GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.1

Based on 1.424 opinions finded in 5 websites

site_photo4

Nº 627 in 1383 in Leicester

Nº 59 of 137 Indian in Leicester

CUSTOMERS TALK ABOUT DISHES WITH..tandooriprawnsmustcurryricechillichickenprawngarlicfishspicycookedpaymeatlambsalmon

comment_iconOpinions

Absolutely brilliant experience last night. Fantastic atmosphere and service and the good was really so so tasty!! Sorry to hear the restaurant is closing. Get there to experience it while you can!!

site_logo

Maisie Lee . 2025-01-19

MORE AT Google

No puedo comentar sobre la comida porque nunca llegó. Después de una hora y media de espera, nos rendimos, pagamos nuestras bebidas y nos fuimos. No estábamos solos, otros comensales estaban igualmente furiosos por los retrasos. La falta de comunicación del personal era poco profesional, pero lo que realmente era exasperante era que el restaurante priorizaba los pedidos de Deliveroo y JustEat sobre sus clientes internos. En una ciudad como Leicester, con tantas fantásticas opciones gastronómicas, este lugar no merece su tiempo o dinero. Evítalo a toda costa.

site_logo

Islandhippy . 2025-01-12

MORE AT TripAdvisor

Booked for Dinner before the Rugby. After an hour and a half all we had eaten was some very average poppadoms. (The pickle tray was well below par) Having ordered our mains we waited for 45 minutes and told the waiter that we had to go to the game soon. We were promised 10 minutes.....this came and went, so we paid for our drinks and left. Lots of other customers were in the same position. Looks like they had booked in too many tables. We left very unhappy and hungry.

site_logo

Joseph Davis . 2025-01-12

MORE AT Google

when we made the order it said the order would be with us by 19;50, the delivery estimation kept getting later and later and it finally arrived at 20:45, then a set of poppadoms were missing and we had to reheat the mains as weren't even lukewarm. If we had know how delayed it would be, we wouldn't have ordered, but by the time the estimated delivery jumped from 20:25 - 20:50, we were too hungry to start a new order elsewhere. Very unhappy

site_logo

clare . 2024-12-21

MORE AT Just Eat

Nice enough place, decent enough food and a friendly welcome and service

site_logo

Steve Gee . 2024-11-30

MORE AT Google

Después de haber comido aquí cada vez que vamos a un concierto nos quedamos muy decepcionados esta vez. Éramos las únicas personas en el restaurante aunque era temprano. La comida era sosa y no estaba a la altura del estándar habitual. El local parecía cansado y hacía bastante frío. Los baños estaban húmedos y olían a humedad. Por lo general, la comida es genial junto con el personal, pero parece haber perdido su chispa.

site_logo

Christine P . 2024-11-20

MORE AT TripAdvisor

All the dishes we ordered had bit of sweetness in it despite showing medium level of spice. Not meant for people who like spices. Other than that it's fine if you like sweet texture in your curry.

site_logo

Puja Mohindra . 2024-11-02

MORE AT Google

I made an order on Uber eats. The butter chicken was average and the chicken was a bit tough. The issue is the egg fried rice, it was £5 which is already quite steep but ok that’s fine, when it arrived it was a small portion! The smallest portion of rice I’ve ever received from a takeaway for £5!

site_logo

Denise Wrench . 2024-10-31

MORE AT Google

Comida promedio y un servicio increíblemente lento y pobre. Bonitos servidores, pero la dirección tiene las cosas seriamente mal. Menús dejados en la mesa, ya que no puedes pedir platos principales hasta que te hayas comido los entrantes. Diferentes personas a las que pedir cosas diferentes, nadie parecía saber lo que estaba sucediendo. Tomó 2. 5 horas para una comida. Incluso todavía tienen todos los signos Covid y cosas del código QR en todas partes para recordarte ese período de diversión. No voy a volver.

site_logo

JG . 2024-10-13

MORE AT TripAdvisor

Cannot fault the flavour (Haryali chicken, extraordinarily good) andwould have given 5 stars if the food had been hotter, it was warm at best. Shame, but I would order from them again.

site_logo

Shaun . 2024-10-07

MORE AT Just Eat

Chilled place. Nice food, would recommend

site_logo

Erica . 2024-09-29

MORE AT Google

Comemos aquí con bastante regularidad en los últimos 10 años, y hemos llegado a esperar comida excepcional, desafortunadamente basado en la visita de anoche... ha ido cuesta abajo. El plato vegetariano y nuestros currys eran claramente promedio... el saag aloo era un punto alto, pero esto estaba claramente hecho con puré de espinacas congeladas. Los entrantes estaban menos sabrosos y menos en cuanto a variedad de lo habitual y las setas quemadas. Qué pena. ¿Ha cambiado de manos el restaurante?

site_logo

Julia H . 2024-09-14

MORE AT TripAdvisor

Tuvimos una noche fantástica con buena comida y servicio. La comida era deliciosa con un montón de opciones para todos y me encanta poder ver en la cocina mientras preparan nuestra comida. Éramos una gran fiesta de 16 (mesas divididas entre adultos y muchachos! ) pero no - nadie tuvo que esperar por su comida y nuestro servicio de la noche fue sin problemas. Esta fue nuestra primera visita a Shimla Pinks, pero sin duda no será la última, ya que definitivamente volveremos cuando estemos de vuelta en Leicester!

site_logo

RWC03 . 2024-09-09

MORE AT TripAdvisor

La comida estaba bien este era el mejor lugar como hace 8 - 9 años, la calidad de la comida era épica. Esta vez todo el servicio recibiendo la factura fue extremadamente lento y el lugar no estaba ocupado y luego cuando llegó la factura pusieron cargo de servicio, me negué a pagar esto al camarero que luego trajo al gerente y eliminó el cargo de servicio y se fue realmente mardy ningún profesionalismo en absoluto cuando dijimos adiós no había sonrisa u hospitalidad. En los días anteriores el personal y la comida era mejor no volveremos de nuevo después de esta experiencia.

site_logo

chiggu . 2024-08-31

MORE AT TripAdvisor

The whole lunch experience was not as expected because the food was good but the service was indeed slow and delayed. The ambiance also lacks a certain warmth and the staff is not very friendly while taking orders. The main course was alright hence overall a very average experience.

site_logo

Dannysi78 . 2024-07-28

MORE AT TripAdvisor

So we are regulars at Shimla for take aways.. simply not happy with having a service charge to sit and have a meal , so the last twice before today the food hasn’t been great , so tonight went for a takeaway again and gave the benefit of the doubt , food tasteless and a little acidic , we ordered a karahi lamb which is hot absolutely no spice or flavours … unfortunately this is where we part .. no more Shimla no clue what has happened but it’s not like it was. An awful lot of people saying the same thing , maybe changed hands

site_logo

Michelle shortland . 2024-07-10

MORE AT Google

I liked this place, it's clean and calm, delicious food

site_logo

Leo Cook . 2024-07-08

MORE AT Google

Haven't visited for a few years until today, certainly not lost it's quality. Lamb Masala absolutely beautiful and attentive service with a smile. We don't know what the interesting smell is in the downstairs loo area but thankfully it's well out of the way of eating area. Interior in need of a revamp in general, safe to say it's authentic..

site_logo

Peter White . 2024-06-30

MORE AT Google

It was a shame this lovely restaurant with great staff was so quiet on a Sunday night. But we didn't let it put us off and had a great meal. I really enjoyed the paneer tikka, my husband had the keema peas and our friend had a great king prawn curry. Will definitely visit again.

site_logo

Claire M . 2024-06-12

MORE AT TripAdvisor

wonderful as always.i just can't get enough of your prawn Puri!!!!

site_logo

wayne . 2024-06-05

MORE AT Just Eat

I've eaten in the restaurant before so thought we would try delivery.... all the food was excellent, tasty, hot, well prepared and securely packaged. The delivery driver was very happy and friendly too. The only issue was with the nan bread, which was very undercooked, but a refund is on its way already. Thank you

site_logo

Gillian . 2024-05-24

MORE AT Just Eat

Excellent Indian restaurant near to the station. Good ambience. Staff excellent. Fantastic food. Always worth a visit when in Leicester. Visited again last Saturday - really good as always!

site_logo

Keith Stevens . 2024-05-20

MORE AT Google

stunning food one of the best in the UK hands down!!! amazing prawn Puri and lamb chops.i have saved as my go to restaurant in Leicester A +++++++

site_logo

wayne . 2024-05-09

MORE AT Just Eat

My order has not been delivered!!! Terrible service!!! waiting over 2 hours!!

site_logo

Anna . 2024-05-04

MORE AT Just Eat

Amazing food, fantastic service and an over-all lovely experience. We had the Lamb Chettinad and Fish Tawa, beautifully cooked and good portion sizes. Very good value too. The staff couldn't have been more efficient, Paviter in particular was friendly, helpful and very attentive. Lovely shots of Baileys at the end!

site_logo

Amanda H . 2024-04-27

MORE AT TripAdvisor

Portions size spot on and food is delicious.

site_logo

Shane Endall . 2024-04-06

MORE AT Google

We had an early doors meal before seeing a gig at the O2. Service was brilliant and it’s one of the best Indian meals we have had in years. Recommend highly the Chicken Biryani and the Chicken Tikka which comes as a dry dish on a sizzler plate with salad, rice and sauce on the side. The Biryani is so aromatic, and best of all, it contains no sultanas! Our waiter DJ was the best. I would highly recommend this place and definitely have it on my list of places to return.

site_logo

Mydoghasnonose . 2024-03-30

MORE AT TripAdvisor

Last Saturday we came for dinner about 7.30pm Food was stunning, really good portions! Even though it was very busy We had exceptional service from our waiter DJ too who was so lovely!

site_logo

Stacey Phillips . 2024-03-06

MORE AT Google

This is the not the same popular Shimla pinks that we used to dine for the last 10 years. New chef’s, new staff and new taste. The food is average.

site_logo

Chanel Stevenson . 2024-03-03

MORE AT Google

Great food service was brilliant

site_logo

minesh patel . 2024-02-27

MORE AT Google

Central had car wash town central

site_logo

Jay Jay . 2024-02-11

MORE AT Google

always a lovely meal and nice to share with a friend over a chat

site_logo

Jason . 2024-02-06

MORE AT Just Eat

Excellent food. Good amount of poppadoms. Appropriate amount of spice. Good variety.

site_logo

The . 2024-01-20

MORE AT Just Eat

always a good meal for take away or eat in. would recommend

site_logo

Jason . 2024-01-19

MORE AT Just Eat

Our meal here was one of the highlights of our short visit to Leicester just before New Year. We had Goan Fish Curry, Chicken Tikka Masala and Lamb Chettinad, with pilau rice, naan and rotis. All excellent, especially the lamb, which was succulent, and the sauce was beautifully spiced. There was a nice atmosphere in the restaurant and the service was excellent throughout.

site_logo

Kenny A . 2024-01-14

MORE AT TripAdvisor

The starter was lovely but the mains were sadly to no ones taste. No one could finish their meal and we sadly did not rate this restaurant compared to others around. We also found it very expensive for the service and quality of food. Also, be mindful they automatically add 10% tip to the bill, which I didn't particularly like 🤔 Plus side though.. You did get a lot of food. Overall, we will not be returning or recommending this place.

site_logo

Natalie Watkins . 2024-01-13

MORE AT Google

Came to this restaurant with my family last Saturday on the 6th of January in the evening when we stopped over in Leicester. Have to say we had a great dining experience. The food was excellent, we ordered karahi chicken and tawa paneer. Both dishes had a very nice flavour and tasted great and had a spicy kick to it which was very good. Only negative was that the service could have been a bit better especially as the place was busy. But overall I think this place was very good, great ambience and its definitely worth coming to again 100% for sure.

site_logo

Viren V . 2024-01-10

MORE AT TripAdvisor

always a lovely meal and value for money

site_logo

Jason . 2024-01-09

MORE AT Just Eat

I cannot recommend Shimla Pinks the food was terrible!!!

site_logo

Judith . 2023-12-22

MORE AT Just Eat

I have eaten at Shimla pinks many times and ordered many a takeaway so I was very surprised at the quality and taste of the food that I ordered tonight, in my opinion only the rice and naan bread was edible the rest of the meal has been thrown away, I will never eat in or order a takeaway again, it’s a shame because Shimla Pinks used to be lovely.

site_logo

Judith Cherry . 2023-12-21

MORE AT Google

Great hospitality, good food and ambience

site_logo

Aditi Dewra . 2023-12-16

MORE AT Google

2nd time iv been here, amazing food and service - highly recommend

site_logo

Richard Coley . 2023-12-05

MORE AT Google

Always a good meal. Would recommend

site_logo

Jason . 2023-11-21

MORE AT Just Eat

A wonderful meal as always. Recommed the restaurant for eat in or take away. Always friendly and professional

site_logo

Jason . 2023-11-02

MORE AT Just Eat

Great food, and really good service too. No delays.

site_logo

Graham Blackwell . 2023-10-20

MORE AT Google

Visited my daughter and son in law this weekend and jumped off the train to a very rainy Leicester so just literally walked in off the street at tea time so it was obviously quiet but the restaurant was beautiful and the service was brilliant but even if it hadn't been the food would have been enough to bring us back again. The chicken shashlik was divine 😋 and the masala chips were amazing as was everything else. See you next time we visit Leicester 👍👌👌👌👍

site_logo

Denise Hepton . 2023-10-16

MORE AT Google

3 of us went here after it being recommended by our Leicester based staff. Its always a bit of a worry when you're the only customers, which we put down to it being a rainy Wednesday, but we had absolutely no need to be worried. The food and service were both fantastic. Had starters which were almost a meal on their own. Lovely Tikka Masala with pilau rice, really tasty, not too spicy but just enough. Perfect portion size, nice fresh nann bread. The staff were very attentive and provided exceptional service. We'll definitely visit again next time we're working in Leicester, hopefully very soon.

site_logo

Neil Capper . 2023-09-21

MORE AT Google

Came here mid week, early after stepping off a train- a little intimidating at first with the size, but impressive service. Had popadoms to start, very nice and fresh, bit stingy with the pickle tray- then had the Kheema peas peshwari main dish. Superb! One of the best I’ve ever had. It’s hot- I like it that way. A generous portion, with no oily residue at all. Lovely!

site_logo

Anthony Sullivan . 2023-09-19

MORE AT Google

Really enjoyed this Leicester restaurant. Good food and beer too.

site_logo

Martin Lewis . 2023-09-16

MORE AT Google

Delivery time was very quick. Normally my favourite restaurant, however this time, the taste of the tarka dhaal was nowhere near as nice as it usually is from this restaurant. The spice balance tasted different to normal and the colour was a lot darker than it usually is. I usually order from Shimla Pinks specifically because I like their tarka dhaal, I would normally say it is the best there is, so I hope this is a one off as this is my favourite dish and favourite restaurant to order it from, but I would not like to order it again if they have changed their recipe

site_logo

Francesca . 2023-09-12

MORE AT Just Eat

Very quiet for a Friday night. It was quite early, but that said,almost empty. Group of six, meet up and quick bite to eat before the rugby. Table service a little laboured, but food came out fairly quickly. Very tasty. 2 beers each,poppadoms and pickles, main and a rice, shared nan....£32 each! Service charge already added to bill! Felt it was a touch expensive for what we had.

site_logo

LEE JOHNSON . 2023-09-02

MORE AT Google

Ordered a delivery using Uber eats. Nice food but the portion sizes are really small for the prices they’re charging. £4.50 for chips and i got about 20 small cut fries. £5.50 for chilli paneer and there was 8 small pieces. Food was nice though

site_logo

Gaz Smith . 2023-08-29

MORE AT Google

Very friendly staff and service is impeccable, food was amazing

site_logo

veronica . 2023-07-29

MORE AT Google

Great place food and service was excellent gave a 4 atmosphere as they had just opened and only 8 people in there .. top food will defo be returning

site_logo

Adam Leicester . 2023-07-26

MORE AT Google

Food fantastic, but the service terrible, nearly knock drinks over twice and had to wait for our naan bread a long time, main nearly finished by time it came out.

site_logo

David Munro . 2023-07-16

MORE AT Google

Amazing food and really good service. Will definitely be back thanks for a great evening

site_logo

Tammy Gill . 2023-07-04

MORE AT Google

Food was more than ok and the service was good.

site_logo

Vikas Karan . 2023-07-01

MORE AT Google

Our first visit to shimla pinks indian restaurant was a lovely experience from going in to coming out..the service was excellent by the whole team from table/ bar service to kitchen staff..the meal was delicious meats were lovely and tender shall definately be going there again well done to the whole team..look forward to seeing you again soon...

site_logo

Diane Cooper . 2023-06-23

MORE AT Google

Food was ok. Starters were bland but mains were better. We told the waiter DJ about the starters and he offered us complimentary drinks at the end to make up for it. This was a nice touch.

site_logo

Jay Chauhan . 2023-06-17

MORE AT Google

Awful service, ordered a butter chicken and the chicken was rancid. The guy didn’t even said sorry and was super rude. Really expensive

site_logo

Aarushi Kumar . 2023-06-07

MORE AT Google

Expensive for what is at best is a very average dining experience. Until yesterday, I hadn't been to Shimla Pinks for over 5 years and was disappointed at the quality of the food. Mushroom rice was made with what looked and tasted like dried mushrooms that hadn't been allowed to rehydrate. The main dishes had the onions, peppers etc added late in the preparation making them under cooked. Breads were good, poppadoms were good. Bill arrived and found a 10% service charge added - in all fairness the waiting staff were very good but it should be my choice to add a service charge not ask for it to be deducted. In the past, you never went to Shimla Pinks expecting a bargain but the dining experience sort of justified the cost. Sadly after this recent experience the standard of the food just didn't match the charges.

site_logo

Richard S . 2023-05-28

MORE AT Google

It's always nice to have a meal here. The food is lovely and the people who work here are very nice. The roti bread is sensational 🙂 Definitely worth a visit.

site_logo

Silje Haarr . 2023-05-19

MORE AT Google

Shimla Pinks never disappoints. Great food and service in a relaxed atmosphere. There's no need to go anywhere else in Leicester.

site_logo

Trev Tyers . 2023-05-19

MORE AT Google

They sat us down at the entrance for a while which was rude, there were so many tables available. Luckily a more experienced member of staff seemed to tell him off and sat us down straight away when he saw. Food was OK but for the price it should be better. Naans and tandoori shrimp were very good, Curry and chicken tikka was bang average. Also tried not to apply the £15 reduced offer on our bill despite booking with the code which was a bit cheeky. 10% service charge automatically applied is fine, but not when service is poor. Not a bad visit but probably wouldn't go back.

site_logo

Clayton Helsby . 2023-05-18

MORE AT Google

Wouldn't even give it a 1 star. We dined over the weekend and it was the worst experience ever. Food was slow, poor taste and quality. I ordered Chicken butter masala and it had no flavour. Rude and unhelpful staff. Wouldn't come back here ever again. Interior is old too and not even a nice atmosphere

site_logo

Anjeli Ford . 2023-05-15

MORE AT Google

Staff were not friendly ,no good service ,food were with the same taste n same gravy which is not possible as we had ordered goan curry....

site_logo

Dickson Furtado . 2023-04-30

MORE AT Google

If your passion is Indian food Shimla will cater for all your needs. Chose the Exec banquet for 4, swapped a couple of dishes out due to allergies. This was an absolutely fantastic meal.

site_logo

Kevin Whitcombe . 2023-04-30

MORE AT Google

Food was not great 😕 got tummy problems tonight .

site_logo

sofia . 2023-04-26

MORE AT Just Eat

Old tipe place need a new look Waiting time to long Bad experience over all

site_logo

Vlad Ionuț Banuta . 2023-04-20

MORE AT Google

delicious food as always, nice touch with the cookie to say thank you

site_logo

Manika . 2023-04-19

MORE AT Just Eat

First class food and service as always. The Tawa is one of the best I have ever tasted. All of our party were very impressed with the standard of food and service. We will all certainly be back again, well done 😋👏👏

site_logo

David Stamp . 2023-04-18

MORE AT Google

Rubbish restaurant and rubbish rude customer service. Wrost food quality... 👎 Restaurant don't know what is the taste of Indian food... 👎👎👎Totally waste of money... 😡😡😡

site_logo

Nihar Gandhi (Nick) . 2023-04-08

MORE AT Google

Excellent value for the quality

site_logo

Steve . 2023-04-04

MORE AT Just Eat

Substandard food. Horrible chicken tikka, below average lamb chops. King Prawns we’re really nice though. Overall, not recommended for those with an Indian palate.

site_logo

R . 2023-04-02

MORE AT Google

Absolutely beautiful meal, staff were amazing. My dad really enjoyed it too.

site_logo

Elise Evans . 2023-03-28

MORE AT Google

Tasty food with great portion sizes but try to avoid going at a busy time - it can be very difficult to get the attention of staff as they're rushed off their feet. They were very polite, though, so it never felt uncomfortable.

site_logo

Tom Brown . 2023-03-19

MORE AT Google

Service is very poor. Pushy staff. Food is below average

site_logo

filmy fakeers . 2023-03-17

MORE AT Google

first time since lockdown all good

site_logo

the cat . 2023-03-05

MORE AT Google

Great place to take visitors from out of town

site_logo

Divyesh Shah . 2023-02-26

MORE AT Google

First time eating here Friday evening we have been eating Indian food all over the uk and beyond for 35 years and this was sadly one of the worst meals we have ever had. There were 4 of us and we ordered many dishes to share but all were tasteless and bland, the naan breads were the only part of the order worth eating. The staff were efficient but not very friendly and none of them came to ask if we were happy with our food of which most was left un eaten. I have never written a review before good or bad but this was so tasteless and the garlic chilli chicken had lots of very under cooked almost raw garlic in it that it was un edible. If it had been that just one of the dishes lacked flavour it would have been put down to an oversight but you cannot say that for so many different dishes. Indian food should be full of taste but this was the opposite and an expensive waste of money.

site_logo

kevin cornish . 2023-02-04

MORE AT Google

Heard there is a black belt man who is really fit! Can we make this happen?

site_logo

Sara Coelho . 2023-01-28

MORE AT Google

Took my cuzzies from NZ there as they had been on a previous trip and loved it so did we couldnt fault the service or food we will be back👍🏻👍🏻👍🏻👍🏻

site_logo

pirategaza . 2023-01-06

MORE AT Google

Excellent Christmas Day meal, no turkey or sprouts. Really delicious food, exception service! Thank you Shimla Pinks

site_logo

Liz Knight . 2022-12-25

MORE AT Google

Great restaraunt food was great one of the best ive had, staff were attentive and accomodating.

site_logo

scott gordon . 2022-12-17

MORE AT Google

They looked after our extra large group really well. Starters were better than mains but overall the good was very good. Standard Cobra beers etc.

site_logo

Paul Roberts . 2022-12-16

MORE AT Google

overpriced below averge meal restaurant was empty food below average and they had the cheek to add 10% service charge for 3 people with 2 starters one curry each and drinks nearly £100 thats hard earnt money do not recommend and would not return

site_logo

Kelvin White . 2022-12-08

MORE AT Google

Notts ladies Visting Leicesters finest foods. Beautiful food very tasty and served with elegance. Most enjoyable. Would definitely re visit and taste more off the menu Thank you Shimla Pinks

site_logo

Helen White . 2022-11-29

MORE AT Google

Never let you down, always excellent food and service is superb

site_logo

Phil Pearson . 2022-11-12

MORE AT Google

Isn’t worth it. Service too slow, and others were served food although we came a lot earlier, we waited 2 hours on a weekday. Pathetic.

site_logo

Amira Begum . 2022-11-03

MORE AT Google

Did not enjoyed at all. Chicken curry was not cooked properly. Curry was watery nd tasteless.

site_logo

Alisha Kamli . 2022-10-15

MORE AT Google

Just don't noo what this are cook over rated food

site_logo

Mario Gomes . 2022-10-09

MORE AT Google

First time at this restaurant. Very nice place, food was really nice and very good portion sizes. Kind and attentive staff, only thing I would fault was the lassi was watered down too much. Well priced for the quality and quantity, lovely tasting and well presented dishes. The peshwari naan bread filling was not skimped on as some restaurants do which defeats the point. The cutlery even came in a sealed packet with tissue and anti bac hand wipe, very hygienic. Not sure if service charge was optional or not but I would and will pay again as the service was brilliant, we went on a busy Saturday night and could not fault it, orders came out fast with extras as requested and asked during the meal if everything was ok. Also asked if we were ready for next course which is always a plus. If there was no service charge we would have left about the same in a tip anyway. Will definitely be back to try some of the other dishes.

site_logo

Sonny Parmar . 2022-10-02

MORE AT Google

I've been here a few times with friends and the food has always been delicious everytime. Service is brilliant and menu is varied. Would recommend!

site_logo

Rhiannon . 2022-09-29

MORE AT Google

Really nice taste only one thing it was a little bit cold

site_logo

Thomas . 2022-09-29

MORE AT Just Eat

We ordered Peshawari naan, paneer masala, chicken malai starter amount. Really enjoyed the meal.

site_logo

Abhinav Kumar . 2022-09-26

MORE AT Google

Food good,service ok. Not happy with service bill 8 quid.no way guys.

site_logo

Adrian Boyd . 2022-09-23

MORE AT Google

Thought id order as a treat for daughter and grandson Butter chicken and chicken tika both of them tasted like they was made from a tin of tomato soup, platter was nice and rice and nan bread but curry was chicken in tomato soup very disappointed for the price kirsty

site_logo

Sara Peg . 2022-09-17

MORE AT Google

Food was delicious, service very good. Parking was a little awkward when we went but possible.

site_logo

Doug Gregory . 2022-09-04

MORE AT Google

Amazing curry Best in Leicester 🍛

site_logo

Colin Johnson . 2022-08-24

MORE AT Google

Something different. The food is excellent and a bit different from the usual Leicester menu.

site_logo

Tracy Campbell . 2022-07-14

MORE AT Google

Similary restaurants in East Midlands

restaurant_img
4.2

1008 Opinions

location-icon207A Evington Road
Indian
outdoor_seating_203430takeaway_203430delivery_203430

The best place!!! The best breakfast, coffee,chai, I love this place Lovely people 🤗

restaurant_img
4.2

808 Opinions

location-icon29 Portsmouth Road
Indian
outdoor_seating_78721takeaway_78721delivery_78721

Excellent food, great atmosphere, friendly staff. I highly reccoment it

restaurant_img
4.2

1567 Opinions

location-icon103 - 105 Narborough Road
Indian
outdoor_seating_84931takeaway_84931delivery_84931

They have lost the taste and ordinary Ladoos are too smooth sweet and not fresh at all Punjabi Samos are too stuffed and not tasty Veg cutlets are too salty . Over not good that they were earlier Service is also very slow. You have to wait for long in the Q for the take away orders

restaurant_img
4.2

635 Opinions

location-icon75 Cecil Road
Indian
outdoor_seating_210472takeaway_210472delivery_210472

Delicious and underrated. So far the best take away in Highfield. Will come back insh Allah.Update : I came a second time and my daughter and me both have food poisoning. She is not going to work today.

restaurant_img
4.1

33 Opinions

location-icon48 Belgrave Road
Indian
outdoor_seating_317621takeaway_317621delivery_317621

Just Punjabi is a very nice place which is located in Belgrave Road in Leicester. Food was prepared during our visit, so it was brought in the frying pan which was steaming. We ordered mixed grill and fish which were very delicious. Service was fast, polite and pleasant. The restaurant is beautiful and cosy though it is not very big. Thank you for such a pleasant time on Saturday night.