homemade exceeded expectations with vegetables cooked perfectly and super chips Fish and chips served with mushy peas tasty and good portion size Followed by baileys cheesecake which was accompanied by a glass of baileys Like art on a plate and delicious Very chilled and welcoming atmosphere We will definitely recommend and return Great value for money Jan & Judith

restaurant_img
4.0

705 Opinions

location-iconScorcher Hills Lane
British
outdoor_seating_168544takeaway_168544delivery_168544

Really welcoming and friendly. Decor may be a little tired, but the wonderful piping hot fresh food, and friendly service is fab! Great value deals in the afternoon Monday to Friday as well.. 2 meals for £22! Really can’t complain