GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.2

Based on 906 opinions finded in 5 websites

site_photo3

Nº 251 in 691 in Hounslow

Nº 10 of 24 Asian in Hounslow

CUSTOMERS TALK ABOUT DISHES WITH..cookedcoconutcurryfishprawnsmeatprawnchickenspicyfriedbasilriceducknoodlessquid

comment_iconOpinions

¡El peor Pad Thai de la historia! ¡Verdaderamente no creo que el chef haya estado en Tailandia! ... ¡desperdicio de dinero! ... ¡Los fideos parecían ser “tagliatelle”, las gambas eran camarones en lugar de gambas! ... ¡Totalmente insípidos y grasosos! ¡Nunca más!

site_logo

Diva M . 2024-07-28

MORE AT TripAdvisor

Lindo, acogedor y ordenado lugar para tomar su delicioso café y deliciosa rama! Hay un par de mesas afuera y adentro. Las personas que trabajan allí son amables y sonrientes, sin duda volvería!

site_logo

Ioanna_Vrk . 2024-05-27

MORE AT TripAdvisor

Been here for a couple of meals in the past month - once with my daughters and once with my wife. Excellent food and service both times. High points were the beef coconut curry with amazing depth of flavour, and the chicken satays. Also had the chicken and cashew, and when my wife said she was worried about seafood allergies with the oyster sauce, they cooked it from scratch with an alternative. Cannot recommend enough.

site_logo

Tim C . 2024-03-17

MORE AT TripAdvisor

Disappointing & unpleasant in every sense! The restaurant was drafty, noisy (wind chime by door, dirty plates being stacked noisily) and unpleasant sewage smell, poor service as waiters kept bumping into the back of chairs and coats whilst they rushed around and took no notice when we complained about draft or noisy wind chime and the food was not very nice at all as it was very greasy and lacked flavour. It’s in a great location but will not ever be returning!

site_logo

Nyonya6 . 2024-02-27

MORE AT TripAdvisor

Had a fresh reasonably good sit in meal a couple of weeks earlier but this takeaway was poor. The squid was rubbery, the satay chicken was clearly not freshly cooked and dry and even the noodles were tasteless and not moist. Most of it went into our recycle bucket so think twice about takeaway.

site_logo

Ken M . 2024-02-23

MORE AT TripAdvisor

The food is lovely. Most of the staff was courteous, except one lady seemed a bit grumpy when we were asking for some more time in deciding from menu. Just very small place.

site_logo

Marco . 2024-02-19

MORE AT TripAdvisor

Food was not fresh terrible food will never go there again. Was really looking forward to it but when it come was poor food quality the taste not good at all wouldn’t recommend it.

site_logo

Elizabeth A . 2024-02-17

MORE AT TripAdvisor

Ate here after a long day in London. Food was excellent, service very friendly, and prices very acceptable. Service was very quick, which suited us as we were hungry and tired, but may have been a bit too fast if we’d wanted to make an evening of it.

site_logo

975Jimbo . 2024-01-01

MORE AT TripAdvisor

Prompt delivery, nicely packaged and well presented food, no spills or leaks, generous portions, reasonable prices. Another really enjoyable meal from this charming little restaurant in Chiswick which has become a firm favourite.

site_logo

GluggingKrug . 2023-12-03

MORE AT TripAdvisor

Sadly, having eaten from/ ordered from this restaurant previously. The quality and the care has dropped significantly, and I will not be returning or recommending for the foreseeable. I ordered dim sum and duck spring rolls- absolutely awful! Clearly store bought and frozen, terrible taste and consistency. A simple main was ordered for the two of us dining. Pad Thai, and a white steamed fish… it took nearly 2 hours! We kept checking and we kept getting a giggle or a hand wave. In the meantime it was clear that the delivery drivers were the priorities of the evening and those in the restaurant were not important. No care. The pad Thai was over cooked and nearly no prawns or veg. The white fish was a joke! And when asked, the restaurant confirmed it was a frozen fish fillet, but couldn’t even clarify what the fish was?!. It barely counted as a meal in its size! We were so hungry and tired we just ate and reflected dimly, the bill came, and the cost was insane for what was offered ordered and received. It’s sad to say of a place I previously enjoyed

site_logo

s r . 2023-11-10

MORE AT TripAdvisor

Usually really tasty and delicious, this time didn't feel the same, I would still order again.

site_logo

Chris . 2023-10-17

MORE AT Just Eat

Food is always good here, been ordering from here & eating in for several years. If you've been to Thailand you'll know the food is very authentic here. My only disappointment is that from time to time they have a fill in cook & you can tell because the food quality becomes a bit hit & miss. Tonight the Chicken Satay starter was so overcooked, dry & shrivelled up, while the Duck Curry was quite flavourless & it's a regular dish for me, so I know it's usually so much better. However the Weeping Tiger sirloin in tamarind sauce was fantastic - expensive but so worth it & portion sizes are really good. As always the Thai Milk Tea is incredible, the best one I get is always here.

site_logo

Barbara . 2023-10-11

MORE AT Just Eat

It was early but that's OK, I wish I had a bit more chicken in my meal.

site_logo

Segen . 2023-10-02

MORE AT Just Eat

We were told they were running late and it was still hot and delicious.

site_logo

Stephanie . 2023-09-30

MORE AT Just Eat

We were driving home to SW14 and wanted somewhere we’d be served quickly, ideally Chinese or Thai and when we saw Torthai, we thought we'd give it a try and parked up. I’m surprised at some negative reviews here because our experience was extremely positive. I expected the food to be okay but nothing special. However, all the dishes we had were EXCELLENT: tasty, piping hot and very clearly freshly prepared to order. The beers were gloriously cold and were served promptly. It took a few minutes before our order was initially taken although we got our menus immediately we sat down, but after that we were looked after very efficiently and service was faultless. Although it was a Wednesday (around 8.30pm), they were doing a good takeout/delivery trade and the tables began to get full around 9.00, we never felt forgotten or ignored. Our servers were quick, attentive and friendly. This is a lovely little place doing really great food at reasonable prices. I’d very happily stop off here again if the opportunity arose.

site_logo

GluggingKrug . 2023-09-08

MORE AT TripAdvisor

Was great however I'm still waiting for a refund as they couldn't find a driver and had to cancel my order. I'm still waiting for a refund please.

site_logo

Jo . 2023-09-02

MORE AT Just Eat

The sticky rice was like a brick, but the red curry was delicious

site_logo

Nicole . 2023-08-29

MORE AT Just Eat

Delicious hot tasty high quality food!

site_logo

Naheed . 2023-08-29

MORE AT Just Eat

Went out for what was supposed to be a light lunch treat on long week-end Sunday. Very disappointing, to say the least! Ordered Crispy Duck to share for two. Waitress tried to bring us two portions when we only wanted one. She barely spoke English. The food was not at all crispy, nor very ducky - don't quite know what it was. Survice was dreadful. She brought one cup of coffee and the second one about 15 minutes later. When asked why the delay she said 'so many take-away'! We declined to pay the surcharge but it was still quite expensive for what it was. We will not go there again.

site_logo

alephzero2015 . 2023-08-27

MORE AT TripAdvisor

Mi ha portato un mio amico che vive nel quartiere, devo dire buonissimo! Il locale è intimo e curato, il personale gentile e sorridente . La qualità del cibo davvero ottima ed il prezzo molto accessibile. Ed avevo paura di avere sete durante la notte ed invece super leggero . Lo consiglio vivamente.

site_logo

Iamfede27 . 2023-08-05

MORE AT TripAdvisor

I eat here regularly for years, so I know their food well. They must have a new chef because the Duck Curry that is usually one of their mildest had a spice hit that was too much. The Panang Curry was missing it's usual creaminess, quite watery & it usually isn't. Also the protein in both curries (duck & chicken) was quite a small amount compared to how much is usually in their dishes. The Satay Chicken starter had a Malaysian satay flavour (more spice, less peanut & watery dipping sauce), instead of the usual Thai style thick peanut flavour that we love. Also the chicken was dry & that never happens. The Dim Sum were good & of course the Coconut Rice and Thai Iced Tea are always absolute magic & they still were tonight. I don't like the new Malay style cooking this chef brings to an authentic reliable Thai restaurant, I hope the new chef isn't staying too long.

site_logo

Barbara . 2023-07-17

MORE AT Just Eat

Never received a order, contacted with restaurant, no help whatsoever, been advised by restaurant to contact Just Eat .Restaurant is stating that the order is delivered, but I didn’t receive my food, this happened second time with Tor Thai, I’m regular customer but never order again.

site_logo

ANDRZEJ . 2023-07-15

MORE AT Just Eat

As always delicious, this time had an issue (my mistake) and they solved and resolved instantly, friendly and helpful.

site_logo

Chris . 2023-07-07

MORE AT Just Eat

Delivered late and chicken was dry. The rest of it was nice.

site_logo

Sarah . 2023-06-30

MORE AT Just Eat

Tom yum fried rice with tofu was delicious 😋

site_logo

Chris . 2023-06-28

MORE AT Just Eat

Delicious and big portions, yummy

site_logo

Chris . 2023-05-31

MORE AT Just Eat

I've been a big fan of Tor Thai for years, a regular customer, but lately their portion sizes are becoming ridiculously small yet prices remain high. Also finding their curries quite spicy, while the ones I usually order are known to be mild, now have some spice - maybe they have a new chef? My Panang Curry that's usually made with coconut CREAM, was really watery this time & made with watered down coconut milk. Their Red Curry is usually made with coconut milk & that's the difference between the two. Bit disappointed at the dropped standard. They still make the best Thai Iced Tea.

site_logo

Barbara . 2023-05-08

MORE AT Just Eat

The quoted 20 minutes turned out to be 55 - they clearly started preparing it when we arrived to collect. Then when we got it home they’d got one of the dishes wrong. Not a one off either - I can’t remember any trouble free order from them. The food is very good, which is why we keep giving them another chance, but a great chef is let down by useless FOH.

site_logo

Andy . 2023-04-21

MORE AT Just Eat

Excellent food, so much choice for vegetarians. Our waiter Worawat was so friendly and provided exceptional service. Would be good to have baby change facilities as we came with 2 babies. But other than that, food was outstanding. Would highly recommend the soups, corn cakes and aubergine stir fry. Delish!

site_logo

Jilna V . 2023-04-13

MORE AT TripAdvisor

The vegan pad Thai felt like it had so much oil in and the tofu was soaked in what I can only assume was the same oil. Maybe refried although I would not wish to state this as fact. I actually couldn’t eat it in the end and threw it away. Very disappointed.

site_logo

megan . 2023-04-01

MORE AT Just Eat

The food was late and my tummy did not like it the next morning. Stay away!

site_logo

Stefan . 2023-03-28

MORE AT Just Eat

Great food and massive portions. Decent selection of wine and really friendly attentive service. Would absolutely recommend. A full vegan section on the menu too which was a nice surprise!

site_logo

samanthagK4845YO . 2023-03-27

MORE AT TripAdvisor

Excellent and very tasty food . PadThai had very few prawns. But the taste made up for that

site_logo

George . 2023-03-24

MORE AT Just Eat

Please may we have a full refund as discussed on the phone earlier? Food wasn't hot

site_logo

Richard . 2023-03-24

MORE AT Just Eat

So having previously been to this restaurant with a friend, we revisited tonight. The restaurant was fairly busy. Once we sat down, after 5 minutes, we had to ask for menus. There were 2 young female waitresses who seemed very uninterested in giving any kind of decent customer service. One in particular made us feel like we were being an inconvenience. Again we had to ask to place our order and then about ten minutes later my friend's meal came out . I expected mine to come out soon but this did not happen. Around ten minutes later a waitress came over to say that there would be another ten minutes delay on my dish or I could choose something else from the menu. We really didn't understand why a different dish could be cooked sooner and when I asked why she didn't have a coherent answer. We questioned why one dish had been bought out so early and why they hadn't simply delayed my friend's dish so that both could come out together. I said I would wait but in the meantime asked to speak to the manager. At least ten minutes later the manager hadn't appeared. When I asked one waitress where the manager was, she replied the manager wasn't there. I was puzzled as to why I hadn't been told that when I asked to see the manager. I then asked to speak to whoever was in charge. This person also didn't appear till another 5 minutes later, after which my food arrived too. The person in charge did apologise but it seemed very insincere. After the meal , the waitress cleared the table. Around fifteen minutes had passed and we were not asked if we wanted anything else or dessert or coffee etc. I beckoned to the waitress who didn't come over but just bought the bill over without checking what I had called her for. I asked to speak to the guy in charge again to be told he had gone home! At this point we had had enough and paid the bill minus the service charge!!! and left. The food was good but the service was easily the worst service we had encountered for a long while. The female waitresses need to be advised that treating their customers with disdain does not make it likely they will return. We definitely won't be returning.

site_logo

saQ7290CZ . 2023-03-08

MORE AT TripAdvisor

Delivery from just eat was awful, waiting almost 2 hours and food was left on the doorstep, meaning our currys spilt out. Awful delivery service. That being said, food was great and love the restaurant itself, will always go back to them for food but not happy with just eats service tonight.

site_logo

Lydia . 2023-02-17

MORE AT Just Eat

Absolutely delicious meal. 5 out of 5 stars !!! Every single dish was extremely tasty and came quick. The staff were so kind and friendly. It was my first time having Torthai and I cannot wait to go back for the lamb curry (the BEST curry I’ve ever had in my life! Meat was so tender and flavourful!). Thank you to all the staff and chefs for a wonderful evening, see you soon !

site_logo

alliyah14 . 2023-02-15

MORE AT TripAdvisor

Prices up, Standards down. Chicken satay sticks have halved in size. Green curry barely has any chicken.

site_logo

Erron . 2023-02-09

MORE AT Just Eat

Always great food, that’s why we keep ordering but portions of Phad Thai getting smaller though.

site_logo

P . 2023-01-31

MORE AT Just Eat

Love the tofu pad Thai, just wish it was a bit saucier :) the calamari is the bomb — it’s very flavourful and meaty

site_logo

Kristine . 2023-01-24

MORE AT Just Eat

the food has still not arrived. It’s now 50 minutes late

site_logo

Stuart . 2023-01-20

MORE AT Just Eat

Ordered the green curry and a middle dish and both were delicious. We also ordered prawn crackers and never received them and they were on the bill! Have had better service and Thai food elsewhere but still pretty decent

site_logo

Tiidgey . 2023-01-14

MORE AT TripAdvisor

We went in fairly late and the young staff looked devastated to see customers. The service was ok but the staff did not seem interested in working or helping (unhappy). The food was ok but not much meat in the main courses. The starters were better than the mains. The beer was nice but very expensive. Ok food with miserable staff and expensive.

site_logo

paulrE2971OL . 2023-01-09

MORE AT TripAdvisor

The food was awful inedible thrown away - Greasy overcooked heavy fires batter Dietary needs not met & Unlike any thai we have ever eaten! Will NEVER order from here ever again!

site_logo

Sahira . 2022-12-31

MORE AT Just Eat

Gorgeous food. Professional courier. Highly recommended restaurant. 5 🌟 🌟 🌟 🌟 🌟

site_logo

Mary . 2022-12-23

MORE AT Just Eat

We really did not enjoy this food. Received a delivery from just eat. The calamari was good but we thought the duck was bland. We also ordered a massaman curry that did not indicate on the just eat website that it did not come with rice and that rice had to be ordered separately. Before writing this review I double checked just eat to see if I had missed a note about ordering rice but there was nothing. In addition, the curry was very salty while the potatoes tasted as though they were boiled and then added in the end so had no flavour. Overall we were so disappointed and sadly will not order from this restaurant again.

site_logo

CPGI . 2022-12-10

MORE AT TripAdvisor

It was disappointing that the main meal, massaman curry did not come with rice and it was not clear that rice had to be ordered separately. Having a bowl of curry on its own was not dinner. Furthermore the duck was fatty and bland. The calamari was quite good and so was the best part of the meal.

site_logo

Coleen . 2022-12-10

MORE AT Just Eat

Very little chicken for the price

site_logo

Nico . 2022-11-29

MORE AT Just Eat

I often order from Tor Thai, i can say im a regular customer and often order a Pad Thai with prawns. But this time the taste of the prawns was awfull. Like really bad. Not sure if i will order again.

site_logo

Davide . 2022-11-04

MORE AT Just Eat

This is my go to Thai preferred restaurant as it's quite authentic. Unfortunately the food portions keep shrinking but the quality is always outstanding, I still return again and again.

site_logo

Barbara . 2022-10-31

MORE AT Just Eat

Just delicious excellent green curry

site_logo

LYNDA . 2022-10-28

MORE AT Just Eat

Calamari was to big and so chewy that i had to spit it out. Sorry for being so grafic

site_logo

Andy . 2022-10-22

MORE AT Just Eat

Order chicken fried rice and a dose of Prawn pad Thai. The rice tasted pretty good, the pad Thai … not so much…also I managed to find 3 small/medium sized prawns total. Disappointing:/

site_logo

Ricardo . 2022-10-10

MORE AT Just Eat

Great quality food and delivery was on time

site_logo

Sheila . 2022-10-08

MORE AT Just Eat

Nice noodles but really poor portions the box was pretty empty

site_logo

Gigi . 2022-09-25

MORE AT Just Eat

Food was not as hot (temperature) as I would have liked, but delicious even so.

site_logo

paul . 2022-09-24

MORE AT Just Eat

Quick service and excellent food! Could not recommend enough!

site_logo

Jeffrey . 2022-08-27

MORE AT Just Eat

My favourite Thai in the area - love the pad see ew!

site_logo

Caroline . 2022-08-26

MORE AT Just Eat

Really disappointed with the whole meal, most of it was cold and soggy by the time it arrived

site_logo

Estrella . 2022-08-23

MORE AT Just Eat

I often order from this restaurant, but this time something happen with the chilly on my Basil Fried Rice. I know its a spicy dish, but they literally put too much. It was not possible to eat the dish at all.

site_logo

Davide . 2022-08-10

MORE AT Just Eat

Fresh ingredients, full of flavour.

site_logo

Elisa . 2022-08-10

MORE AT Just Eat

It took.a while.to arrive but it was delicious and worth the wait.

site_logo

Lucie . 2022-08-10

MORE AT Just Eat

Frankly our meal was a disgrace. The sticky rice was indeed sticky so much so it had coagulated and a fork could not separate it. The chicken in the pad Thai was tough and uneatable . The noodles were tough and had a fishy taste so perhaps the chef prepares them beforehand in a mixed pot. And so it goes on… It is with regret that I am posting this review as all of us residents in the locality had high hope of this restaurant- sadly that is not the case. Please raise your standards and you may then have a loyal following.

site_logo

Izabela x . 2022-07-16

MORE AT TripAdvisor

Ordered once and they completely missed my order so they never sent it. We were waiting for 2 hours and no way to contact the restaurant or just eat customer support. I ordered again next day and order was late. They really need to improve.

site_logo

Nikolaos . 2022-06-28

MORE AT Just Eat

Mix up with one of the items, which could have been an issue as the recipient was Muslim, however they delivered chicken instead of prawn by mistake, so it wasn't too terrible of a thing - however, it is something I'll have to stress in future orders.

site_logo

Martin . 2022-06-19

MORE AT Just Eat

Didn’t come till 7:55, noodles were just one huge clump and none of it was warm. Prawn toast paid £6.50 and you get 4 small thin slices…not worth it. Very disappointed in the noodles being one big clump and stuck together

site_logo

Olivia . 2022-05-31

MORE AT Just Eat

The driver was very nice and helpful, and the food was outstanding wow! Thanks ThorThai

site_logo

Jordy . 2022-05-29

MORE AT Just Eat

Food made without love and cheaply

site_logo

Bardon . 2022-05-24

MORE AT Just Eat

Green curry was wonderful. I ordered the tofu, and it was so good I was convinced it was chicken

site_logo

Dominc . 2022-05-22

MORE AT Just Eat

Booked dinner on a Fri night via the Fork app with half price on food which seemed too good to be true but honestly, was not! Vv nice staff, really helpful. Nice atmosphere, tho slightly odd smell wafting up from basement at times, think it's just old London plumbing. V good gyozas, slightly boring prawns in blankets (my error in ordering), v tasty mains, especially the pcu beef. Lush mango sorbet and absolutely amazing coconut and almond iceceream, one of the best we have ever had. Thoroughly recommend!

site_logo

seanbB6758SM . 2022-05-20

MORE AT TripAdvisor

I’ve eaten here before and it’s always been good but this wasn’t great - starter was very soggy and pad Thai was tasty but very dry

site_logo

Emma . 2022-05-15

MORE AT Just Eat

We order from Tor Thai regularly and the food is so so delicious and the quantity is also good. Just this time the Basil Fried Rice was soooooo spicy. We struggled to eat it with the red Thai curry.

site_logo

Deepali . 2022-05-15

MORE AT Just Eat

Waited ages to be served, delivery drivers food seemed to be a priority. They didn’t seem to know anything about shellfish allergies. Food, when it eventually arrived was tasteless.

site_logo

doctorsgirl9 . 2022-05-06

MORE AT TripAdvisor

Lunchtime waited 20 minutes before order taken, meanwhile food was cooked for several Deliveroo messengers, They didn’t understand a shellfish allergy and food was mediocre when it finally arrived. Disappointing

site_logo

Susan J . 2022-05-06

MORE AT TripAdvisor

Amazing food! The food was delicious…best Thai food I’ve ever truly tasted. Efficient and hot food. The staff were friendly. This was for my 40th birthday. The only flaw was that we felt a bit rushed to eat as they wanted the table afterwards.

site_logo

RBee1982 . 2022-05-04

MORE AT TripAdvisor

Great food as always! Green n red curry was 10/10 and had just the right amount of spice. Fried rice went down like a treat with curry.

site_logo

Julius . 2022-05-03

MORE AT Just Eat

Everything was delicious! Contrary to its name, the basil fried rice didn’t contain basil lol, but flavour wise, it was still tasty.

site_logo

Kristine . 2022-04-19

MORE AT Just Eat

They waited for us as we were running late after finishing work! We ordered so much food and everything was delicious! Relaxed athmosphere, soft lights, romantic set if you'd like to see it that way. Definitely recommend it and will go back soon!

site_logo

jadedice88 . 2022-04-13

MORE AT TripAdvisor

Visited Thorthai 2 April. The food was one of the best Thai we have had. Service was fantastic and attentive. The starter of a sweet and sour soup was sublime. All in all couldn’t fault this lovely restaurant. Will definitely return when next in Chiswick

site_logo

DBY306 . 2022-04-03

MORE AT TripAdvisor

the food was average, some was soggy

site_logo

kate . 2022-04-01

MORE AT Just Eat

Used to really love the food at Tor Thai, noticed their serving sizes are about half of what they used to be and the amout of meat (chicken, duck, beef, prawns) have been majorly reduced too, but prices are still high. Either they have a new chef or they're clawing back the £££, but it feels like a customer rip off at this point.

site_logo

Barbara . 2022-03-23

MORE AT Just Eat

Great food, quick delivery time!

site_logo

Clevin . 2022-03-14

MORE AT Just Eat

It was challenging delivering the food but great service

site_logo

Henry . 2022-03-10

MORE AT Just Eat

Really tasty food, the good reviews are warranted! Portions could be larger (if ordering without rice - only a few chunks of meat but sauces are rich so still filling). Will order again

site_logo

katrine . 2022-03-09

MORE AT Just Eat

Food came 45 mins late and was stone cold.

site_logo

Stuart . 2022-03-05

MORE AT Just Eat

We’ve ordered several times from Tor Thai and it’s always been soooo good. The quality of food and the flavours are on point. I’ve also earned 5 stamps and now got a £21 discount for my next order. This is overall a really good place.

site_logo

Deepali . 2022-02-27

MORE AT Just Eat

I had vegetable gyozas 10/10, Corn cakes 11/10 and vegan pad Thai 10/10. Though it was hard to choose what to have because everything looked very tasty

site_logo

carlapattenden . 2022-02-26

MORE AT TripAdvisor

The app said that the food was delivered on time, even though it wasn’t. Had to ask for an update to find out that the order is delayed. Poor service.

site_logo

Neringa . 2022-02-25

MORE AT Just Eat

Food was a little cold as the delivery took so long however the food is absolutely delicious.

site_logo

bee . 2022-02-15

MORE AT Just Eat

Good food but poor service! I called the restaurant after 20 min delay and they said they couldn't find my order. Turns out the delivery driver had already picked it up as it was delivered 10 min later, but it had already messed my evening plans up.

site_logo

Nevena . 2022-02-09

MORE AT Just Eat

İ did not take the order you give it wrong person

site_logo

Zekeriya . 2022-01-18

MORE AT Just Eat

The pad Thai is too sweet and a bit dried.

site_logo

Hannah . 2022-01-11

MORE AT Just Eat

2 hours late and then the wrong order!!!

site_logo

Rebecca . 2021-12-28

MORE AT Just Eat

Always a high standard. And love that the majority of the packaging is environmentally friendly.

site_logo

Stephanie . 2021-12-06

MORE AT Just Eat

Thanx tor thai! Excellent service

site_logo

Eimear . 2021-12-05

MORE AT Just Eat

The vegetarian Somtam had fish sauce which is unacceptable. Also had too much vinegar. Had to throw it The red curry and basil chicken was super delicious Massaman curry was good not wow!

site_logo

Deepali . 2021-11-28

MORE AT Just Eat

In the past we have dined at the Tor Thai quite often and this evenings meal was one of the best we have had. But the occasion was completely spoiled by the very slow service. It was galling to sit waiting to be served whilst...

site_logo

NED de Q . 2021-11-27

MORE AT TripAdvisor

Over 2 and a half hours late. Food was delicious though

site_logo

Elle . 2021-11-26

MORE AT Just Eat

Very, VERY small portion of sticky rice, prawn crackers were in lots of little broken pieces. Not that impressed if I’m being honest.

site_logo

Dave . 2021-11-22

MORE AT Just Eat

We always order their green and red thai curry. It is soooooooo good. But they take a long time to deliver. Next time will try something new !

site_logo

Deepali . 2021-11-21

MORE AT Just Eat

Similary restaurants in London

restaurant_img
4.2

260 Opinions

location-icon5 Green Parade, Whitton Road
Asian
outdoor_seating_192696takeaway_192696delivery_192696

Had heard good reviews, so we ordered a take away. Meal arrived eventually after 2 hours of waiting and the restaurant refusing a refund due to their late delivery. The worst curry we have ever had, with three bits of lamb in a completely different sauce to the one we ordered. DO NOT RECOMMEND

restaurant_img
4.2

349 Opinions

location-icon68 High Street
Asian
outdoor_seating_210074takeaway_210074delivery_210074

We celebrated my son’s 30th birthday at Ing Thai on Saturday. The food was great as usual and the service was outstanding. Special thanks to Rose who when out of her way to make us all feel welcome.

restaurant_img
4.2

4773 Opinions

location-icon369, Hanworth Road
Asian
outdoor_seating_154990takeaway_154990delivery_154990

We thought we would try the restaurant out.l, due to the publicity on YouTube. Well what can we say, it was poor, the food was pathetic and it certainly wasn’t a taste of Pakistan. The Khari Chicken was pathetic, kebabs full of haldi, nan and roti tasted like baked bread and the sauces should taste refreshing- it was all rubbish

restaurant_img
4.1

2308 Opinions

location-icon3 Spur Road, Busch Corner
Asian
outdoor_seating_182005takeaway_182005delivery_182005

I regularly buy from Bayleaves for years, their food is really good, portion sizes are great & the taste is wonderful. We regularly get Korma & Pasanda curries, Butter Chicken with either plain rice or mushroom rice. Also their Naan are fantastic.

restaurant_img
4.0

164 Opinions

location-icon566 Chiswick High Road
Asian
outdoor_seating_87265takeaway_87265delivery_87265

Never had a bad experience with staff / customer service. It's not a restaurant with servers it's a take out place!