GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.6

Based on 3.178 opinions finded in 4 websites

site_photo4

Nº 2263 in 2913 in Edinburgh, City of

Nº 12 of 16 Brasserie in Edinburgh, City of

CUSTOMERS TALK ABOUT DISHES WITH..porkpotatocoffeepaymeatsaladsandwichchickenmustsmokedcheeseoldchilliribscoolstew

comment_iconOpinions

Here again 2/12/25 and kitchen is closed until March which made me sad indulging in a French cherry martini which is very delicious. Cherry liquor , vodka and pineapple juice shaken and served with cherries ice cold is prefect. Lively for a Wednesday. Only negative is no food available

site_logo

Barbara Lindner (Travelling Wife) . 2025-02-12

MORE AT Google

The best craft beer bar in Edinburgh. Always a great selection on tap and in the beer fridge, the food never disappoints either.

site_logo

Craig Oldham . 2025-02-09

MORE AT Google

Had great potential (cute spot, reasonably priced drinks) but an incredibly rude man came around and started yelling at all the guests (lots of tables still seated) around 11pm (closing is midnight). Of course completely understandable that a bar might close earlier if it isn’t busy, but this man was condescending and outright confrontational. Another group politely asked what time the bar would close (again - website explicitly says open to midnight every day, so this is an hour early) when this man first came around grabbing drinks from tables while patronisingly declaring “it’s home time”, he replied by aggressively pointing at an empty table and sarcastically asking “what do you think?”. This is out of nowhere and he doesn’t actually answer the question as to whether the bar is closing or at what time it’s closing. He does leave the full drinks for guests to finish so we interpreted this as his version of “final call.” When he came around again and told all the people “it’s home time, now get out”, we asked him for his name. He replied by stating it’s none of our business. We raised this to the management who were understanding and seemed aware of the issue with this employee. Would suggest avoiding this bar while he is working. Again - there would have been no issue whatsoever if he simply said “apologies, it’s quiet so we’d like to close the bar now”, it was the tone and aggression that made his behaviour inappropriate.

site_logo

Merel . 2025-02-04

MORE AT Google

They have cheap cocktails (£7-£9) and they are really good

site_logo

Pilar Petruzzella . 2025-02-04

MORE AT Google

If you love beer you will love it here.

site_logo

Davey Wallace . 2025-01-21

MORE AT Google

Not recommended, it looks nice but the staff is worthless. Very blunt and antisocial.

site_logo

Tom Rutten . 2025-01-20

MORE AT Google

This is my regular stop whenever i’m in Edinburgh. The variety of craft beers they are serving, is the best choice. This place has lovely and cool atmosphere with friendly vibes. Staff were attentive and good in service. In this freezing weather, they create an amazing, cozy atmosphere. Visiting everyday while staying in Edinburgh.

site_logo

win task . 2025-01-12

MORE AT Google

What a shame! You wait obediently at the bar when the bar closes for 30 minutes on New Year's Eve so that the staff can drink? In any case, I had nothing to offend. Thanks for nothing.

site_logo

Katja A . 2025-01-01

MORE AT Google

Excellent craft beers, sadly wifi not working

site_logo

palmea1 . 2024-12-29

MORE AT Google

Rude staff one member of which clearly hates the English. Who ignored me when he heard my accent, served others before me and was incredibly rude when I politely advised him that I had been waiting before them with the response "thanks for that". Luckily for him I've mellowed over the past few years!!!

site_logo

Ritchie Hicks . 2024-12-28

MORE AT Google

Had the fish and chips. Very nice.

site_logo

Eva Engilrad . 2024-12-19

MORE AT Google

Great pub and lovely bar tenders

site_logo

sarah moore . 2024-12-06

MORE AT Google

Another one that’s been on my radar and happy to have dropped in. Lovely Place and the Plum Ruby Mild went down nicely.

site_logo

Timothy McGInnis . 2024-11-24

MORE AT Google

Pub slightly away from the city center with a good selection of beers on tap. Slow and somewhat chaotic service, you order at the counter and then the food is served at the table... if they don't forget. Even though it was a Tuesday evening and the place wasn't full, we waited more than 25 minutes for a portion of chips. High prices especially for beers but in line with the rest of the city

site_logo

Fiorella . 2024-11-23

MORE AT Google

Quirky bar with a brilliant range of ales. Friendly and knowledgeable staff very nice atmosphere

site_logo

H L . 2024-11-12

MORE AT Google

Great little pub with a good beer selection.

site_logo

Bill Penberthy . 2024-11-02

MORE AT Google

Came in just for a few drinks before a meal elsewhere, and we were very impressed with the atmosphere and the very welcoming and attentive bar staff. Nice beers and ciders, well kept with a very big range - Also a nice whiskey selection, staff very knowledgeable and helpful with recommendations!

site_logo

Sam Longden . 2024-11-02

MORE AT Google

Nice pub with a little bit of old school feeling.

site_logo

Péter Bokor (Broki) . 2024-10-24

MORE AT Google

We arrived with 23 people and received fantastic customer service. The food came out before we even sat down. I've always wanted chips that tasted like they were from a castle cellar. The only downside was one of our party was a little too obsessed with the bare stone walls.

site_logo

A . 2024-10-21

MORE AT Google

One of the worst restaurants I have ever experienced. Ordered food as a group of 23 people. This was served individually at regular intervals of 20 minutes, spread over 3 hours. It feels like fries have been dug out of the castle cellar. The only positive thing is the ambience. The wall behind us has some old stones...

site_logo

Waldemar Jordan . 2024-10-21

MORE AT Google

The haddock sandwich was amazing, plus the chips are perfect for the vinegar girlies and lads. They are little potato moats where you can get the perfect malt vinegar to potato ratio.

site_logo

Lindsay McCabe . 2024-10-04

MORE AT Google

Great selection of unusual beers! One of the best in Edinburgh.

site_logo

Aaron T . 2024-09-30

MORE AT Google

Excellent selection of craft beers, albeit slightly on the pricey side. Friendly bar staff.

site_logo

Paul Morris . 2024-09-29

MORE AT Google

Great atmosphere and good service. Food was excellent. Bit pricey on the drinks but wonderful international selection. German Oktoberfest collection was great.

site_logo

Zach Wilson . 2024-09-27

MORE AT Google

What a great find! Popped in to the Hanging Bat on the basis of the good reviews and to enjoy some craft beer. So pleased to see such a great choice of keg beers to try! The staff gave us the best welcome we've received in Edinburgh and were really knowledgeable. Following some great recommendations by the team and after a taste, we really enjoyed the NEIPA Otherworld Brewery's 'Huntress'. Delicious! We enjoyed a good, honest portion of dirty fries with our beers. They were served beautifully hot, with loads of topping and enough to share. Thank you for a top craft beer experience and welcome! ⭐

site_logo

Berrybum . 2024-09-26

MORE AT TripAdvisor

What a great find! Popped in to the Hanging Bat on the basis of the good reviews and to enjoy some craft beer. So pleased to see such a great choice of keg beers to try! The staff gave us the best welcome we've received in Edinburgh and were really knowledgeable. Following some great recommendations by the team and after a taste, we really enjoyed the NEIPA Otherworld Brewery's 'Huntress'. Delicious! We enjoyed a good, honest portion of dirty fries with our beers. They were served beautifully hot, with loads of topping and enough to share. Thank you for a top craft beer experience and welcome! ⭐

site_logo

Annabel Berry . 2024-09-26

MORE AT Google

The Hanging Bat was mentioned in a book we enjoyed reading and therefore we went to try their Mac'n'Cheese. We were not disappointed, the atmosphere was great and the food was amazing! Throughout our stay in Edinburgh we went there multiple times and tried different things from the menu - all tasted great~ We can only highly recommend going there!

site_logo

Tamara Dost . 2024-09-25

MORE AT Google

Great pub. Really good vibe and nice beer selection

site_logo

Andrew Lynch . 2024-09-17

MORE AT Google

Hanging Bat was a chill place for us to recharge during the day. We grabbed some food and drinks, and I was impressed by the beer menu. The food was only average, but vibes inside were great.

site_logo

Jeremy Yowell . 2024-09-12

MORE AT Google

Great choice of craft beers but unfortunately no pints.

site_logo

Pawel . 2024-09-03

MORE AT Google

Great selection of local beer on tap.

site_logo

Philippe . 2024-08-27

MORE AT Google

Been two times now and atmosphere is lovely, it’s a nice level of busy where it feels comfortable and cozy. The cocktails are DELICIOUS. Staff are so unbelievably friendly and lovely. If you’re around, absolutely go here you’ll be looked after so nicely. Good pricing too, great student bar. Highly recommend.

site_logo

Tyler-Ann Day . 2024-08-24

MORE AT Google

Excellent choice for beer lovers, but expensive when they only serve in half pints! The pub is spread out over 3 split level floors and very few seats at the bar which robs the place of a heart.

site_logo

Android User . 2024-08-13

MORE AT Google

The food was good and generous portions. No table service so you need to go to the bar and order. Very noisy in the evening which is to be expected.the bathroom was very dirty and no hand towels or dryer

site_logo

Tracey M . 2024-07-22

MORE AT Google

This group of lads are fantastic. Wide selection of beers from all over! Even north America! Very friendly and chatty. Run a fine establishment.

site_logo

Zain Aboo . 2024-07-20

MORE AT Google

As an ipa and overall craft beer enthusiast from Seattle, this was a great spot for me to drop in at. Barkeepers were awesome at making drinks and very friendly! I had a great time and when I visit Edinburgh again, I will be back. Cheers!

site_logo

Jay Peterson . 2024-07-12

MORE AT Google

Very good craft beer pub. Great range of taps and cans.

site_logo

Mark McGuire . 2024-07-10

MORE AT Google

An excellent place for craft beer lovers 😍😍. Very good service, excellent music, pleasant atmosphere and a wide variety of craft beers both on tap and in cans. Wonderful that they also have zero zero beers so you can enjoy several beers if you prefer not to consume alcohol. A marvel, highly recommended!

site_logo

María Honeyes . 2024-07-08

MORE AT Google

Visiting Edinburgh from the PNW of the States, Portland Oregon to be exact. I enjoy craft beer and trying to experience what Scotland has to offer. The Hanging Bat really hit the spot with tap selection, friendly people and great slightly funky atmosphere. Highly recommend a visit when your in their part of Edinburgh or just make a special trip. Cheers

site_logo

David Hicks . 2024-07-02

MORE AT Google

I was brought here on my hen/birthday weekend for a meal, and did not leave disappointed! The food was fantastic, booze selection: excellent! And the staff were so much fun too. Some places kinda shun hen parties, but not this place! definitely eat there and don't be in a hurry. You won't regret it! :D

site_logo

Rhiannon Yates . 2024-06-18

MORE AT Google

Just a great pub if you enjoy local craft beer. Food was solid too. Friendly service too.

site_logo

Eric Foster . 2024-06-11

MORE AT Google

Great beer and very filling food. The chilli nachos were a meal in themselves. The steak sandwich was ok but would go for a burger in hindsight. Amazing selection of beers!

site_logo

Paul Trubridge . 2024-06-11

MORE AT Google

A pub that doesn’t sell pints. Most likely to cover the fact they routinely charge £8 a pint plus pro-rated for some pretty standard “craft” beers. Limited cask options - not sure it’s stored/pulled that often as my Pilot-Sunny on latest visit was a bit musty for my tastes. If you’re looking for cask ale, my advice is to walk 5 minutes and go to Cloisters.

site_logo

A T . 2024-06-08

MORE AT Google

This place is off the Royal Mile and thankful away from the hustle of the tourist trade. We had the fish and chips and it was excellent. Good selection of craft beer as well. Found it a very relaxing, local pub with good food, beer and great service. If you want a nice local pub with good conversation, this is a must.

site_logo

Chris H . 2024-05-25

MORE AT TripAdvisor

Enjoyed the bar, all the beers are ones you've never heard of but you are allowed to try them before you buy.

site_logo

Allan Lytollis . 2024-05-15

MORE AT Google

Great ambiance, great food, fair prices. Would go back

site_logo

Rain . 2024-05-09

MORE AT Google

I’m from the Midwest, where we have a flourishing craft beer scene. This was the first establishment in the UK where I could get a proper taste of the craft beer scene across the pond. Also, the music they play is incredible, one of the songs I noticed over the stereo was Parabola by TOOL. Need I say more?

site_logo

james Hammond . 2024-05-08

MORE AT Google

Beer selection is cool, pricing adequate for beers offered. service however very poor and unfriendly, no advice - beer menu hardly readeable, tables not cleaned, lots of fruit flys PLACE COULD BE SO MUCH BETTER

site_logo

Bettina Kirch . 2024-05-06

MORE AT Google

Good selection of beers and delicious beef stew

site_logo

Nicholas Rohrbacker . 2024-05-05

MORE AT Google

Great food and a good selection of craft beers and cocktails

site_logo

Peter Hall . 2024-04-21

MORE AT Google

Nice music and the beers are good. On the other hand, if you are looking for a pub to eat well with pleasant service, go your way... the burger I ordered was really not good (burnt steak, dry bread and non-existent sauce) and my partner's Mac and cheese Same. Note that it is often said that you can know the cleanliness of a restaurant's kitchen by visiting their toilets and that really doesn't make you want to come and eat there 🙃

site_logo

A. D . 2024-04-16

MORE AT Google

It's giving big "out of business" vibes

site_logo

Marijn Frijns . 2024-04-16

MORE AT Google

Leans "modern" pub but has that classic vibe while still being vibrant and fun. Staff are young and friendly. Beer selection leans craft and food leans modern gastropub. Spacious with some great music playing. Great stop for a pint and even a proper meal.

site_logo

Matthew Garcia . 2024-04-13

MORE AT Google

Super cute little bar! 3 floors, cosy lighting and quick service. Quite a few cocktail options and lots of interesting beers.

site_logo

Karla van Rensburg . 2024-04-12

MORE AT Google

Huge selection of craft beers in all styles. Friendly service. Cozy atmosphere.

site_logo

Mathieu Castets . 2024-04-08

MORE AT Google

Visited a few times now when I’ve been in Edinburgh. Firstly, it got to be said that the beer range and quality are second to none. That’s the only positive unfortunately. A couple of the staff are very good. However from recent experiences, most are miserable and would much rather be propping up the end of the bar on their phones rather than serving or clearing tables. There was a guy ‘working’ there on Friday afternoon that was the worst I’ve seen so far, he really didn’t want to be there at all. The food on Friday was dreadful, easily the worst burger I’ve ever had the misfortune to eat. It was stone cold and tasted of nothing at all, and that’s their ‘signature’. It’s certainly not something I’d want to be putting my signature on, absolutely terrible. Just a note regarding the state of the place. The smoking area outside is disgraceful, an absolute embarrassment. I’d doesn’t look like it it has been cleaned for about a year. The toilets are horrible, two urinals blocked and the hand dryer was broken. The small area that I believe is the brewery look like a junk store, if that’s where their own beer comes from I’m glad I didn’t try it.

site_logo

Ian_C96 . 2024-04-01

MORE AT TripAdvisor

Great beer, that’s the only positive. We visited on Good Friday. But for one of the staff, the rest were sullen and were all propping up the bar on their mobile phones instead of clearing tables. On a couple of previous visits the staff have been pretty rude, OK I’m 52 but I’m allowed to drink craft beer although I’m clearly not a cool hipster. I had a burger, it was absolutely terrible and stone cold. My friend had the pulled pork topped fries, it looked like baby sick. We had a few more beers after our food, nobody cleared our table, the plates are probably still there. The place is filthy, the smoking area doesn’t look like it’s ever been cleaned, two urinals in the gents were blocked and the hand dryer wasn’t working (it wasn’t the last time I went in about six months before). What I think is the brewery is a filthy mess. Just relies on its reputation, the manager needs a kick up the arse or sacking and replacing with someone who can make it what it was. The staff all need to be told that mobiles are banned behind the bar, to flipping smile a bit and be polite to the customers. I love the beer in there but I’m done with the place now.

site_logo

Ian Casson . 2024-04-01

MORE AT Google

Fantastic real ale pub, definitely recommend

site_logo

mark cutler . 2024-03-27

MORE AT Google

Amazing staff, nice atmosphere and VERY good music!

site_logo

Marie Liebold . 2024-03-23

MORE AT Google

A couple of drinks on a quiet Sunday night

site_logo

Tommy Lynch . 2024-03-17

MORE AT Google

Cool venue. Great beer. Can't comment on the food as I only had the ale.

site_logo

Nick Edwards . 2024-03-11

MORE AT Google

Decent pub but their no pint glass policy is stupid and unpatriotic.

site_logo

Michael David . 2024-02-29

MORE AT Google

Loved the session pale ale I tried, pricey but worth it. Has a variety of beers from different breweries.

site_logo

Alkistis Pourtsidou . 2024-02-25

MORE AT Google

A good beer spot for local crafts, could sit for a few hours

site_logo

Joanna Bradshaw . 2024-02-20

MORE AT Google

Fantastic place for beers. They also have a much welcome selection of non alcoholic beers (including stout, porters, sours, etc) I'm not a regular, but when I want a nice pint, this is the first place I will go to

site_logo

Neim Echsemm . 2024-02-14

MORE AT Google

Brilliant bar. Great choice of beers and larger. Food good too.

site_logo

Sue Cail . 2024-01-21

MORE AT Google

Scott, the bar tender, was amazing. Friendly environment, drinks reasonably priced. The food was great and by far my best place of the evening.

site_logo

Alyson Neijman . 2023-12-31

MORE AT Google

5 stars and maybe starting to fade a bit. So many do. The bar is amazing. The beer is amazing...big kudos to the fabulous 6% house lager and American hop head beers. However, when you get to over £9 for a third of beer on the board that is not rare world class aged German or Belgium (or even aged Scottish) ...it risks becoming a bit silly. Stay strong Hanging Bat!

site_logo

Liam Burford . 2023-12-12

MORE AT Google

What a great little place this is. A really excellent range of local and not so local beers. Staff were really friendly and helpful and the food was really good. It was really busy when we arrived around 7pm but was a bit quieter from around 8:00pm onwards, although it was a Thursday evening. Would definitely call again next time we're in town.

site_logo

Ian Parkes . 2023-12-11

MORE AT Google

Good selection of craft beers and nice location but a tad on the pricey side which seems to be the standard for craft beer in Edinburgh.

site_logo

Debbie . 2023-11-14

MORE AT Google

Very chill pub, music isn’t too loud and the beers are nice

site_logo

Orion Toivonen . 2023-11-13

MORE AT Google

The waitress at this shop was very nice, I had a cold and kept refilling my hot water and adding honey.

site_logo

He Jiang . 2023-11-12

MORE AT Google

Creative beers that you don't get elsewhere. They were playing Disney songs. 5/5.

site_logo

Alena . 2023-11-08

MORE AT Google

A fantastic bar - with both a great beer selection but also tasty food, and good cocktails. Mostly keg beers - craft beer. Not a huge place. The smoked meats are cracking.

site_logo

Kristian Brown . 2023-11-06

MORE AT Google

Food is pretty good, wings are decent. Not sure how good the beers are, the staff were so unfriendly and miserable I didn't stay for more than one. Felt like I was imposing.

site_logo

Dougie Richardson . 2023-11-04

MORE AT Google

Great selection of beers; everything from sours, stouts and porters to pale ales. Friendly staff and vegan- and allergy-friendly menu. The kitchen accommodated my girlfriend's egg and milk-protein allergies with no issues. The Nachos with vegan cheese was delicious.

site_logo

Mads Andreas Elvheim . 2023-10-27

MORE AT Google

A cool dark atmosphere with a wide selection of beers and tasty, yet simple food. Kids were welcome and enjoyed the hotdogs.

site_logo

Jamie S . 2023-10-27

MORE AT TripAdvisor

I became a regular there during the five days of my stay in Edinburgh. The place bewitched us, we got addicted. Every member of the staff is super professional: they respect the customer, have a great sense of humour, they are super friendly, and they create an amazing, cozy atmosphere. I loved the food. Their fish&chips is extraordinary, their signature burger is delicious, just like the beef stew. AND the cocktails!!! Best taste, quality and value.

site_logo

Katalin Fekete . 2023-10-25

MORE AT Google

Lovely and cozy pub with a selection of craft beers, some of which are also from cask. Beers are a bit on the pricey side and drinks have to be ordered at the bar. Food is okay but nothing out of the ordinary. Loved that place.

site_logo

Dominik Jager . 2023-10-24

MORE AT Google

A great bar / cocktail bar. Fantastic atmosphere and very trendy styling. Excellent range of draft craft beers which change regularly, but this is much more than al beer house. There is a good range of cocktails too, which is great because that invites a very different crowd from the typical bearded beanie hat wearing craft beer aficionado. Food is typical bar fare - sandwiches, burgers, wings - but made with care and at a better level than most. Someone has put a lot of thought into this place.

site_logo

Robert Hyland . 2023-10-23

MORE AT Google

Great range of beers and cocktails too. Local beers where on when we went in

site_logo

gavin tosney crafting . 2023-09-20

MORE AT Google

Scot (yes, Scot from Scotland) was such a nice affable young man that this oldster from New England & his missus were quite charmed. Our 30-ish son & daughter-in-law from fashionable London told us that The Hanging Bat was their FAVORITE spot in Edinburgh & we're glad we followed their tip. And to be 💯% clear, the other two men staffing the bar were a pleasure to chat with as well! The large fish & chips might have been the best that these we've had in our visits to England & Wales. Lightly battered, fresh tasting, and oooooh those fries (chips? potato thingies? pick your favorite idiom). We chose the double IPA which I think was served from a cask at UK temperatures. But have no fear, fellow Yanks - the slightly higher temperature than you might expect only ENHANCES the taste of the hoppy brew. You can just feel your synapses snapping happily as they step outside your comfort zone 🤔🙃🥳 Alrighty, that's quite enough. What a lovely welcome to a (for us) new city. Thanks Hanging Bat!

site_logo

Jim Donahue . 2023-09-18

MORE AT Google

A brilliant beer bar in Edinburgh. Loved the selection of beers and the food was decent too. Will be back.

site_logo

PeterFLovesBeer . 2023-09-12

MORE AT TripAdvisor

Needs more bats!! Great spot though! I wish the music was not 90s but a darker mix of goth/industrial/metal.

site_logo

Janelle Iaccino . 2023-09-09

MORE AT Google

ここのフィッシュアンドチップスがお気に入り。店員さんは親切でお店の雰囲気もいいです。大好きすぎて2ヶ月の滞在期間中に何度も行きました。

site_logo

Yoko . 2023-09-02

MORE AT Google

Cool brewpub with a variety of beers on tap. A good place to grab a cold one.

site_logo

Steven Schwartz . 2023-09-01

MORE AT Google

Unfortunately, I do not buy the atmosphere of this place, which is not entirely clear what it should be like - a bit old, but also a bit new. Pretty good selection of craft beers but unfortunately due to the lack of atmosphere I wouldn't go back there again.

site_logo

Eliza M. Duchnowska . 2023-08-27

MORE AT Google

La comida estaba muy buena. Las mejores patatas fritas de todo Edimburgo! Fueron rápidos y trajeron todos los platos calientes. Tienen una amplia carta de cervezas. Como pega, el servicio fue algo antipático

site_logo

Carmen Gomez . 2023-08-26

MORE AT Google

Seat yourself. Order at the bar. Place was hopping when we got here and staff were bustling. Great atmosphere, great selection of beers and cocktails, great food selection. They were playing some funk and that made it even more better.

site_logo

Amanda Casteel . 2023-08-24

MORE AT Google

The Hanging Bat has a great selection of beer and whisky, and they make great cocktails. Bar was well themed. The food was delicious and had a good vegetarian selection.

site_logo

Anne A . 2023-08-20

MORE AT TripAdvisor

The first time in a year since I could get here and as always great beers, helpful, friendly staff. Never disappoints coming here

site_logo

GordonMogg . 2023-08-19

MORE AT TripAdvisor

Had the misfortune of visiting this place, ordered a beer, paid the man what was a slightly above average price for a pint and recieved a HALF, avoid at ALL costs, rip off merchants preying on the unwary, was only after ordering saw the signs saying no pints, pure con artistry, should be shut down

site_logo

19Plum67 . 2023-08-18

MORE AT TripAdvisor

Pub molto carino ed ottima selezione di birre artigianali. Piatti buoni e a buon prezzo.

site_logo

Claudia Marchetti . 2023-08-17

MORE AT Google

Really nice place with a fantastic selection of craft ales and cocktails. Not too OTT hipster or wine bar-esque; just chilled out friendly atmosphere and lovely staff. ♿ Accessibility: Although I entered on crutches it appeared completely level for wheelchair access - someone scooted past be coming from the toilets on a compact wheelchair which is a good sign. I'm pretty sure you'd be OK on anything other than a baryatric model wheelchair in here, at least for bar access, toilet and access to select seating. The raised seating area and downstairs dining area would be off limits and realistically I don't they could do anything about that.

site_logo

DPH . 2023-08-06

MORE AT Google

Friendly staff…Amazing porter on tap!

site_logo

S W . 2023-08-04

MORE AT Google

Beer was good quality. Food was good too, but my beef patty was rare (which I didn’t like that much). The place is very crowded, we were here on a Thursday afternoon and could only sit to a table which had been reserved for later. It’s better to make a reservation just to be sure.

site_logo

Reka M . 2023-08-02

MORE AT Google

Friendly service, superb food! I think of myself as a bit of a fish and chips connoisseur, and this was in my top 3 F&b ever. My partner and I both agree also that the chips themselves were first class, none of your skinny fry McDonald’s nonsense - these were proper skin on, crispy on the outside, fluffy on the inside and hot all the way to the bottom of the tub. I’m never fussed about peas with F&c anyway so it was a bonus they didn’t come with any. Very reasonably priced for these days and absolutely delicious. Great selection of non alcoholic beer and service with a smile at the bar. Love the decor as well, true to the name there are upside down bats on the beer taps.

site_logo

Amanda T . 2023-07-29

MORE AT TripAdvisor

Definitely the place is one of the local legends! Totally recommend when visiting Edinburgh, great atmosphere, beers and tasty food.

site_logo

Kuba Rechowicz . 2023-07-29

MORE AT Google

Wide range of craft beers and nice atmosphere. Maybe a bit noisy for people who are looking for a quiet place.

site_logo

Maxence Bellenguez . 2023-07-28

MORE AT Google

I would give zero stars but Google won’t allow you to. I’m not exaggerating when I say this was by far the worst restaurant experience I’ve had in my entire life. I was here on Friday 21st July for my friends stag do, ordered a beef burger at the bar to go to table 35. Time goes by and my friends are all eating and my beef burger is nowhere to be seen. There are however two chicken burgers that seem to have been brought to the wrong table (31) as no one ordered them. Somethings obviously gone wrong, no problem mistakes happen. I speak to the server first and he basically calls me a liar and claims it’s my problem as someone else has clearly eaten my burger. That’s clearly not the case as we’re all in close quarters I can see no one else has got a beef burger. I then go to the bar to speak to the manager/owner. Explain the situation. Same again he refuses to believe me. I’m flabbergasted at how poor the service is. I’m sure this tactic will work on some people, but I’m not giving in. After a few minutes of arguing back and forth he finally agrees to rectify the situation. Honestly though I wish I never bothered as it was such a hassle and the burger itself was so greasy and basically blue. I would never recommend this place to anyone. The owner/manager and the staff need a lesson in manners and would need to go back to basics with their customer service skills. The customer is always wrong in their eyes it seems.

site_logo

Anthony Doran . 2023-07-24

MORE AT Google

Similary restaurants in Edinburgh and Lothian

restaurant_img
3.6

1449 Opinions

location-icon128 Dalry Road
Brasserie
outdoor_seating_94246takeaway_94246delivery_94246

Overpriced and underwhelming food. Mixed grill was dry and tasteless. Please avoid

restaurant_img
3.9

2496 Opinions

location-icon184-186 Cowgate
American
outdoor_seating_94232takeaway_94232delivery_94232

Worst experience, not enough staff 1 guy behind the bar and 1 on tables. Had to wait for 25 minutes for a pint. Shite DJ and food is average. Must say the guy behind the bar Dean was very patient and professional although customers were arguing shouting. Deserves a medal for that bravery 🏅 😂

restaurant_img
4.0

1016 Opinions

location-icon61 Leith Walk
Brasserie
outdoor_seating_96542takeaway_96542delivery_96542

The food was amazing really tasty. Staff was amazing as well I will definitely be coming back again. And best of all it's Halal

restaurant_img
2.9

1899 Opinions

location-icon50 Marine Drive
Brasserie
outdoor_seating_206163takeaway_206163delivery_206163

Astronomical price for a hot chocolate-my partner and I took our baby for a walk and were shocked to be charged £10 for a hot chocolate and bottle of water. I don’t normally post reviews but I was appalled by this - totally unjustified.

restaurant_img
4.5

2801 Opinions

location-icon209-213 High Street
Brasserie
outdoor_seating_205539takeaway_205539delivery_205539

The best Nachos we have had in a long time. Good price for Edinburgh. Very good location.