GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.6

Based on 1.493 opinions finded in 3 websites

site_photo4

Nº 343 in 431 in South Kesteven

Nº 22 of 24 Chinese in South Kesteven

CUSTOMERS TALK ABOUT DISHES WITH..meatvegetableonionricecurryprawnduckprawnschillispicyfriedchickeneggcookednoodlesribslemonbean

comment_iconOpinions

This was excellent food. Made nicely, not greasy and very enjoyable. Had to wait about an hour to get the food but it was a peak time on Saturday night. Certainly the best Chinese takeaway I’ve experienced in quite a long while. I would recommend them.

site_logo

Martin . 2025-03-09

MORE AT Just Eat

amazing food lovely tasting hot perfect and fast delivery

site_logo

Emma . 2025-02-18

MORE AT Just Eat

Always a good takeaway from here. Never had a problem.

site_logo

Tom . 2025-01-12

MORE AT Just Eat

The chicken chow mein and shredded chicken tasted funny so we couldn't eat them, first time had a bad meal

site_logo

Jade . 2025-01-01

MORE AT Just Eat

Delicious as always and right on time 👍

site_logo

Thomas . 2024-12-24

MORE AT Just Eat

Absolutely awful - special fried rice was just boiled hard rice with some meat thrown in. No flavour. We ordered two Thai dishes that were just fried battered meat. Wouldn’t even give this a 1 out of 10.

site_logo

Kirsty . 2024-12-12

MORE AT Just Eat

Food delivered on time, chow mein is good. beef is tough, prawns not crispy or hot and chewy, s&s chicken bland, chicken curry so thick looks like jelly... Shan't be returning.

site_logo

Alex . 2024-12-08

MORE AT Just Eat

ordered sweet n sour chicken ball, balls turned up without and sweet no sour sauce ... so just the chickens balls to chew on ...

site_logo

Martin . 2024-10-31

MORE AT Just Eat

Ordered a curry and the meat and vegetables had obviously been cooked out of the sauce which was poured on top. The sauce was so think and the rest very watery so not great when served

site_logo

Beverley . 2024-10-20

MORE AT Just Eat

Great value, good portion size and fantastic flavour.

site_logo

Pete . 2024-10-19

MORE AT Just Eat

Food was soggy. Dumplings were hard. Won't be using again

site_logo

louise . 2024-09-27

MORE AT Just Eat

Food was hot and tasty, food portions are quite small.

site_logo

becky . 2024-09-06

MORE AT Just Eat

Food was really lovely and delivered on time.

site_logo

Alison . 2024-08-09

MORE AT Just Eat

Sad to say it was absolutely awful and gave me FOOD POISONING, avoid at all costs worse Chinese in Grantham, tasted rock hard and gone off

site_logo

Natalia O . 2024-08-05

MORE AT TripAdvisor

Worst Chinese I’ve ever eaten, 0/10

site_logo

Zak . 2024-08-05

MORE AT Just Eat

Really good tasting food that was nice and hot when delivered and great delivery time

site_logo

Jake . 2024-06-17

MORE AT Just Eat

Really enjoyed. Well cooked and great tasting

site_logo

Claire . 2024-06-15

MORE AT Just Eat

Food was ok but not as good as it used to be, been a little disappointed the last couple of times we've ordered. Hopefully next time will be back to normal!

site_logo

Alison . 2024-06-08

MORE AT Just Eat

so tasty, really enjoyed our first takeaway from here. definetly will order again. thankyou

site_logo

sharon . 2024-05-27

MORE AT Just Eat

Didn’t even chop the duck. Chow mein was dry. Food felt poorly prepared

site_logo

Joseph . 2024-05-04

MORE AT Just Eat

Will not be ordering from here again, the food is soggy and chewy- especially the chicken, prawn toast had a sprinkle of prawns- very unhappy, food arrived cold

site_logo

Domante . 2024-04-26

MORE AT Just Eat

Food arrived on time and hot, was honestly one of the tastiest I’ve had in a while. Highly recommend, my first time ordering from here but will definitely be ordering again. Delicious 😋

site_logo

Michael . 2024-04-21

MORE AT Just Eat

food portion small compared to other places and curry sauce was way to spicy I mean I love spice but that way to spicy the chickens satay chicken was dry but the sauce was nice apart from all that it was decent but not wow its amazing

site_logo

Jay . 2024-04-15

MORE AT Just Eat

Food quite nice but very small amounts for the price compared with similar in Grantham . Unfortunately we won’t be ordering in the future due to this .

site_logo

michael . 2024-04-15

MORE AT Just Eat

First time ordering and will definitely be ordering again.

site_logo

Claire . 2024-03-10

MORE AT Just Eat

Second time ordering now, food both times fresh, hot and really tasty!

site_logo

becky . 2024-03-02

MORE AT Just Eat

Absolutely delicious...best we've had in a long time

site_logo

Andy . 2024-02-08

MORE AT Just Eat

Fast delivery, hot when it arrived, fresh and tasted amazing. Thank you

site_logo

Chelsea . 2024-02-03

MORE AT Just Eat

The portion of cucumber and spring onion is so small

site_logo

Phalisa . 2024-01-21

MORE AT Just Eat

The food has changed since our last order, I usually order the same dishes but this time they were very different and not nearly as tasty as usual. Will have to find another restaurant now

site_logo

James . 2024-01-19

MORE AT Just Eat

cold rice. soggy chips. chicken was hard. spare ribs where cold and the curry sauce was in a lump.. no more food from any of just eats..

site_logo

Adrian . 2023-12-01

MORE AT Just Eat

We waited nearly 2 hours, ordered at 7.30pm. Delivered at 9.20pm.No apology from delivery driver, restaurant refused to refund any money. At least as a goodwill gesture you would expect a small percentage refunded. Obviously they are not bothered about keeping my custom, so I will not order from them anymore. There are plenty of other Chinese restaurants in Grantham.

site_logo

Sarah . 2023-11-26

MORE AT Just Eat

Delivery time was an hour and half which they slightly exceeded. I order from this Chinese regularly however the quality of the food last night was really poor. The squid and chips were so greasy we were unable to eat them.

site_logo

Louise . 2023-11-19

MORE AT Just Eat

Perfect every time will always go here best in town 1000% satisfied

site_logo

Dean . 2023-11-19

MORE AT Just Eat

Great flavours - good portions - highly recommend

site_logo

Kelly . 2023-11-19

MORE AT Just Eat

Not eaten here for around 15 years and tbf it was really good. The salt and pepper squid was certainly worth returning for. Ordered online and it came.bang on the recommended time.. thanks very much we will be back

site_logo

Chris Collins . 2023-11-06

MORE AT Google

Ordered seafood soup and Squid with vegetables. The squid was flavourless and the soup smelled like it had dish soap. First time ordering the soup and probably the last

site_logo

Silvana . 2023-11-05

MORE AT Just Eat

Best chinese I've had in a long time

site_logo

Kerry . 2023-10-27

MORE AT Just Eat

Only order Chinese food from you guys, its amazing everytime 😋 was a yummy birthday treat. Thank you

site_logo

Chloe . 2023-09-23

MORE AT Just Eat

The food was lovely. Vegetarian options tasted fresh and there was a good variety of textures. Shall be ordering again.

site_logo

Sophie . 2023-09-14

MORE AT Just Eat

Husband thought food was ok, but I was disappointed. Curry was watery, and fairly bland. All of it was rather tasteless to be honest.

site_logo

Michelle . 2023-09-01

MORE AT Just Eat

The best Chinese in town, tasty and not greasy at all!

site_logo

Joanne . 2023-08-20

MORE AT Just Eat

Food was quite greasy today didn’t enjoy it has left me with a stomach ache

site_logo

nicky . 2023-07-20

MORE AT Just Eat

Above average food and delivered early

site_logo

Stephen . 2023-07-16

MORE AT Just Eat

Absolutely love this place the food was perfectly cooked warm and would never eat anywhere else. For me this is the best Thai Chinese food to order in grantham delicious see you again very soon! ⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️

site_logo

Dean . 2023-06-21

MORE AT Just Eat

Food wasn’t great, wouldn’t order again. Delivery was quick however

site_logo

Isabel . 2023-06-10

MORE AT Just Eat

Worst Thai I’ve ever had, was not Thai, at best was very bad Chinese…. Tasteless

site_logo

B . 2023-06-01

MORE AT Just Eat

Always order from here. Very disappointed tonight, the quality of the food was not there tonight. The shredded chicken, we couldn't eat it at all. The prawn toast was really oily and the noodles were ok but not up to the usually standard.

site_logo

Felicity . 2023-05-19

MORE AT Just Eat

chips were stale, the rest was incredibly greasy

site_logo

Caitlyn . 2023-05-13

MORE AT Just Eat

Always beautifully cooked no matter how big or small the order. Delicious! Well done guys

site_logo

Andrew Durham . 2023-05-03

MORE AT Google

The food was cooked perfectly but it was very oily and it had no seasoning at all. All you could taste was the cooking oil. Delivered on time.

site_logo

Sashka . 2023-05-01

MORE AT Just Eat

Sauces watery and tasteless. Good delivery time.

site_logo

Katy . 2023-04-26

MORE AT Just Eat

Ordering was easy. Delivery was very early ( 45 mins ahead of estimated schedule ), which was very much appreciated. However, the egg fried rice was quite hard & the portions in general were small in comparison to other local restaurants, especially considering the price.

site_logo

lee . 2023-04-03

MORE AT Just Eat

Was easy to order and delivered on time but tasted cook from frozen as was cold in middle of a few things and microwaved to point the rice was so dry it felt like uncooked rice and any sauce that was in meal disintegrated, I am disappointed as usually nice when ordered from here as a treat .

site_logo

Sabrina . 2023-04-03

MORE AT Just Eat

2 poor dishes now. The Satay chicken is never Satay and the Chow Mein is awful. It’s not cheap either so I think now is the time to try others. Sorry.

site_logo

Chris . 2023-03-31

MORE AT Just Eat

Small portions compared to cost and other takeaways

site_logo

Mr . 2023-03-27

MORE AT Just Eat

Usually great but as the cost of living increases so does over heads. Almost £7 for every main dish and portions smaller and padded out with cheaper ingredients. Even the containers seem smaller. Example being the chilli prawns which we usually love and now tiny Shrimps. Have to hunt through the batter to find any prawn and man it was chewy. Lemon chicken had the smallest pot of sauce, never enough to cover the chicken provided. I’ll probably give another take away a go next time.

site_logo

Jamie . 2023-03-17

MORE AT Just Eat

Food quality and portion size wasn't good. Poor value for money, the plain chow mein didnt even fill the small container. Spring rolls were bland, chewy and greasy and the beef in Oyster was bland and insipid. Not great for £40!!

site_logo

Andy . 2023-03-09

MORE AT Just Eat

Fantastic experience. The quality of food is excellent and very authentic. It is certainly a cut above other Chinese/Asian restaurants in the local area in terms of food and dining experience. Looking forward to trying their takeaway food as well. Would highly recommend the Vietnamese spring rolls and the Thai curries

site_logo

J T . 2023-03-01

MORE AT Google

High quality food. A cut above the other Chinese restaurants in the Grantham area. Starters and Thai curries are especially good

site_logo

Scott Adkins . 2023-03-01

MORE AT TripAdvisor

Normally good food from here but not tonight. Noodles tasted like they had cleaning residue on them and the special fried rice was rice with peas and one prawn. Very disappointing tonight.

site_logo

Kayley . 2023-02-17

MORE AT Just Eat

I am a client for a long time,and really enjoy all the food so I am happy to order again . Also The person does the delivery is very kind and friendly 😊

site_logo

vicencia . 2023-02-04

MORE AT Just Eat

Food was really delicious, good quality and arrived at the time we ordered for which is brilliant. Lovely delivery driver too. Really good for Christmas Eve when I'm sure it's really busy.

site_logo

Isabelle . 2022-12-24

MORE AT Just Eat

The spare rib in batter was so nice. My favourite Chinese takeaway. Thank you 💕

site_logo

A . 2022-12-16

MORE AT Just Eat

terrible food, awful quality. Food was sometimes raw, saw non-professional cooks cooking. Food was not what i expected, took a long time to serve.

site_logo

Benjamin R . 2022-12-05

MORE AT TripAdvisor

Not right noodles was cold small portions no flavour

site_logo

Darren . 2022-12-03

MORE AT Just Eat

Excellent service. Thanks to the cook and the delivery driver. Great meal. Kids loved it.

site_logo

A . 2022-11-21

MORE AT Just Eat

Order delivered fast, nice and tasty food, thanks!

site_logo

Olga . 2022-11-12

MORE AT Just Eat

Fantastic service, quality food, nice friendly delivery driver.

site_logo

El . 2022-11-02

MORE AT Just Eat

Top rated food!!!! 1st time and will be using again!!!👍👍

site_logo

Ian . 2022-10-27

MORE AT Just Eat

A group of us went here to celebrate with me and unfortunately it was not a good visit. Can not give this place a good review as there was no atmosphere, it was very cold needed to keep your jackets/cardigans on. And to top it off the food wasn't warm enough and my chicken was tough and chewy like it was an old piece from a day before. Would of been better staying in and having a takeaway Chinese from my normal place. I would avoid this place if you are wanting an evening to enjoy and to be warm etc

site_logo

ALISONJAYNE22 . 2022-10-19

MORE AT TripAdvisor

The food was nice and service was perfect. Thank you. The only thing letting it down for me was the music. It was very strange having to listen to "I kissed a girl" by Katie Perry whilst sitting with my grandparents. And back to back Justin Bieber. Definitely not my cuppa tea. 🤣

site_logo

Stephanie * . 2022-10-03

MORE AT Google

Never really leave reviews but out of most of the Chinese we have had this is by far the best we have had in a long time. Everything was fresh/hot/ and delicious!! Will definitely order from here again.

site_logo

David . 2022-09-30

MORE AT Just Eat

My Usual go to Chinese was sub standard to normal. The duck was inedible it definitely wasn't crispy it was really fatty the cucumber and spring onion was dry also inedible. The remainder of the meal was stone cold, I have requested a full refund very disappointed.

site_logo

Wendy . 2022-09-17

MORE AT Just Eat

I found the Singapore noodles disappointing, some of the prawns had shells on and it was horrible to discover. The fried dumplings were actual itsu Frozen ready made dumplings (I buy them regularly and would recognise them anywhere) horrible experience

site_logo

Scarlett . 2022-08-26

MORE AT Just Eat

Really nice food! Fast delivery

site_logo

Shan . 2022-08-20

MORE AT Just Eat

Super fast delivery, very hot fresh and tasty

site_logo

Patka . 2022-07-11

MORE AT Just Eat

The noodles were dry. The portion size compared to others in town was small for the same price. The chips were great! Best part of the meal. Delivery was spot on time. Soso overall

site_logo

l . 2022-06-09

MORE AT Just Eat

Food horrid. Curry like water. All 3 chicken items. One was ment to be spicy vile. Chicken balls burnt and dry. Sweet sour sauce all could taste was vinigar. Salt pepper chicken all dry and more like shreded chicken. Omlete okay chips under this not even cooked properly.

site_logo

Karl . 2022-05-23

MORE AT Just Eat

Pancakes tasted stale, hoisin sauce was more a garlic sauce than plum and didn’t taste nice at all. Rest was ok, not the best but not terrible.

site_logo

Charlotte . 2022-05-21

MORE AT Just Eat

Very poor quality and quantity of food for the price. Very dry. Waste of £40. Not happy with my order at all. Bad customer service when I rang to complain.

site_logo

Sara . 2022-04-14

MORE AT Just Eat

Last time I order from this place everytime something is overcooked and unedbile. Last time it was the wings now ribs and lemon chicken both dry and tasteless. Only the dumplings are coming out well lately. Disappointing with the price and delivery time, would have enjoyed a sandwich more!

site_logo

Marlena . 2022-04-14

MORE AT Just Eat

Absolute rip off for the amount of food you get. Bland, Dry and poor quantity of food. Sarcastic girl on the end of the phone when I rang up to complain. Bad customer service. Waste of £40.

site_logo

Sara Morgan . 2022-04-14

MORE AT Google

Great food just a long wait; guess that’s the cost of a good restaurant 😄

site_logo

Richard . 2022-02-19

MORE AT Just Eat

Never had a bad order from here. Great food and plenty to choose from. Nearly always arrives early as well.

site_logo

Tom . 2022-02-19

MORE AT Just Eat

Sweet and sour pork is very authentic. We’ll def order that one again next time. Rice was quite dry, but edible. Kind of difficult to find a supermarket that sells good rice in the UK. Broccoli and carrot vegetables was good too. The beef udon, however was very salty and not edible at all.

site_logo

Charmaine . 2022-02-13

MORE AT Just Eat

Pre ordered before opening times. Food arrived earlier than stated but i do live very close.and i have been a customer for decades.5star accross the board..best in grantham hands down

site_logo

Gary . 2022-01-15

MORE AT Just Eat

Awful dishes. Plain and all tasted same. Chicken with cheshew nuts tasted like witj garlics only. Delivered 20 min early. Never again.

site_logo

liana . 2022-01-08

MORE AT Just Eat

First time ordering. Arrived early. Tasted great. Would use them again

site_logo

Tracy . 2022-01-08

MORE AT Just Eat

It’s NYE, little late - kinda expected. Awesome food though!

site_logo

Anna-Leah . 2022-01-01

MORE AT Just Eat

Food is always very tasty however their delivery driver a few times had been standing with his face right up to the door, pre covid i had no problem with this however when the pandemic was on its peak i kept telling him to stand back, luckily he wears a surgical mask to protect us on his drop off.

site_logo

Joshua Czarnecki . 2021-12-07

MORE AT Google

Takeaway for my son & daughter-in-law & we really enjoyed it. Always have a meal from you when they visit from Hampshire & never disappointed.

site_logo

Christine . 2021-12-06

MORE AT Just Eat

Not as good as previous orders. Food was not hot on delivery. A little disappointing.

site_logo

Matthew . 2021-12-03

MORE AT Just Eat

Duck was very greasy and didn't taste nice not enough duck sauce. Noodles greasy very salty . Not nice tonight at all use to love this place but gone down hill . Order took only 18 minutes to cook and deliver so I think not fresh just microwave.

site_logo

Craig . 2021-11-22

MORE AT Just Eat

Smaller portions than other takeaways but lovely food

site_logo

Karen . 2021-11-16

MORE AT Just Eat

Never ordered from here before but will be again best Chinese I’ve had in a long time .

site_logo

louise . 2021-10-21

MORE AT Just Eat

Last two orders have been disappointing. Reordered this time as we thought it may have been a one off previously. We have used restaurant and takeaway for years but no more. Food quality dropped greatly. Greasy. Watery sauces. Soggy. Battered Prawns good but the sweet and sour sauce that came in separate pot was fizzy and tasted off. Shame as we had always recommended

site_logo

Diane . 2021-09-19

MORE AT Just Eat

Lovely food, great service, ordered and delivered perfect

site_logo

Mark . 2021-09-04

MORE AT Just Eat

Great taste but portion size to small for the cost of the food

site_logo

Keren . 2021-09-03

MORE AT Just Eat

The young chap that delivered the food to my door was extremely sweet and polite, the prawn spring rolls are amazing, the curry was just so spicy, so Much so it was hard to taste all of the flavours. I’d consider using this take away again but I’d be sure to leave a note for them to tone the down the spice in their curry.

site_logo

Christopher . 2021-08-30

MORE AT Just Eat

Similary restaurants in East Midlands

restaurant_img
3.6

112 Opinions

location-iconSt Leonard's street
Chinese
outdoor_seating_105990takeaway_105990delivery_105990

The best salt and pepper.Authentic spice.

restaurant_img
3.7

153 Opinions

location-icon157 New Beacon Rd
Chinese
outdoor_seating_137069takeaway_137069delivery_137069

Food was delicious but ine dish was Missing. Normally no problem

restaurant_img
3.9

85 Opinions

location-icon61 Manor Way
Chinese
outdoor_seating_207043takeaway_207043delivery_207043

Ordered for collection, ready in 15 mins, meal for 5 of us. Great service and value. We had: Chicken with cashew nuts in yellow bean sauce, yummy Szechwan chicken, very nice Chicken curry, tasty Lemon chicken, lots of sauce Beef in Black Bean sauce, my favourite Singapore Chow Mein, fiery Sweet & Sour pork Cantonese style Large egg fried rice Singapore fried rice Chips Prawn crackers, FOC. All food was superb, see picture. We ate almost all of it, just a mid sized portion left for Sunday breakfast 😁 All in £58 Defo recommend.

restaurant_img
4.0

360 Opinions

location-iconA1 North Bound
Chinese
outdoor_seating_202740takeaway_202740delivery_202740

Really good food. Staff were friendly to us and our 5 month old baby. Will be back!

restaurant_img
4.0

349 Opinions

location-iconWestgate
Chinese
outdoor_seating_118737takeaway_118737delivery_118737

This is indeed a nice cosy place. Food is reasonably priced, the service is fast, and the lady serving our food was welcoming and friendly. There is good parking space near the restaurant, free for two hours, I think there is some scope to improve the food to make it more authentic Chinese food, it's needless to say that even best of the best restaurant could still be improved, and, this is not a criticism.