GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.2

Based on 1.929 opinions finded in 4 websites

site_photo4

Nº 346 in 830 in Bromley

Nº 2 of 6 Thai in Bromley

CUSTOMERS TALK ABOUT DISHES WITH..cookedfishcoconutvegetableschillicurrysoupprawnspicyricechickenprawnsmeatnoodlesduck

comment_iconOpinions

This is without a doubt the best Thai restaurant in South East London. The Rendang is superb. We moved out of it's catchment area and it's making me reconsider this major life choice.

site_logo

Daniel O'Brien . 2024-11-16

MORE AT Google

Just Ok. Rendang dish not worth calling a special. Spicy noodles not spicy in any way. Same for chicken wing starter but that was still tasty. Typical uk high street Thai. Could be so much better.

site_logo

John . 2024-10-23

MORE AT Just Eat

Very nice and generous amount of meat in the curry

site_logo

Rachael . 2024-10-18

MORE AT Just Eat

Food was cold, satay chicken was dry.

site_logo

james . 2024-10-12

MORE AT Just Eat

Not authentic Thai food, poor quality and bland. They even water down the sweet chilli sauce that comes with the prawn crackers.

site_logo

Leon . 2024-10-02

MORE AT Just Eat

Food arrived hot and was good value for money. Quick delivery, had no trouble finding our flat. Will be ordering again soon!

site_logo

Tony . 2024-08-14

MORE AT Just Eat

The favourite takeaway of our house! Always perfect, never misses. We love you Thai Delight x

site_logo

Hazel . 2024-08-05

MORE AT Just Eat

I was worried about the delivery time and then the food turned up right on time! Great food!! Love this Thai! great price and great food! 💖💖Thank you

site_logo

Jessica . 2024-08-02

MORE AT Just Eat

Very tasty food, really enjoyed the flavours and a bit different to anywhere else.

site_logo

A . 2024-07-21

MORE AT Just Eat

food was not good quality, would not order again. Even the crackers were burnt

site_logo

Rachel . 2024-07-19

MORE AT Just Eat

The food is OK but they never seem to be open!!

site_logo

R Dean . 2024-06-16

MORE AT Google

Thai Delight are always good. Lovely food and quick service.

site_logo

Mollie . 2024-05-24

MORE AT Just Eat

Best veg tempura I've eaten from a takeaway - light batter but delicious crispy veggies!

site_logo

Kate . 2024-05-12

MORE AT Just Eat

Such an amazing find for delivery, everything came on time, still hot, with generous portions. Tasted amazing, would definitely recommend their Pad Thai with prawns and their Roti. Will definitely be ordering from here again soon!!

site_logo

Caitlin . 2024-05-12

MORE AT Google

Ordered the massaman curry and prawn pad thai. They came in generous portions, hot off the wok and along with some complimentary crackers. I would highly recommend this place for some quick and easy Thai food.

site_logo

Ken Chiu . 2024-05-12

MORE AT Google

The food here is always fantastic.

site_logo

Jacqueline . 2024-05-06

MORE AT Just Eat

Food was good. Very fresh tasting.. Adequate sauces.. Would have prefered a different chilli oil, but that Just me. Thank you

site_logo

Martin . 2024-04-13

MORE AT Just Eat

Honestly the best pizza we've ever had, love from your neighbours.

site_logo

Alec Rowlingson . 2024-04-05

MORE AT Google

Order cancelled. No reason given. Very disappointed

site_logo

Callum . 2024-02-10

MORE AT Just Eat

Delicious pad thai and the vegetable tempura is incredible!

site_logo

Kate . 2024-01-20

MORE AT Just Eat

Thai Delight offers an outstanding take-away experience, bringing the same delightful Thai flavors to the comfort of your home. The efficient service ensures that your order is prepared with care, maintaining the authenticity and freshness of the cuisine. Whether it's a quick meal or a feast for a gathering, Thai Delight's take-away service delivers a taste of Thailand that you can savor in the convenience of your own home.

site_logo

Em L . 2024-01-19

MORE AT Google

Had a great time at Thai Delight! The food was delicious, staff was super helpful, and they give you good-sized portions. Definitely recommend checking it out! I recommend the Pad Thai and Massaman Curry :)

site_logo

Bryony Elliott . 2024-01-19

MORE AT Google

Our favorite 🇹🇭 place for take away in our area. Sydenham and penge. They deliver and may do eat in soon. Consistantly good and very friendly.

site_logo

Guy Gibson . 2024-01-06

MORE AT Google

I had the Massaman curry and coconut rice, it was delicious, great flavour and amazing meat. Really happy with my order, would definitely recommend.

site_logo

Alfie Phethean-N’Dong . 2023-12-15

MORE AT Google

Lovely food, but not much meat included. Only 4 prawns in the pad Thai, and only a few bits of chicken in the main

site_logo

Rachael . 2023-12-13

MORE AT Just Eat

Not up to the usual standard tonight, all dishes tasted completely different and not as nice

site_logo

Samantha . 2023-11-23

MORE AT Just Eat

The pad Thai wasn’t the best. A little greasy for me. But the meal still good. Just not great.

site_logo

Holly . 2023-11-04

MORE AT Just Eat

Hot and tasty food again from Tahi Delight. Really pleased with the quality and quantity. Great to find a restaurant with lots of tofu options

site_logo

Chloe . 2023-11-02

MORE AT Just Eat

Lovely tasting food and superquick delivery

site_logo

Mary . 2023-11-01

MORE AT Just Eat

Despite of the 4.7* reviews on Just Eat, we ordered take away and the food was not worth it. All meat dishes were disappointing: all meat was very tough to eat, beef wasn't edible. Tamarind and peanut source were also not freshly made but all from bottles, so disappointing. Such a simply thing like sticky rice, were too sticky and stodgy and chewy. Would never order there again. It's a shame.

site_logo

Vilma Arlauskaite Independent Estate Agent eXp . 2023-10-29

MORE AT Google

First time ordering from Thai Delight. Absolutely delicious food and generous portions. Extremely tasty and authentic. Will order again without hesitation

site_logo

Chloe . 2023-09-30

MORE AT Just Eat

I absolutely love the pad thai 😍 ❤️

site_logo

Imre Millert . 2023-09-20

MORE AT Google

Very small portions for price. Meat overcooked. Sauces over seasoned

site_logo

Terry . 2023-09-08

MORE AT Just Eat

Ordered via uber and couldn't leave a review. The food was utterly tasteless and watery. The rice looked grey. And the portions were very small. Not value for money and won't be ordering from them again.

site_logo

Adrian T . 2023-08-11

MORE AT Google

This was my first time ordering from here but won’t be the last. The food was delicious!

site_logo

Mel . 2023-08-09

MORE AT Just Eat

This has to be one of the best Thai places that I've ordered from.The food was authentic ingredients fresh and very flavoursome...I will be ordering again...Top quality 👌 Added to my faves. 😋

site_logo

kat . 2023-08-04

MORE AT Just Eat

I’ve ordered from here a few times now. Always very speedy delivery times with friendly delivery drivers. Love the Pad Thai and their veg spring rolls are delish. Always arrives piping hot with a small bag of comp prawn crackers. (I think comp with orders over a certain amount) Would highly recommend and will definitely order again!

site_logo

Rachel . 2023-06-15

MORE AT Just Eat

Gorgeous food every single time!

site_logo

Paul . 2023-06-09

MORE AT Just Eat

Lovely, tasty food delivered early with a smile... Recommended!

site_logo

Steve . 2023-06-03

MORE AT Just Eat

Tiny portions bearing in mind the price.

site_logo

Herval Webster . 2023-04-18

MORE AT Google

I am going to have to give up trying to order from here. I quite like the food but they have very short opening hours and the last few times I've tried to order online they just cancel the order without explanation. Will have to find another place as I can never seem to get any food from them.

site_logo

Jack Tozer . 2023-04-15

MORE AT Google

The Thai green curry was extremely salty this time.

site_logo

Natalie . 2023-04-08

MORE AT Just Eat

One of our favourite locals, contact them directly and not via just eat!!

site_logo

Mungo Pearce . 2023-04-07

MORE AT Google

The salt and pepper squid is awesome!

site_logo

John . 2023-03-31

MORE AT Just Eat

The driver left the food outside on the floor before I answered the door. The driver rushed back to his car before I could speak to him.

site_logo

Chidi . 2023-03-15

MORE AT Just Eat

Ordered Thai food from Thai delight and it was delicious the price is very reasonable i liked the green curry and red curry the sea food meat was awesome

site_logo

Mohammed Akram Mohammed Aathif . 2023-02-23

MORE AT Google

Great food, arrived quickly and hot.

site_logo

Allison . 2023-02-03

MORE AT Just Eat

Delivery was really fast. First time ordering from here and loved the food. Pad Thai and aromatic duck very tasty. And the chicken satay lovely thank you

site_logo

Denise . 2023-01-01

MORE AT Just Eat

Food turned up 35 mins later than it should have, even after 3 phone calls. It was also cold. The green and red curries tasted powdery. The manager had no customer service at all...he didn't even return phone calls even after saying he would. Terrible experience.

site_logo

Rakhee Handa . 2022-12-29

MORE AT Google

Never ever again £22.50 out of pocket for rubbery thai fish cakes, suspicious tasting barbecue spare ribs, and a sugary based masaman curry with a few bits of so called beef, this is so NOT authentic Thai food. The food was whipped up in less than 10 minutes which alone raises a lot of red flags then as I was leaving and got into my car, the husband and wife were watching me( guilt) because they knew what they had sold me. I ended up throwing everything in the bin it made me nauseas and gave me a stomach ache, put it this way, I don't think the meat was from any farm animal, this place should be closed down they are taking peoples money and selling stale non authentic suspicious food, steer clear, dont say I didn't warn you. It doesn't even deserve 1 star.

site_logo

Dee a . 2022-12-23

MORE AT TripAdvisor

Staff were friendly and polite but the food was awful, the fish cakes were like rubber, the barbecue ribs I ended up throwing in the bin because the meat was a bit suspicious and made me want to vomit. The beef curry, the meat was very rubbery and the sauce was full of sugar, I know its a takeaway but the food was whipped up very quickly it was not cooked from fresh and it is NOT authentic, if you want authentic Thai food then go to a proper sit down authentic restaurant NOT a backstreet takeaway. I should of listened to my gut, literally, it was the first time buying from this place and it will certainly be the last, I am still feeling nauseous the morning after. When I left the shop, the guy that whipped up the food and his wife stood at the window watching me, which made me question the type of meat that was used, why did/ do i feel so sick, this can only be a lesson for me to NEVER return neither recommend. BTW, my one star rating is generous to say the least. £22.50 down the drain.

site_logo

Dee alison . 2022-12-22

MORE AT Google

Really tasty food! Best I've had around here for Thai!

site_logo

Dave . 2022-12-19

MORE AT Just Eat

Great food, arrived hot and a polite delivery driver

site_logo

Allison . 2022-12-14

MORE AT Just Eat

Tasty food enjoyed by all the family! Would recommend

site_logo

Daniel . 2022-10-22

MORE AT Just Eat

Food was really tasty, arrived hot.

site_logo

Allison . 2022-10-14

MORE AT Just Eat

Very tasty Thai food. We had a sea bass dish and a duck massaman curry, which were both especially tasty. The pad Thai was fairly decent. Spicy prawn crackers and salt and pepper squid were great.

site_logo

Brooke . 2022-10-03

MORE AT Just Eat

Usually order and tastes great. This time came early but tasted bland!

site_logo

Natasha . 2022-10-01

MORE AT Just Eat

Food was dispatched 5 minutes after ordering which makes it very clear it’s just been stuck in the microwave. Red curry and panang curry pretty much indistinguishable from each other. Extremely spicy which we didn’t mind but some people might object to. Beef extremely tough and chewy, veg mainly big chunks of sweet potato.

site_logo

Charli . 2022-09-26

MORE AT Just Eat

Never ordered from here before, fancied some thai food as haven't eaten it in years and was very satisfied with the quality of food, only thing I would say is we ordered for two and maybe change the 1 can of drink when you spend over £30 to 2 cans or a bottle, other than that I can't say anything other than the meal was lovely and would happily order again :)

site_logo

James . 2022-09-24

MORE AT Just Eat

Decent food but weirdly restrictive opening hours means it's never open when I want to order.

site_logo

Jack . 2022-09-16

MORE AT Google

I always order from this place, I think their Massaman Curry is delicious, the portions are decent and prices are reasonable for London. In fact, I was still eating leftovers the next day

site_logo

Kam Y . 2022-09-04

MORE AT Google

The prawns that came on my PadThai were definitely off. Quite smelly and tasted a bit weird too. Only realised the bad smell after trying 1 or 2 which made me wake up to stomach problems. Besides that the chicken PadThai was just awesome. That one I would order again but the prawns choice never again.

site_logo

Gabriel . 2022-08-27

MORE AT Just Eat

Very simple Thai restaurant in Penge. Ordered Pad Thai Noodles and Thai Style Chow Mein. The later one tasted much better than the Pad Thai. But just that in both the dishes, it was more oily.

site_logo

Baran Raju . 2022-07-09

MORE AT Google

Surprised with the poor quality of the food considering the ratings. Didn't seem particularly fresh and was all too spicy (and this is coming from someone very tolerant to spicy food). Delivery time was good but would not order from this place again.

site_logo

Daniel . 2022-07-08

MORE AT Just Eat

Quality of food has improved since last ordered!

site_logo

Caroline . 2022-06-30

MORE AT Just Eat

Food is very good but the green curry was spicier than usual. Just a tad too hot.

site_logo

Huw . 2022-04-30

MORE AT Just Eat

Order two curries via Uber Eats. They look more like soups!!! And full of oil, worst curry I have ever ordered. Not recommended!!!

site_logo

Adamowicz Adamski . 2022-04-18

MORE AT Google

Always great tasty food, served quickly.

site_logo

Mike Johnstone . 2022-03-26

MORE AT Google

Massaman curry is hands down the best I’ve ever had, and I’ll always keep coming back for it. Unfortunately the vegetarian sides are kind of rubbish. Vegetable tempura was vile, left all of it. Just spongey tasteless batter on unseasoned veg. Veg spring rolls I had last time, they were tiny and crispy, not much to shout about. However that massaman…. I dream about that massaman. Nothing could persuade me to order from anywhere else! And that’s why I only docked one star for the sides. Try the massaman !

site_logo

Mil . 2022-02-27

MORE AT Just Eat

Enjoyed as always. Our favourite takeaway! Thank you

site_logo

Hazel . 2022-01-29

MORE AT Just Eat

Very fast but really not very good today. Food didn't taste fresh and just not up to usual standard.

site_logo

Caroline . 2022-01-28

MORE AT Just Eat

Awful meal, spent 28 pds and only rice edible, I eat at Thai restaurants all the time an the Tom kha soup an green curry an crab starter did not taste anything like what I’ve eaten before. When I phoned to speak with them they put the phone down on me!! Charming!

site_logo

Sarah . 2022-01-28

MORE AT Just Eat

Small portions. Thai Green curry was extremely salty. Won’t order from here again

site_logo

Richard . 2022-01-20

MORE AT Just Eat

Very very bad!!!!!! Ordered deliveroo, food was cold and portion was SMALL!!!! Ingredients felt like outdated!!!! Poor quality is covered with super spiciness!!!! AVOID AVOID AVOID!!!!

site_logo

Anchenmaa Kara-Ool . 2022-01-09

MORE AT Google

Meh. The main disheses were really watery and also really salty. It was bit overpriced. All in all a little uninspiring.

site_logo

Tim . 2022-01-09

MORE AT Just Eat

Not nice at all. Old ingredients

site_logo

Daniel Delikatnyi . 2021-12-18

MORE AT Google

The best thing about this take-away was the van of 7up, even that was overpriced! Ordered Thai red chicken curry, had to bin it as it was laced with sugar! Not to mention there were about two pieces of Chicken in it. The salty ribs were fatty and not seasoned well, very disappointing!

site_logo

GILLIAN KIELY . 2021-12-04

MORE AT Google

Very salty food, Tom Yum was not great and rice was very stodgy.

site_logo

Jonny . 2021-11-11

MORE AT Just Eat

My favourite Thai place EVER, I’ve never been disappointed and it really is the best Thai food I’ve tasted

site_logo

Sarah . 2021-10-16

MORE AT Just Eat

Lovely food with speedy delivery

site_logo

Lisa . 2021-09-06

MORE AT Just Eat

Ordered on Uber Eats and it won't let me leave a review for some reason. The prawn toast had barely any prawn so just tasted of fried bread (£5.50 complete rip off) and the Pad Thai tastes of absolutely nothing with stuck together peanuts and only 4 of the tiniest prawns. I will never ever order from here again, atrocious!!

site_logo

Priya AKA Jedi Mind Trick Dragon . 2021-08-22

MORE AT Google

On Deliveroo it says 50% of the entire menu, but thats a big joke. They put the prices double and now its 50% off? Why would you do that guys? Can of coke was £3.50 without a discount? These prices are nowhere to be found in London restaurants! Cmon guys…

site_logo

Karolina Gr . 2021-07-21

MORE AT Google

Rather unimpressed. The food was soggy and overcooked.

site_logo

Catherine Knight . 2021-07-15

MORE AT Google

Excellent food. Really pleased to have found them as hadn’t found a decent Thai near Anerley

site_logo

Nem . 2021-07-07

MORE AT Just Eat

Delicious food. Quick delivery. Good customer service. Very happy.

site_logo

Sophie . 2021-06-27

MORE AT Just Eat

Really fresh, light and tasty Thai. Definitely one of the best takeaways we’ve had. Would definitely recommend.

site_logo

Anna . 2021-06-27

MORE AT Just Eat

I do not like leaving bad reviews. In my life i have left 2. I have just received a delivery and i have to say the food was shocking. I ordered 3 things. Garlic rice .Couldn't decern any garlic at all and it was overcooked. Tiger cry this was overcooked and swimming in a watery vegetable water. There was a sml pot of spicy ( not) dressing on the side. Ped makham. A tamarind duck. Which actually had a nice flavour. But again was so tough The skin was thick and flabby All in all its sitting untouched in the kitchen I rang to express my disappointment. The response was I clearly wasn't familiar with thai food. ( been to Thailand many times and eat at least once a week.) This conversation went on for several minutes. Apparently they don't receive complaints I gave them several opportunities to rectify this. An offer was for me to collect a curry as they don't know what I would like. I ordered a delivery as I could not get out. So this was not helpful. Will never use or recommend this restaurant Hungry and 30 pounds poorer. Disgraceful food and terrible customer service.

site_logo

Julie C . 2021-06-18

MORE AT TripAdvisor

This is a family favourite, does the best pad Thai I’ve ever had! Love love love!

site_logo

Sarah . 2021-06-12

MORE AT Just Eat

We order from here all the time and it’s always excellent !

site_logo

Nicola . 2021-05-22

MORE AT Just Eat

Food was plentiful, really tasty and fresh. Most importantly was very good value for money and is better than other thi options in the area that are twice the price👍👍👍

site_logo

Paul . 2021-05-10

MORE AT Just Eat

Good was ok at best. Really not great. Starter was pretty awful to be fair. Probably won't order from here again.

site_logo

Tim . 2021-05-06

MORE AT Just Eat

Our food has just arrived and it is absolutely disgusting. The £7.50 papaya salad is a half-filled tub of papaya, carrot and tomato that looks like it was made days ago. The £5.50 fish cakes are comically tiny and are just deep fried frozen ones that have an inedible foam texture - straight in the bin as they taste vile. The anaemic-looking chicken wings were on a bed of old lettuce. The prawn pad Thai was the only edible thing in an order of over £30. I don’t understand the good rating they have — I wouldn’t eat food from this restaurant even if someone else paid for it... do not do it to yourself.

site_logo

Matt . 2021-05-03

MORE AT Just Eat

The food was delicious! Great portion sizes, came hot and we really enjoyed it.

site_logo

Kirsty . 2021-04-15

MORE AT Just Eat

regularly order from this place, highly recommended!

site_logo

Uilleam . 2021-04-03

MORE AT Just Eat

Tasty food, good veggie options, good delivery time, reasonably priced!

site_logo

danjoyce1985 . 2021-03-27

MORE AT Just Eat

Solid Thai, the duck was a reasonable portion for 1, the pad Thai was lovely, the sweetcorn and fishcakes were a little odd but overall a really nice meal

site_logo

Harry . 2021-03-09

MORE AT Just Eat

Everything was 10/10. The best takeaway around here

site_logo

Emily . 2021-03-05

MORE AT Just Eat

Great food, very tasty and not greasy, good flavour, one downside is now free prawn crackers with £15 order as promised but not the worst thing in the world

site_logo

Aaron . 2021-02-20

MORE AT Just Eat

Delicious! Will be ordering again for sure

site_logo

Nadia . 2021-02-14

MORE AT Just Eat

Just delicious! Beef masaman and coconut rice. Crispy chilli squid to start. Yum

site_logo

Abigail . 2021-02-12

MORE AT Just Eat

Similary restaurants in London

restaurant_img
4.2

271 Opinions

location-icon41 Upper Elmers End Road
Thai
outdoor_seating_119236takeaway_119236delivery_119236

We decided to visit the restaurant looking for a decent Thai restaurant in the area. It was an underwhelming experience. We visited on a Friday night, and initially were the only people there. A short while later two other people arrived, but nobody else. The atmosphere was uncomfortable, and the restaurant had a strange musty smell. Food was decent and service quick but not very welcoming. When we arrived there was no proper welcome, just a point at the table we had to sit at. Drinks - without any ice in the gin and tonic - were dumped on the table, and when we were trying to leave the waiter wanted to keep talking to us about football. Overall a very disappointing experience.

restaurant_img
4.0

1238 Opinions

location-icon131 Queensway
Thai
outdoor_seating_94798takeaway_94798delivery_94798

First of all 5* for service is only given for the lovely waitress called kat. She was so nice and accomodating, som tum salad was too spicy I know its suppose to have a kick but it was too spicy considering I usually eat a lot of spice also it wasn’t tangy how it should be. The chicken shrimp fried rice was just rice and protein thrown in a pan it had no colour and was bland also the chicken was fried chicken pieces. The noodles however was great I opted in for chicken plenty breast slices (forgot the name but its the spicy flat noodle that tasted authentic). They dont do lime so that was odd instead was given lemon for the somtum salad because I said it is not tangy at all. Now the shreded duck was amazing and so was the prawn tempura/ chicken satay. Restaurant was empty on a wednesday evening however many take away orders. There was 2 men as we came in not sure if they are managers or staff (one had no uniform on so looked like the manager as he was walking around and talking like one to another staff member. No hello not even a look like a smile would be nice. They do lack customer service like if customers are coming in and your first to see them you should say hello or whatever not be silent specially when your right opposite the customers the whole 2 hours. Kat was amazing though the lovely woman. The noodle and rice picture was screen shot of a video hence why blury. Also chilli oil is a sweet paste and not actual chili oil which I found bizzare

restaurant_img
4.4

652 Opinions

location-icon38A East Street
Thai
outdoor_seating_152897takeaway_152897delivery_152897

Authentic tasty freshly cooked thai food. Clean clean restaurants. Friendly welcome.

restaurant_img
3.8

251 Opinions

location-icon16-18 High Street
Thai
outdoor_seating_192940takeaway_192940delivery_192940

We had a truly wonderful meal. The food was so delicious and well presented. It was quiet in the restaurant as it was late on a Sunday evening. I was unsure whether to go based on some reviews but am so glad we did. I am certain to go back!

restaurant_img
0.0

0 Opinions

location-icon44A Newlands Pk
Thai
outdoor_seating_116176takeaway_116176delivery_116176