GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.1

Based on 505 opinions finded in 1 websites

site_photo3

Nº 658 in 792 in Bournemouth

CUSTOMERS TALK ABOUT DISHES WITH..strawberryoldvanillacrepebananastrawberriesmeltedcreamwafflepaypeanutfruitchocolatecoffeemust
Score
OpinionsNoteTripAdvisor5053.1

comment_iconOpinions

Absolutamente horrible. Mal servicio. Nos dijo que nos fuéramos mientras todavía estábamos comiendo porque estaban cerrando. Ignorándonos cuando los llamamos solo porque les pedimos unos minutos más para comer.

site_logo

Neha D . 2024-12-14

MORE AT TripAdvisor

Sprinkle Gelato tiene las mejores opciones de postres en Brighton! El helado es fresco, y los crepes son para morirse. Una pequeña porción de cielo en el corazón de la ciudad.

site_logo

Mahnoor R . 2024-08-23

MORE AT TripAdvisor

Sweet Heaven in Brighton! Sprinkle Gelato offers a fantastic array of gelato flavours that are rich, creamy, and utterly delicious. The waffle was perfectly crisp and topped with just the right amount of syrup. A must-visit for any dessert lover!

site_logo

Sehrish Tariq . 2024-08-21

MORE AT TripAdvisor

Tengo más sabor lamiendo mi ventana, nunca más, bajando colina a lo grande. No voy a volver, eso es seguro, evita.

site_logo

Trail39501351520 . 2024-06-03

MORE AT TripAdvisor

We arrived there and was waiting at the till for at least 10 minutes and nobody served us nor did they even acknowledge us. While we were waiting to be served at the till, what we saw was unbelievable. Firstly, the working area/sides were filthy, and clearly had not been cleaned or sanitised. Secondly, we watched the waitress, pick up banana, then dropped it on the floor, then continued to serve it onto a waffle, which is absolutely vile. Then, one of the sauces had run out so needed refilling, the waitress could not open it so proceeded to use a visibly dirty and unclean cloth to open it, whilst covering the nozzle, which is evidently cross contamination. After seeing all of this and being so appalled by the lack of cleanliness and poor service, me and my friends decided to leave and find dessert elsewhere. We will not be returning, and the staff need to be trained properly on food hygiene and how to keep their workplace clean.

site_logo

Liv C . 2024-05-06

MORE AT TripAdvisor

FANTASTIC COMPANY HERE LOOKING AT MYSELF IN THE MIRROR BECAUSE THE TV WASNT WORKING! I BOUGHT A WAFFLE TO CELEBRATE PANCAKES DAY AND IT WAS JUST WONDERFUL! STRAWBERRIES FRESH OFF THE BUSH AND COFFEE I HAVE ATTACHED IMAGES OF NY VISIT WILL COME AGAIN Martin Sent from my iPhone

site_logo

MartinSmithOfficial . 2024-02-14

MORE AT TripAdvisor

Very pleased the best hot chocolate topped with cream and marshmallows going the extra mile for me strawberries on the side yes it’s a craving lol 😂 crepes are amazing good value for money

site_logo

JessicaJulie Trueman . 2024-02-11

MORE AT TripAdvisor

What I’m about to write is such a shame, given that we love the food at sprinkles. We came in today as a special treat, and witness as an elderly man came in and asked the server for their help. He explained that his mobility scooter was nearly out of charge and he wouldn’t have enough to get him the last 2 miles home. He pleaded for them just to let him in to charge his scooter, and even offered to pay for the electricity. The server contacted her manager, who said ‘no’. Where has the human compassion gone?! Absolutely shocking.

site_logo

Holly P . 2023-10-21

MORE AT TripAdvisor

Bad customer service. In store and even more dire via email, telephone and Facebook pages. I will write review on all pages available until they resolve my issue. Management may need to go on a top up course.

site_logo

N_onsj . 2021-06-11

MORE AT TripAdvisor

Mi pareja y yo decidimos darnos el capricho de ir aquí por primera vez el otro día. No hace falta decir que, por mi título, no fue un gran placer. Mi pareja tomó un batido y yo un helado. Mi comida estaba bien, sin embargo, había un pelo en el batido de mi compañero y cuando se lo llevaron al empleado, hicieron un gran problema al rechazar un reembolso, así que nos dimos por vencidos y nos fuimos. Decidí darles el beneficio de la duda y volver a intentar ir por un helado normal unos días después. Y cuando entré no había personal en absoluto. Tuve que esperar hasta que apareciera alguien, teniendo en cuenta que era la mitad del día de un viernes. cuando alguien finalmente apareció y ordené, tomé mi cono de helado y me fui. Inmediatamente me di cuenta de que el cono estaba muy, muy rancio. Era comestible pero decepcionante en general.

site_logo

91elanar . 2020-10-09

MORE AT TripAdvisor

Social distancing not good menus not cleaned after use, all sat too close. Won’t be going back until they adhere to the rules and regulations, very disappointing.

site_logo

AmandaExpertReviewer . 2020-09-17

MORE AT TripAdvisor

Visitado el domingo 30 de agosto 7. 30 hs. Estaba muy ocupado y previamente teníamos que esperar. Sin embargo, la cola se gestionaba bien y nos atendieron con prontitud. Una vez que ordenamos, nos sentamos y nos llevaron la comida y la bebida a nuestra mesa. Los gofres eran geniales y el café y la tarta eran buenos.Me quedé muy impresionado a pesar de estar muy ocupado, los estándares de higiene eran insuperables. el personal está impecablemente preparado por persona en el lugar. Un miembro del personal se movía continuamente por la cafetería con un carrito de limpieza. El lugar estaba impecable y reluciente. La vajilla y los cubiertos no brillaban ni una marca de agua a la vista. Este tiene que ser uno de los restaurantes más limpios que he visitado. Lo que en el clima actual es muy tranquilizador.

site_logo

Shoey001 . 2020-08-31

MORE AT TripAdvisor

Busy as on eat out to help out scheme but clearly not enough staff to cope with demand or keep tables clean service very slow and disappointed with today's selection of sorbets/gelato flavours tables to close togeher and hand drier in toilet wasn't working

site_logo

Tracey5868 . 2020-08-26

MORE AT TripAdvisor

Vine a tratar a mis hijos. Pero todos los panqueques y waffles contienen lácteos, por lo que lo que se menciona en su sitio web no es cierto. La calidad es realmente mala que no sea un helado italiano. La galleta no se podía comer. El lugar está lleno de adolescentes. Si te gusta la buena comida, este es un lugar para evitar.

site_logo

suqeena . 2020-08-24

MORE AT TripAdvisor

Great selection of ice cream Felt myself like in Italy Good coffee Friendly and polite staff Can seat outside

site_logo

feduvic . 2020-08-06

MORE AT TripAdvisor

Si te gusta el helado, este es el lugar para visitar. Nos sentamos afuera y se admiten perros (bonificación). Pedimos 3 bolas en una tina esperando 3 bolas redondas pequeñas, en su lugar obtuvimos una montaña de helado. Aunque fue muy agradable, hay un límite en la cantidad que realmente puedes comer. Lamentablemente, nosotros (2 de nosotros) no pudimos terminarlo entre nosotros. Para 5 . 50, tiene una muy buena relación calidad-precio. El Sundae también era excelente pero bastante caro (para el postre), pero de vez en cuando valía la pena. A mi hija le encantó. Lamentablemente tampoco pudo terminarlo.

site_logo

AndrewTheExplorerUK . 2020-07-13

MORE AT TripAdvisor

Absolutely disgusting treatment during a time where there is no money about due to Covid 19 charging your normal price yet making your portion sizes half the size it usually is and being melted and it only consisting of only ice cream and nothing else yet charged us top price I will definitely not be ordering from here again and then told there was nothing that could be done

site_logo

tracysM8042QC . 2020-05-31

MORE AT TripAdvisor

Great sprinkles store. the order all arrived at the same time which was nice. Will definitely visit again in the future. Facilities were a bit grubby would be my only criticism. Staff were very pleasant and great with the children when ordering.

site_logo

roymD203MZ . 2020-02-16

MORE AT TripAdvisor

The place is big, bright and cosy! And there are many option for different levels of sweetness.I often come here to take notes and write essays for university; I usually order one of the triangular short cakes with a tea from the selection.However, today I had an awesome chocolate with marshmallows, that cheered me up in a time of need.Thank you, Somi (Hope I wrote that right)!

site_logo

Nikkacen . 2020-01-11

MORE AT TripAdvisor

Came here with my friends had plenty of choice in the menu the staff were friendly generous portion sizes only thing I found was abit too sweet i would definitely go back

site_logo

Climber815548 . 2019-12-09

MORE AT TripAdvisor

Best place to go for desserts very well presentation love it.we would love to go again and recommend to all.....

site_logo

Compass67483635167 . 2019-11-03

MORE AT TripAdvisor

Went with the family and had a mixture of deserts, my wife had the peanut butter M&M waffle which was really nice, I had the Jar which was full of chocolate, vanilla ice cream, M&M's, Bueno and Ferrero Rocher peices served on a slate plate with chocolate drizzled over it (really nice and highly recommend). The kids had ice creams in a cone with one having the apple crumble (I think) which was really nice. Not even I could manage all of it which takes some doing. Staff were quick to serve, wasnt very busy at the time but it was a Sunday evening.

site_logo

6rahamParkes . 2019-10-28

MORE AT TripAdvisor

Visit this sprinkles quite a lot and food is always very nice however customer service is not very good. I ordered a cookie dough which I was enjoying until I noticed a hair poking out of it,it was clearly not my own hair since mine is black and the hair was blonde. I took it up to the counter to one of the staff and said about the hair and he said speak to the manager and walked off after a couple minutes he came back and took the hair out of the food and said it wasn’t human hair, he seemed very confused and said what do you want me todo very abruptly he then continued to look at the hair and put it back on the food.He eventually got the manager who was also quite abrupt about the situation she said since the hair was never in the food she couldn’t do anything about it but the hair was pulled out the food by the other staff member.They never gave me any compensation and was not polite about the matter what so ever and did not even apologise about it at all.The staff made me feel very embarrassed about complaining and overall the staff where not apologetic at all.

site_logo

Angelbearne . 2019-10-20

MORE AT TripAdvisor

The place to go for a sweet tooth craving! The cookie dough is my personal favorite but they also have an impressive selection of treats and ice creams to choose from!

site_logo

Rachel W . 2019-10-16

MORE AT TripAdvisor

Love love love this place. Great value for money too. The portions are very generous! You come out feeling very satisfied.

site_logo

JLR454 . 2019-10-04

MORE AT TripAdvisor

Went with my wife and my daughter for a couples of ice creams to take away and the guy at the counter started the conversation like this"HELLO MATE".... First of all I'm a customer not your mate, anyway I ordered 4 ice creams to take away and I asked about a box for a take away and my " mate" looks like didn't know what I'm talking about.... A quick advice for you... next time try to be more professional and if you don't know something ask you colleagues.... MATE

site_logo

DOMENICOSALSERO . 2019-10-01

MORE AT TripAdvisor

was told about sprinkles by a friend and so we visited omg the waffles we had were amazing i couldnt eat all mine but hubby finished his would recomend the choclate brownie waffle

site_logo

CAROL J . 2019-09-28

MORE AT TripAdvisor

Overpriced poor quality, stay away! Horrible area, near the skanky bus station! Yuk yuk yuk Yuk yuk!!

site_logo

666colin . 2019-09-07

MORE AT TripAdvisor

Took my 2 grandchildren for a treat as they are not normally allowed things like this, service ok didn’t think there was a lot of choice ice cream wise though. It would be good if there was a children’s menu or for smaller appetites as portions are large for little ones.

site_logo

AmandaExpertReviewer . 2019-08-29

MORE AT TripAdvisor

If you want ice cream great, if you want something like cake off the menu don’t bother as they run out of most things, somebody needs to order stock in to keep customers happy, why have a menu with no food !!!! Very poor service

site_logo

Kems555 . 2019-08-28

MORE AT TripAdvisor

The whole experience was terrible. we ordered a chocolate m&m; waffle and we were given a peanut m&m; waffle.someone in my family has a severe nut allergy and if they had eaten it they would be hospitalised or worse. the staff were oblivious with what they had served and this poses a severe threat to anyone with an allergy. they also got the entire order wrong, forgetting half our order and giving us drinks we hadn’t ordered. the milkshake that was ordered was also served with the peanut version which is also a problem. overall would not recommend. untrustworthy staff who are non the wiser of the risks of allergies. quality of food is below average

site_logo

gabby_0105 . 2019-08-21

MORE AT TripAdvisor

I tasted the Fruits of the wood, and mango gelato. Truly repulsive. A sickly sweet synthetic taste. Avoid like the plague. You're better of going for a magnum!

site_logo

DorsetWhite . 2019-08-12

MORE AT TripAdvisor

We planned on going here in the evening but didn’t have time, so went here the next morning before we left for home to have an ice cream for breakfast . Lovely spacious parlour with nice decor and ice cream to die for. The variety was enormous and the gelato definitely lived up to the hype.

site_logo

Georgiacatmum . 2019-08-12

MORE AT TripAdvisor

Sehr nettes Personal, gemütliche Atmosphäre, guter Kaffee und grosse Auswahl an leckeren Gelati. Immer einen Besuch wert!

site_logo

Colin_Schuetz . 2019-08-07

MORE AT TripAdvisor

An absolute please a group of eight were passing by to the seafront from the station , loved each scoop of ice cream we chose.

site_logo

eyem2014 . 2019-07-29

MORE AT TripAdvisor

io e mia figlia abbiamo ordinato un waffle e un pancake, primo ordine arrivato sbagliato, prontamente sostituito, con sentite scuse e porzioni molto abbondanti. Staff gentile e disponibile, prezzi ottimi considerando le quantità e bellissimo locale. Un po' troppo alta l'aria condizionata, per il resto consigliatissimo!!!!! Consoderazione finale: ho chiesto un pancake ed è arrivato prima un waffle poi una crepe......servizio forse da rivedere?

site_logo

AntonellaEly . 2019-07-24

MORE AT TripAdvisor

what can i say about sprinkles except i want to live there, if you love ice cream you will love sprinkles

site_logo

shauna m . 2019-07-02

MORE AT TripAdvisor

We had a really good experience at sprinkles. They had a very large selection of ice creams and deserts. Would definitely go back

site_logo

annalisacorrigan . 2019-07-01

MORE AT TripAdvisor

Difficult to choose what to eat from the menu, you simply can't order everything. Have had waffles and a sundae here. Simply amazing and delicious. This is the place to go if your looking for some dessert or have a sweet tooth. Definitely going to return when in Bournemouth next, this place is hard to resist!

site_logo

baredman . 2019-06-10

MORE AT TripAdvisor

Come here every year and every year we are impressed! Have recommended to friends who are equally impressed. Looking at about £7 ish a waffle or sundae but they are absolutely massive and easily be shared... although I never do!

site_logo

Amber S . 2019-05-31

MORE AT TripAdvisor

Would not recommend anyone going here. No atmosphere. Bland. Awful. So expensive. £17 for 2 adults and 3 children. Can get an equally good ice cream at beach for £2 each. Never again!

site_logo

adabournemouth . 2019-05-30

MORE AT TripAdvisor

I have been coming here with a friend for a year every fortnight , to my horror they have stopped serving fresh cream and replaced it with cheap squirty cream , we will no longer be going and so disappointed

site_logo

honeykinny . 2019-04-03

MORE AT TripAdvisor

Vi stannade till och beställde både glass och diverse bakverk till. Riktigt trevlig personal och vår beställning var riktiga konstverk när de kom till oss. Vi blev riktigt mätta och belåtna. Rekommenderas en varm sommardag.

site_logo

frasse_k . 2019-03-24

MORE AT TripAdvisor

An ice cream parlour with a fantastic selection of delicious ice creams. Served in a variety of ways. BUT quite pricey really.

site_logo

David K . 2019-03-21

MORE AT TripAdvisor

Disappointed as no vegan options. Most places cater for vegans, and other ice cream places do. Shame sprinkles doesn’t

site_logo

Lindi T . 2019-03-19

MORE AT TripAdvisor

Some things are just so indicative of everything that's awful in the world today that they don't even deserve to be described. I would suggest that the memory of this place be swept under the carpet, but i wouldn't want to tarnish the grime under there with an association to this place.

site_logo

Daniel S . 2019-02-17

MORE AT TripAdvisor

I am an avid sprinkles visitor, and this trip blew my mind. Honestly the rudest staff I have ever encountered. That young Spanish women needs to be sacked ASAP. Huffed and puffed at my every request, not to mention her complacency. Very sad, will never visit again.

site_logo

NizBrown . 2018-11-17

MORE AT TripAdvisor

かなり量があるので、これを食べただけでおなかがいっぱいになってしまいます。ご飯のあとに別腹とはいかないかもしれません。夜遅くまでやっていて、夏はかなり混みあっています。

site_logo

Manamana71 . 2018-11-13

MORE AT TripAdvisor

Came here today. Had a waffle with what was meant to be maple syrup. I got the waffle and after my first price I thought it tasted funny. I asked my cousin to taste it and she said it wasn’t maple syrup. Had an orange taste. I asked the girl to perhaps replace it and she said she needs a manager for that. The manager came over and said “ it’s what it is. We are a franchise and head office send us that one “. Shrugged his shoulders and walked off. No offer to change or refund.

site_logo

lloydk121 . 2018-11-09

MORE AT TripAdvisor

first impressions exceptionally clean love the decor and smart friendly staff. However 5 staff were working and only one girl behind the till doing 90% of the work had to que and que and que if i wasn't with a friend i would have just left. My waffle with choc and peanut sauce with banana and ice cream was great although the waffle mix was quite light. the selection of ice-cream we chose was good . But the cappuccinos we had and had remade were not hot at all even second time round. Not sure i would return here.

site_logo

Shoey001 . 2018-09-30

MORE AT TripAdvisor

Aweful service and took forever. They forgot one of our orders and we waited 40 minutes before we got everything. They didnt even apologise..

site_logo

Martin S . 2018-09-29

MORE AT TripAdvisor

Love 💕 this place. Best ice creams and waffle with chocolate and strawberries and cream. Coke floats with vanilla ice cream. Polite and helpful staff

site_logo

733himanshud . 2018-08-23

MORE AT TripAdvisor

The food was as usual great, we come every year. We ordered a big sundae with no banana, it came with banana which they then picked out. Unfortunately my eldest son is autistic and as such is very sensory driven, because of the remains king smell of banana I asked for them to make a new one from scratch which they did without question which I was really impressed with. What I was not impressed with was what happened to my youngest son who is 3. He was looking through the counter at all the ice cream when his hand went through the gap underneath. I’m not sure exactly what is under there but it’s VERY hot. Maybe a light or something? My son cried and cried, we asked for ice which we got after a few minutes. He has been left with blisters along 3 of his little fingers. The member of staff we spoke to apologised and said it had never happened before, however this happened very easily so I am surprised. I suggested she complete a risk assessment and she looked at me as though I were mad. There was no question of compensation despite my hysterical child and obvious injury. I suspect nothing will change so watch your little ones!

site_logo

bonnie344 . 2018-08-03

MORE AT TripAdvisor

What a fabulous gelato parlour. We walked 20 mins to here following huge disappointment at lollipop. Sprinkles has a great choice of gelato and sweet/dessert combinations at reasonable prices. Good service in a friendly environment. Would highly recommend.

site_logo

Honeyblossombg . 2018-07-30

MORE AT TripAdvisor

I thought it was just me, but reading through the reviews here it appears the shop in Bournemouth has a big problem with the staff.

site_logo

Adi C . 2018-07-28

MORE AT TripAdvisor

My son and his friend had their food at your restaurant and I brought mine home

site_logo

tishtash1717 . 2018-07-27

MORE AT TripAdvisor

Went today with my family .. wasn’t very busy when we went in.. 3 members of staff on ..

site_logo

Birdy-putt . 2018-07-24

MORE AT TripAdvisor

It was a heatwave the afternoon I was here so it was packed busy and the staff were doing the best they could. I found the one supervisor on duty actually doing most of the work and having to baby step the other employees as to how to do their job because they were inefficient. I could see the frustration on this poor guy's face, having to teach all these staff how to do their job under pressure while being the only guy who knows what he's doing. So service was terribly slow but it's actually management's fault for being useless at training up their staff properly and relying on one guy to do the work of 5!

site_logo

BarbieMegaTraveller . 2018-06-29

MORE AT TripAdvisor

Insieme a mio marito e la nostra piccola cagnolina siamo entrati in questa gelateria per prendere un gelato. Sono rimasta in piedi all'ingresso cercando di guardare i gusti da scegliere e il commesso mi ha detto che dovevo uscire perche'la cagnolina non era ben accetta. Abbiamo preso due coni (io cercando di leggere i gusti fuori dalla porta). Il gelato e'di qualità scadente, mio marito ha preso il gusto limone che era evidentemente mal conservato o mal lavorato e si e' letteralmente sbriciolato per terra. Visto che non ci era permesso di sedere dentro, ci siamo dovuti "accomodare" fuori al sole col gelato che si scioglieva disastrosamente e nello sporco più' totale. ...mai più! Non accettano i cani e poi i tavolini sono peggio di un porcile!

site_logo

laura m . 2018-06-21

MORE AT TripAdvisor

Lovely place to go for a ice cream treat with the family. Loads of ice cream choices, and choices of pancakes, waffles.

site_logo

MarionB158 . 2018-06-18

MORE AT TripAdvisor

The counter staff there are very unhelpful and they don't always understand what the customers ask for. I was not all that impressed with their service especially with my children and the tables seemed to be quite dirty with the sticky surfaces. The food there are not of a very good quality and it is very overpriced!!

site_logo

colinandbeccy . 2018-06-18

MORE AT TripAdvisor

Love Gelato! Went for 3 scoops (Oreo mint, caramel and kinder bueno) Great flavours and staff were very friendly!

site_logo

alicegI5820QX . 2018-06-18

MORE AT TripAdvisor

Kids ate all their dinner so promised them a treat. Simple to order. Food came to the table within 10 minutes. So many calories. But what the hell. You only live once. Hot cookie dough with ice cream. They both struggled to eat it. We had to finish it off.

site_logo

adsys . 2018-06-01

MORE AT TripAdvisor

Great portion sizes and flavour however they don’t do gluten free waffles or crepes which forced my girlfriend to have ice cream, luckily she’s quite happy with that but was excited for some waffles or crepe.

site_logo

kenanramsay . 2018-05-19

MORE AT TripAdvisor

I am semi retired so plenty of time to chill especially at places like Sprinkles.on average I spend 3-5 hours here starting with a coffee then moves onto either waffles or pancakes. Nice to see some kids running around or couples sharing an ice cream.

site_logo

babybellflower . 2018-05-09

MORE AT TripAdvisor

Visited yesterday( 21/03/18 )... seems very quiet. Ladies working there thy dont act like hospitality people not even smile. When I said its my first time here , so could You tell me, do I have to pay now or later- that lady staff with red lips she looked at me like she wants to made me feel dumb and rudely answered: Here! Why?! ...

site_logo

MissConservative . 2018-03-22

MORE AT TripAdvisor

Gelato buono e porzioni abbondanti, molto consigliato! A una ventina di minuti a piedi dal centro, non solo gelati ma anche waffles e milkshake

site_logo

lucrezia12345 . 2018-03-12

MORE AT TripAdvisor

Never been before never to return either. Decor awful. Service extremely slow despite it being with a smile. Crepe was awful so sweet we barely touched it. Felt sick all afternoon. Probably left with diabetes.

site_logo

The_Faithfuls . 2018-02-25

MORE AT TripAdvisor

Took 15 minutes to order as they let teens stand at the counter messing about and deciding forever. Then it’s a long, long, long wait for pretty basic ingedients to be put in a bowl. Staff were quite friendly though. Never, ever again...

site_logo

Thatsawkward . 2018-02-25

MORE AT TripAdvisor

Came here a few weeks ago and have been here several times before. Always been happy with the quality of food but the waiting time for the food - even just a milkshake, can be a bit too long.

site_logo

Emily M . 2018-02-22

MORE AT TripAdvisor

Waffles, crepes, sundaes and hot cookie dough with lots of ice cream and sauce. Good range in the menu with hot and cold drinks. The down side are the staff who all look under 18 and are literally covered in ice cream and sauce and the toilet was dirty.

site_logo

D6270FBlisam . 2017-12-02

MORE AT TripAdvisor

If you're of older age, Dont come here. By the time you've got your order you'll probably be dead! Very slow service and not worth the wait for the hassle of parking nearby.

site_logo

Adam W . 2017-11-17

MORE AT TripAdvisor

Me and my friends visited this place about 9am and we were the only customers and ordered coffees and waffles.No whipped cream as they runned out...We were informed that it will take 10min....coffee was served us after 15min and waffles after 40 minutes.It wasn't tasty at all...

site_logo

Alena D . 2017-11-01

MORE AT TripAdvisor

There is a fantastic range of desserts on offers here. We tried several different types (including the waffles, crepes, dessert jars and sundaes) and really enjoyed all of them. There is a large selection of mouth-watering flavours for each dessert or ice cream and service was quick and friendly.

site_logo

katy1234wt . 2017-10-17

MORE AT TripAdvisor

Been here a couple of times before and was great. although im not a fan of the decor (bit tacky and trashy) . This Time a round it was i guess 'off season' as its october. the order came fast and the staff pleasant.

site_logo

ghhhjd . 2017-10-13

MORE AT TripAdvisor

We had decided to visit and arrived at noon on Sunday. There were a few customers in sat eating. We tried to find a table but noticed 4 in a row with dirty uncleared food/plates and glasses on. We then checked the whole resterant to find that 80 percent of "empty" tables were uncleared. 4 members of staff were behind the counter not busy and no que of customers. Staff were just chatting and ignoring the place. We voted with our feet and left and went to Winton.

site_logo

sarahcR118CE . 2017-10-01

MORE AT TripAdvisor

Vi consiglio pienamente di prendere il waffle con Nutella, panna e gelato alla vaniglia come questo in foto, la porzione è molto abbondante ed è perfetto per dividerlo in due (Non c'è nel menù ma basta richiederlo alla cassa), il costo è di 6£!

site_logo

891margheritaf . 2017-09-19

MORE AT TripAdvisor

Went to Sprinkles for dessert in a Saturday night & it was extremely quiet! I ordered a Nutella, banana & Oreo waffle with ice cream. It was amazing! Really delicious! It would be great if the menu had pictures rather than drawings. Even though it was quiet, a number of the tables had rubbish on them - it's surprising the staff didn't clean this up. Can't wait for my next visit!

site_logo

SallyMac789 . 2017-09-09

MORE AT TripAdvisor

I've really craved some nice gelato and I wasn't disappointed! Too much to choose from and massive portions!

site_logo

AkerF . 2017-09-07

MORE AT TripAdvisor

Będąc na wakacjach weszliśmy na lody, duże przestronne wnętrze , bardzo miła obsługa. Desery lodowe które zamówiliśmy to coś niesamowitego - takich jeszcze nie jedliśmy pychota. Polecam, każdy powinien je spróbować

site_logo

Salmania . 2017-09-05

MORE AT TripAdvisor

Es un bar para merendar exquisito, en españa no hay ninguno igual. Todo está riquisimo y son hipergrandes. Recomendable si quieres degustar crepes o grofes únicos y dar envidias a tus amigos jajaj.

site_logo

happyflowers93 . 2017-09-03

MORE AT TripAdvisor

Popped in late evening for a little treat. Our server was polite and efficient. We opted for tubs with two scoops. Huge portions. Not the best tasting but palatable. Reasonable prices.

site_logo

PJT91065 . 2017-08-31

MORE AT TripAdvisor

Am fond of Gelato in Manchester thought we try this out the place was ok got hot chocolate drink and it was boiling hot I mean really boiling that I burnt my mouth I waited to cool down for 10 min still it was boiling I finally left it and the girls got pancake which had no cream only ice cream they said they ran out of cream a place popular like this how come they had no fresh cream left and after all this my little one got tummy ache after eating pancakes!! my daughter was going on about this place for days and after this experience she doesn't want to go there again

site_logo

Holiday276 . 2017-08-29

MORE AT TripAdvisor

Un posto veramente sporco, lurido. Non ci berrei nemmeno un bicchiere d'acqua se stessi morendo di sete.Entrato ed uscito dal locale.

site_logo

Che te lo dico a . 2017-08-12

MORE AT TripAdvisor

Waited too long for order, asked staff for extra knife and fork which was met with a blank expression. Then she went away and never came back. Wife had to go herself and ask another member of staff. Can't fault food and there are lots of different tasty combinations. Great place with lots of potential.

site_logo

Neil W . 2017-08-06

MORE AT TripAdvisor

Great treat, managed to find a parking space reasonably quick service, polite staff and I really enjoyed my waffle.

site_logo

BoscBred . 2017-07-23

MORE AT TripAdvisor

Birthday treat was spoiled by slow service and staff getting our orders wrong!

site_logo

teddiejones . 2017-07-21

MORE AT TripAdvisor

Had a very nice ice cream cone and sundae, very generous portions and the gelato tasted great! Well worth the walk in to town, would go again

site_logo

PJ941 . 2017-07-18

MORE AT TripAdvisor

We live in London and visit friends in Bournemouth. When ever we go this place is a must to visit. We generally go for the waffles and they are huge (not great if your counting the calories dread to think how much they contain). Great for a treat and can't wait till our next visit.

site_logo

RayFamily1 . 2017-07-13

MORE AT TripAdvisor

Definitely would return ! Absolutely amazing was so hard to chose what to eat, such a good choice! ..

site_logo

fayeellis2016 . 2017-07-11

MORE AT TripAdvisor

Have been here a few times. Ranges from amazing friendly and helpful staff to those who are just rude.

site_logo

em942017 . 2017-07-10

MORE AT TripAdvisor

Even so we visited 10 minutes prior to them closing for the night we did not think it was acceptable to refuse to sell anything but ice cream and ignore us for ages ? We know you need to get on with your close but customers should always come first and the fact that we were greeted with mean looks was unacceptable.

site_logo

158paulinam . 2017-07-02

MORE AT TripAdvisor

Have given this place a 3 out of 5 for the food. This was pretty average but a nice choice and concept. What let's this place down is the staff. We went there one morning, went to the counter to order and both staff just ignored me and carried on with other jobs. Two other people standing there decided to go elsewhere. In the end had to ask if anyone was interested in taking order and they both just looked at each other.

site_logo

peterfV1269AQ . 2017-06-19

MORE AT TripAdvisor

Lovely place for a sweet lunch or an afternoon pleasure. There was a huge variety of ice creams' flavours and lots of different pancakes and créps! I'm really impressed with this place!

site_logo

agnieszkak320 . 2017-06-11

MORE AT TripAdvisor

I am sure for the majority this is a great place to eat but this post is just to raise awareness for allergy sufferers. If you or any member of your family / party have an allergy please be ultra cautious as the health procedures to prevent contamination are not always adhered to. In spite of stating my daughter suffered from a nut allergy, nuts somehow contaminated her ice cream.

site_logo

EFGnH . 2017-06-02

MORE AT TripAdvisor

Ive been here multiple times and its been great food every time!!

site_logo

Beth D . 2017-05-30

MORE AT TripAdvisor

I often visit this place if i am in the vicinity. the food is good they could be more generous with the toppings and the service could improve

site_logo

janehamilton1886 . 2017-05-17

MORE AT TripAdvisor

Went at 7.30am on Sunday and had the place to ourselves! Yummy strawberry crepe and coffee. Would definitely go again, especially when not filled with hordes of people as it usually is.

site_logo

Emma M . 2017-05-17

MORE AT TripAdvisor

I could not believe the flavours and varieties on offer..you have to see them. Obviously a good business idea from somebody as they are not cheap but still popular!

site_logo

SpudSpuddy . 2017-05-04

MORE AT TripAdvisor

Lovely food! Lots and lots of varieties! Always clean restaurant, helpful friendly staff! Wish I had a sprinkles closer to home!! 😀

site_logo

chelsie101 . 2017-04-26

MORE AT TripAdvisor

Similary restaurants in South West

restaurant_img
3.1

95 Opinions

location-icon6 W Cliff Rd, Bournemouth, BH2 5EY, United Kingdom
outdoor_seating_344614takeaway_344614delivery_344614

Best fish and chips I've ever had.

restaurant_img
3.1

181 Opinions

location-icon532 Wimborne Rd
Pizza & Pasta
outdoor_seating_93737takeaway_93737delivery_93737

Normally cooked well from this branch but ordered yesterday and got here in about 10 minutes o wo der it was so cast not cooked enough sloppy and horrible a total waste of 22 pounds not happy at all

restaurant_img
3.0

4956 Opinions

location-icon460 Wimborne Rd
American
outdoor_seating_93474takeaway_93474delivery_93474

El servicio era excelente y lo que se necesitaba después de un largo día en el trabajo. Gracias a Suada en KFC en el triángulo de Bournemouth. Recomendaré el servicio al cliente en este KFC.

restaurant_img
3.1

355 Opinions

location-iconOld Christchurch Road
British
outdoor_seating_91972takeaway_91972delivery_91972

The pizza was amazing chips & cheese tasty fast delivery

restaurant_img
3.0

235 Opinions

location-iconOceanarium
British
outdoor_seating_93265takeaway_93265delivery_93265

Me acerqué y pregunté si eran perros amistosos en el interior, ya que teníamos nuestros dos daschunds en miniatura. Nos dijeron que sí, así que decidimos comer aquí. Pedí nuestra comida y recibí mis panini de inmediato. Casi había terminado cuando compraron nuestras otras comidas. A medida que se dejaba la comida, se anunció que no se permitía el ingreso de perros. Como pueden imaginar, estábamos muy molestos, como había pedido específicamente. Encontramos una mesa afuera, ya que me sentía incómodo con la forma en que se había tratado la situación. La camarera volvió para disculparse y decir que podíamos quedarnos, pero en este punto, habíamos trasladado todas nuestras cosas fuera. Mi marido le dio un corto golpe fuerte, ya que estaba muy molesto. Terminamos recibiendo el reembolso de la comida y nos fuimos ya que la situación había dejado un sabor amargo! Creo que están en proceso de convertirse en amigables con los perros, y así es como surgió la confusión. Desafortunadamente, estábamos en el extremo receptor de la mano izquierda, sin saber lo que la mano derecha está haciendo.