GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.3

Based on 1.608 opinions finded in 1 websites

site_photo3

Nº 256 in 841 in South Lanarkshire

Nº 46 of 103 British in South Lanarkshire

CUSTOMERS TALK ABOUT DISHES WITH..roastcookedsteakcheeseladyfishmeatpaycoffeeoldsaladcreamchickenpotatoesmustcakevegetables
Score

comment_iconOpinions

Regularly go for breakfast. Great value for a buffet breakfast. Staff are always very nice and helpful too especially Anya.

site_logo

Jason K . 2025-05-16

MORE AT TripAdvisor

Preserved through the app and it arrived quickly. Nachos were lovely, breaded garlic mushrooms were solid. The coating was very hard. The garlic dip wasn’t the best. Macaroni cheese was disgusting, so much so my daughter couldn’t eat it. (They did refund the cost of this). Chicken medley, which Iv had before was very different this time. The pepper corn sauce was under the melted cheese which topped the chicken. Usually it’s served in a small gravy boat. The lettuce was wilted, the sauce over it wasn’t very nice either. All in all not worth the money today. Very disappointing.

site_logo

linda M . 2025-05-10

MORE AT TripAdvisor

A reliable lunch spot. I typically order small plates or a coffee and just keep to myself. I never wait too long, the food is the sort of quality I'd expect for the price I'm paying. The staff are very polite and hardworking, I've often came in to see them rushing around short staffed, but even still they're very friendly and helpful. I used to work in hotels so I know the effort that goes into hospitality and I tend to see an American boy behind the bar most days I'm in and he never seems to stop, I'll need to catch his name next time I'm in, but he is fantastic. I always go on the quieter sort of afternoons and it's a nice peaceful atmosphere, really enjoy coming in to do my uni work etc due to how convenient it is.

site_logo

Liam K . 2025-05-06

MORE AT TripAdvisor

Ordered the Macaroni, fully expected it to be home made, however when It arrived I could honestly believe it was a cheap pack from Farmfoods or the like. Normally I go for the Carvery which is usually good here and I do come regularly. When asked by a staff member if food was OKas I had left the full thing. I said it was aweful and seamed like a cheap ready meal. She said she didn't know where it was from and that was the end of the conversation. So all in all just really a bit dissapointed!!!!

site_logo

stuart w . 2025-04-28

MORE AT TripAdvisor

I love this place but more and more I'm put off visiting due to the staff. The food and prices are great, but the majority of staff urgently need either replaced or fully trained again. I'm not against older staff in anyway but the older grey haired lady is quite simply rude (telling me I'd ordered the wrong thing instead of her bringing the wrong meal) and visibly struggling to carry plates. The worst experience however was from the blonde tall Russian lady who was absolutely vile - unfriendly to the extent she was almost angry when I was ordering.

site_logo

Jennifer R . 2025-04-23

MORE AT TripAdvisor

Had a lovely breakfast with my son, mum and brother everything was perfect and we all are definitely coming again Vicky and Mary gave brilliant service and were lovely

site_logo

Toni G . 2025-03-11

MORE AT TripAdvisor

We came for a breakfast which to our surprise was an all you can eat Biffet style with bottomless tea and coffee. We were also able to use our blue light discount which was an excellent 15% off. As for the food and service… the service was great from all members of staff. We were met with friendly smiles and warm service. The food was warm and tastey. The kids play area was clean and lots for kids to do. Will be back.

site_logo

Ryan . 2025-03-11

MORE AT TripAdvisor

Outstanding, great service. Friendly staff, Jordan was especially helpful. Dont have any complaints, first time being in the restaurant and will definitely make an effort to return.

site_logo

Adam M . 2025-03-07

MORE AT TripAdvisor

Lovely breakfast served up at Red Burn Farm yet again. Fantastic customer service from Vicky and Mary who always go above and beyond to make you welcome. Would highly recommend.

site_logo

Malcolm W . 2025-03-06

MORE AT TripAdvisor

Great service for breakfast. Coffee made by vicky was lovely. Mary also served and had a friendly manner. The value for money that you get from breakfast is great. Compared to all these big companies.

site_logo

Laura W . 2025-03-06

MORE AT TripAdvisor

WE STAY NEARBY AND HAVE WENT HERE SINCE IT OPENED AND IN GENERAL ITS ALWAYS DELIVERED. DESPITE VERY FRIENDLY STAFF AND GREAT SERVICE THE QUALITY OF FOOD HAS FALLEN. HOW HARD CAN IT BE TO SERVE A "HOT" CARVERY AND DECENT MEAT. MY WIFE HAD THAT AND I HAD BURGER/CHIPS WHICH HAD SUFFERED SHRINKFLATION; THE CHIPS WERE AMAZING AND THE BURGER WAS OKISH BUT CERTAINLY SMALLER AND LESS TASTY. MY WIFE COMPLETED CUSTOMER FEEDBACK BUT NEVER HEARD BACK HENCE MY REVIEW. HOPEFULLY IT IMPROVES AS WE LOVE GOING, BUT NOT FOR THAT STANDARD 🙏

site_logo

2toppers . 2025-01-12

MORE AT TripAdvisor

Great value for money, Breakfast is a Buffet so help yourself to as much as you want and what you want with a fantastic selection. Staff were pleasant Margaret made us feel welcome and was great with customer service, She was Brilliant. Will definitely be back and would highly recommend to anyone looking for a cheap but very well quality breakfast.

site_logo

Lewis B . 2025-01-05

MORE AT TripAdvisor

Great value, lovely staff. Margaret especially helpful. Recommended will be back. Fussy wife was a happy wife! Happy New Year.

site_logo

Ian k . 2025-01-05

MORE AT TripAdvisor

Absolutely amazing service our family enjoys going to the red burn very often , the food and drinks are absolutely amazing and very affordable

site_logo

Blah B . 2025-01-05

MORE AT TripAdvisor

Myself and my sister visited to book for 18/19 people for the festive menu. We had to visit the restaurant to book as our calls were unanswered. We were advised by the assistant on duty that night that they would have to clarify booking with the manager and would let us know. A couple of weeks past and we had no notification so we visited again and was assured the booking had been accepted. On the night before our booking we visited and while in just double checked the booking only to be told there was no booking on the system. The booking was only then put on the system. When we arrived at the restaurant on 28/12/24 @ 5pm our tables weren't ready. We were like 4 separate families out for dinner. There was no table covers, crackers or even festive menus on the table. So all in all there was nothing festive about it. The orders were all taken at different times so they were all served at different times. A couple of people ordered tikka masala half and half. The curry was like soup it was so runny and the chicken didn't resemble anything like chicken, it was a very dark colour. The gluten free chicken wings with bbq sauce was also a let down as the sauce again was very runny and thin. Some of the meals were luke warm. We have all visited regularly together and separately without any issues. This is my 82 year old mums favourite place to eat when out and she was very disappointed at the issues we encountered. It definitely wasn't any of our best experience and I hope it doesn't put any of us off visiting again.

site_logo

Karen F . 2025-01-02

MORE AT TripAdvisor

Anya was amazing! Such lovely service from start to finish! She noticed when we came in we had elderly grandparents with us so allowed us to choose where was most comfortable to sit for them and she also checked on us during our meal to make sure we were enjoying our food, anya was really patient when we were ordering our food which was very appreciated - such a lovely woman made our experience a lovely one thank you so much again!

site_logo

Rachel B . 2024-11-16

MORE AT TripAdvisor

Greeted at the door, so informative, all staff had smiles and time for the kids. We started a party of 7 which changed to 11. We were accommodated in all aspects. Food was great and hot. Staff let us sit a little while longer to catch up with distant family. Pricing was fantastic and the desserts where not only beautiful but huge, kids were mesmerised with them. We have just moved to the area and have already decided this will be our local eatery. Thank you to all.

site_logo

Pamela L . 2024-11-12

MORE AT TripAdvisor

Went to the Redburn Farm at 5pm this evening. Greeted and shown to a table with a very polite and pleasant gentleman. Ordered our carvery from the lovely young man at the bar ( so helpful with fantastic customer service) proceeded to carvery spoke to a delightful chef also (the turkey, beef and Gammon were all fresh along with the piping hot buffet selection of potatoes veg and of course the gravy. Best Carvery in Lanarkshire - would not go anywhere else. Been for breakfast and lunch lots of times staff are amazing - nothing is a trouble - keep up your excellent standards 👍

site_logo

Andy & Liz . 2024-11-06

MORE AT TripAdvisor

I love coming to Red Burn Inn,Blantyre for my breakfast where the food and staff are excellent and especially Anya whom goes out of her way to make you feel happy and welcoming with her great customer service and very kind smile 😃 10/10

site_logo

Austin M . 2024-11-02

MORE AT TripAdvisor

The food was super tasty for a good price. The staff were all lovely too, especially David who served us at the carvery! :)

site_logo

Abbey McKinney . 2024-11-02

MORE AT TripAdvisor

Lovely fast friendly service Food was nice some things a bit dry as left out a bit long. Lovely place to have a breakfast with family and friends great atmosphere.

site_logo

Diane T . 2024-09-12

MORE AT TripAdvisor

Fantastic service, lovely food. Seated right away. Food served quickly. We were served by Vicky and Mary they were so helpful. Really nice ladies.

site_logo

Nicola M . 2024-09-11

MORE AT TripAdvisor

Lovely cup of tea made by Mary and served by Victoria. nice environment to relax in.Would recommend and will be back in future.

site_logo

Chris M . 2024-09-11

MORE AT TripAdvisor

Must be one of best in the area. The food is excellent as is the service in particular. Mary and Vicky stand out. Would encourage you to try it out and I am sure you will want to return.

site_logo

Graeme S . 2024-09-11

MORE AT TripAdvisor

Was in this morning with the family for breakfast vicky and mary are always so friendly and we love to chat to both.ladies breakfast was delicious thanks again red burn we will see yous all soon

site_logo

Sightsee30174986133 . 2024-09-10

MORE AT TripAdvisor

WE have been before several times, but I feel todays experience deserves a review due to the lovely staff we met. I came in this afternoon7/7/24 with my other half for lunch. We were a bit early at 12pm, but we were welcomed by a lovely gent, sorry I don't know his name, he had dark hair and a beard wearing a plaid shirt,he was possibly the manager? who saw us to our table. He was so very nice and chatted away while he poured our drinks. Despite being in at 12pm, the carvery was all ready, the carver was a lovely lad too. Very respectful, chatty and friendly. The food was great. We both had the carvery then Eaton Mess sundae after which was also delicious! I noticed the big massive cakes they have too in a chiller display cabinet and they looked amazing, but I was good and resisted getting some to take home! LOL All over experience was good. The 2 gents we spoke to were lovely and I hope the management commend them for having excellent customer service! And the food was great. 5* from us!

site_logo

Jay E . 2024-07-07

MORE AT TripAdvisor

We come to Red Burn farm regularly for breakfast. The food was lovely and wee feel well looked after. A special thanks to Anya who looked after us amazingly!

site_logo

Kelvin B . 2024-07-06

MORE AT TripAdvisor

Went to the Red burn it's went down hill the cavalry is a joke chef was cutting the meat with a razor blade the calouflour cheese was disgusting the rost potato burnt beyond recognition never be back disgrace

site_logo

murrymint44 . 2024-07-06

MORE AT TripAdvisor

I met up with a large group of friends for dinner and drinks. Menu choices were amazing. They have a new manager and she was doing a fantastic job for such a young girl . We received a warm welcome from her and her staff x

site_logo

Hunca1 . 2024-07-05

MORE AT TripAdvisor

Met up with a group of choir members for tea/coffee/cake. Arrangements were made for us to have a reserved area where we could chat and move around. We were well looked after by staff who could not do enough for us. We will return.

site_logo

diva465 . 2024-07-05

MORE AT TripAdvisor

This is our favourite breakfast spot! Anya and all of the other staff are lovely and attentive! They also always remember us and say hi which is very welcoming!

site_logo

Kiara R . 2024-04-13

MORE AT TripAdvisor

Always a good selection available and staff are always helpful and friendly. Buffet style and off menu available. Great value for money. Today we were served by Anya who was very helpful.

site_logo

Michael C . 2024-04-13

MORE AT TripAdvisor

Staff were all really friendly. Guy at the carvery was chatty which was nice. Alan served our coffee and was lovely. Nice big restaurant

site_logo

Noni2012 . 2024-04-08

MORE AT TripAdvisor

I recently went here for the breakfast buffet with my two toddlers. The selection of food was great. In particular staff member anya was very attentive and also helped with plates to our table meaning I didn’t have to do a double run for my own plate. The children’s area is fantastic as it meant they could have a play and come back for more food when hungry. And also mummy could eat and get coffee.

site_logo

holidaywhor3 . 2024-04-08

MORE AT TripAdvisor

Had a fantastic carvery dinner tonight at red burn farm. The man on carvery had it all set up very well, food was tasty and a good atmosphere. Michael on the bar served me very well also. Will be back.

site_logo

John T . 2024-04-07

MORE AT TripAdvisor

I went here today with a group of friends and our kids. Staff were friendly, the play area was good and the service was fast. The food quality however was not good. My child’s pizza was undercooked, bland looking and in his words was “rotten”. Chips were dark looking indicating the need for a change in oil in the fryer. My own lunch was served with salad which was actually some lettuce and a few slices of onion. I had expected some more salad items. I’ve eaten here before and been happy so was disappointed today.

site_logo

Lesley O . 2024-04-03

MORE AT TripAdvisor

Visited today with family for the first time. The carvery was fantastic, food cooked to perfection, plentiful and a varied selection for all tastes. The staff were very friendly and welcoming Highly recommend

site_logo

Yvonnepilgrim3 . 2024-03-31

MORE AT TripAdvisor

Friendly, accommodating staff-the buffet breakfast is excellent and the bottomless glass is the biggest I’ve seen-great value for money 👍🏻

site_logo

Ronnie K . 2024-03-30

MORE AT TripAdvisor

Came here instead of our usual spot and it did not disappoint. Food and service was brilliant. Alan, Gemma and Micheal went above and beyond for us. Thanks so much guys!

site_logo

TraceyMills12 . 2024-03-30

MORE AT TripAdvisor

Had a terrific lunch yesterday. Food was delicious and the service and banter from Alan was fantastic. The staff are a credit to the organisation. Will 100% be back!

site_logo

Liisaliisa12 . 2024-03-29

MORE AT TripAdvisor

Early breakfast at redburn farm for breakfast today what a wonderful Easter display on entering with lovely bright colours and beautiful little Easter theme items placed around. And the Easter raffle displays are made up beautifully I can see a lot of effort must have been put into this. Well done Mary and the team it is so nice to see some venues keeping a little bit of tradition on these type of themed events oops and the poached eggs were amazing thank to the chef.

site_logo

Liontroy123 . 2024-03-29

MORE AT TripAdvisor

Great food and friendly atmosphere. Special shout out to Alan and Callum. Never disappoints…great wee local restaurant, love it.

site_logo

jacmit . 2024-03-29

MORE AT TripAdvisor

Late afternoon Meal with the family, had a great time at the Redburn Farm. Typical Gastro Fair, food was decent… service was great, Laughs with Erin & Cameron on the bar & Alan all deserve a notable mention. Well Priced, Well Presented & Tasty. Mrs’ wants to come back more often just for cakes (delicious)

site_logo

Colin M . 2024-03-29

MORE AT TripAdvisor

Breakfast was lovely staff really nice and welcoming especially Anya. Been in a few times for dinner also and never been let down once.

site_logo

Mobile781854 . 2024-03-25

MORE AT TripAdvisor

Food was standard nothing special. Staff never responded to a query about food we paid for and never got. Tried to order a Sundae to be told that they could not make any sundaes at the moment. Staff pleasant enough but not overly helpful. Ask for a receipt when you order food as it saves having to ask staff multiple times about things and not getting a reply. Would we return? Yes but only during the week when its cheaper.

site_logo

jeaneY4702EZ . 2024-03-24

MORE AT TripAdvisor

Great pub food, cakes look amazing ( too full to even try them after dinner on every occasion so far - but they are HUGE) Carvery has more selection than Toby’s down the road which can be a bit hit and miss. This one gives...

site_logo

ElJBe . 2024-03-17

MORE AT TripAdvisor

Came for lunch and decided to try the carvery The whole meal from the meats to all the trimmings was absolutely delicious would highly recommend folk to try it well worth the money the service we received from the young man who I believe was...

site_logo

deborahcD3730JI . 2024-03-07

MORE AT TripAdvisor

My family meet up there weekly in varying numbers for lunch. The food is always good and the staff are welcoming, friendly and accommodating.

site_logo

Fiona M . 2024-03-07

MORE AT TripAdvisor

Carvers was outstanding thanks to staff I think his name was William very well mannered and polite will be back again thanks to the chef

site_logo

Peter B . 2024-03-07

MORE AT TripAdvisor

Great place to eat! We come here regularly. We came last Wednesday for the Carvery, which is one of the best I've ever had. The young chap who served us was really friendly. He was really helpful too when I was asking him how the...

site_logo

703trishas . 2024-03-07

MORE AT TripAdvisor

Popped in for a spot of lunch yesterday, decided to have a carvery. The food was delicious and the portions were great. The young man serving at the carvery was a delight, very polite and welcoming. I am sure he told me his name was...

site_logo

Katie C . 2024-03-07

MORE AT TripAdvisor

We go to redburn farm quite often as a family and the service is just fantastic. We are always welcomed well and served very good. The waiter Anya is always very accommodating to us as a family and knows exactly what we are needing. When...

site_logo

Jordene D . 2024-03-02

MORE AT TripAdvisor

I have only been twice with my mom . She uses a walking aid and the red burn is very accessible and she likes the facilities . Anya and the staff are very helpful and the food is lovely. Overall a good experience and will...

site_logo

William M . 2024-03-02

MORE AT TripAdvisor

I come here with my partner and 3 kids a lot for breakfast and for dinner we love it food is amazing kids love the icecream on the way out, Anya is very polite lady who works here , takes time to remember you as...

site_logo

Natalie O . 2024-03-02

MORE AT TripAdvisor

Me & my family are regular customers we come here for breakfast & dinner most days or nights during the week the food is absolutely amazing highly recommend as well as the servers are amazing also we are served by anya most times we are...

site_logo

Lawrance Y . 2024-03-02

MORE AT TripAdvisor

Brilliant pub. Relaxing and very welcoming. Not cordon bleu but tasty and edible. Amazing staff who are a credit to the company

site_logo

Pamkirk . 2024-02-26

MORE AT TripAdvisor

Great place, lovely service from Anya and lovely food. Always great food here and we come here regularly 😋 Plenty parking spaces and tables inside with a chilled atmosphere

site_logo

FEM1971 . 2024-02-24

MORE AT TripAdvisor

Great place, friendly staff and lovely food. Carveries usually aren't great for vegetarians, but this place was fantastic for veggies and omnivores alike. Our waitress Anya was really helpful and I'm sure we will be back!

site_logo

Abigail L . 2024-02-24

MORE AT TripAdvisor

Another amazing meal at Red Burn, I go with work and take someone with a LD and the staff are all amazing. The lovely Anya went over and above for our visit.

site_logo

Gemma L . 2024-02-22

MORE AT TripAdvisor

I’m a support worker for adults with learning disabilities and we visit Redburn Farm regularly I am there every Thursday with 1 of the tenants for lunch and as a group we visit mainly monthly for lunch with a few of the tenants and we...

site_logo

Helen M . 2024-02-22

MORE AT TripAdvisor

Excellent service Gemma , excellent food as always !! Plenty of selection, and fresh! Booked a table and arrived early to be seated Great prices also.

site_logo

Janine W . 2024-02-17

MORE AT TripAdvisor

Visited for breakfast for the first time. We also received the highest level of hospitality. Had a quality and delicious meal at a reasonable price.The space and facilities in the restaurant were of high quality. Above all, the friendly staff must be praised. Special thanks to ''Anya'' who treated us very well and dedicatedly from the moment we entered the restaurant.

site_logo

Chathusha K . 2024-02-16

MORE AT TripAdvisor

We were given a voucher as a gift so decided to go for dinner. After being seated at our table by the waitress we were undecided whether to have food from the menu or the carvery. The menu had food residue on it so picked up another and it was the same. Clearly they don't get wiped when the table is being cleared. We settled for the carvery. BAD DECISION. The meat, carved by the chef, was fine but the rest, which you serve yourself, was terrible. The roast potatoes were burnt, the selection of vegetables were just casseroles of mush. The bowl of stuffing was so hard you couldn't even get a spoonful onto the plate. Returning to our table to start eating and it was all lukewarm. My only recommendation is to AVOID AT ALL COSTS. Definitely don't recommend for food and we will certainly never be back

site_logo

FineDinerAR . 2024-02-15

MORE AT TripAdvisor

Was served by William what a guy defo be back here good to see a happy face too quality service from him helped me and my girlfriend out to the fullest give him all the praise in the world

site_logo

Robbie M . 2024-02-14

MORE AT TripAdvisor

Burgers were tasty and the customer service was excellent. Alan and Cameron both very helpful. Service with a smile and humour!

site_logo

Gillian W . 2024-02-12

MORE AT TripAdvisor

Was in the red burn farm today for some dinner and cake Alan gave great service at the bar and helped on witch cakes to buy thanks.

site_logo

Dana H . 2024-02-12

MORE AT TripAdvisor

Great place to eat, come all the time Food is amazing, great service Family friendly Our server Alan was very polite, and great service.

site_logo

Abigail S . 2024-02-12

MORE AT TripAdvisor

Fantastic service especially from Alan …good was great, love a carvery … Alan was very informative, friendly & quite funny … Helped with one of my family members who has limited mobility … thank you …

site_logo

Lainygirl . 2024-02-11

MORE AT TripAdvisor

Food was brilliant. Assistant manager Alan was wonderful,helpful and happy . Other members of staff, young Male cannot remember his name was superb also.

site_logo

Andy B . 2024-02-11

MORE AT TripAdvisor

Came here for a family birthday meal. Alan at the bar was great customer service. David at the carvery station was also top notch. Would recommend.

site_logo

desmondf235 . 2024-02-11

MORE AT TripAdvisor

We had Gemma as our waitress and she was lovely, she was very friendly and helpful. She was on point with clearing the table and making sure everyone was happy with our meals.

site_logo

steph d . 2024-02-10

MORE AT TripAdvisor

I really enjoyed my time here, want to say thank you to the bartender Michael for his service made more enjoyable. Definitely will come back.

site_logo

John K . 2024-02-10

MORE AT TripAdvisor

Gemma was fantastic with the kids, food was ok but 5* purely for Gemma. Great place for a meal with a nice little play area for the kids

site_logo

Kevin M . 2024-02-10

MORE AT TripAdvisor

Delightful experience with my family. Carvery was tasty and all staff were attentive. Especially Anya who served us, customer service was amazing. We will definitely be back soon.

site_logo

sofimidd . 2024-02-10

MORE AT TripAdvisor

Enjoy a meal out with my wife, something we do most Saturday nights. We have been going most weeks for many years and have found the staff, many changes over the period, to be pleasant and helpful. Anya is a breath of fresh air and...

site_logo

Jim H . 2024-02-10

MORE AT TripAdvisor

Great food, excellent service. Five stars all the way would highly recommend Red Burn Farm will definitely be coming back.

site_logo

Sweetbell2810 . 2024-02-10

MORE AT TripAdvisor

Great food. Great service by Alan behind the bar. Very chatty and efficient. Maybe A bit too handsome too!! thanks again.

site_logo

ana m . 2024-02-05

MORE AT TripAdvisor

The food was excellent, service from Alan the manager was spot on, 10/10. The prices were more than reasonable and the takeaway deserts just topped it off.

site_logo

martin s . 2024-01-27

MORE AT TripAdvisor

What a great wee find. The food more than surpassed expectation. The fish and chips was delicious and carvery (small) was more than enough for lunch, very generous portion and a fabulous selection of vegetables including cauliflower cheese delicious. The staff were so attentive and...

site_logo

E5290DRpaulam . 2024-01-22

MORE AT TripAdvisor

As we come here on a regular basis Couldn't fault it breakfast was great very fresh, very accommodating as asked for green tea, the staff member Douglas gave me 2 tes bags incase I fancied another cup . Staff member Douglas is suh a funny...

site_logo

Playpark1234 . 2024-01-20

MORE AT TripAdvisor

Magic late afternoon dinner at our favourite haunt - the Red Burn Farm with Adam and the team. Great service as usual and food is healthy and wholesome. A place to go for your carvery.

site_logo

Linda S . 2024-01-18

MORE AT TripAdvisor

We booked for Sunday evening meal. The place was very full when we arrived and was obviously popular and looked good. We were shown to a table promptly although they did clean it in front of us. It was not obviously dirty although the stain...

site_logo

rayneileen . 2024-01-16

MORE AT TripAdvisor

Been loads of times but it’s slowly went down hill. Portion sizes are much smaller yet prices have increased. Asked for the beans to be separate but they came over the smallest beer battered fish that was half the size of the picture. Loaded chicken...

site_logo

Siosta94 . 2024-01-13

MORE AT TripAdvisor

Spot on staff where great and had a good laugh with them especially Alan(the peas where amazing lol)

site_logo

B R . 2024-01-10

MORE AT TripAdvisor

I have been here 3 times now and every time the staff have been great ! Had an issue with my farmhouse 15 code but Alan & Michael sorted it out with no hassle , great service , great food and excellent staff , I...

site_logo

clarewilson6 . 2024-01-10

MORE AT TripAdvisor

Excellent service and good food from start to finish. Special mention to managet Alan Mackie and Server Liz for their friendly service and welcoming attitudes - a pleasure to be a customer at their establishment

site_logo

James D S . 2024-01-09

MORE AT TripAdvisor

We visit regularly, the staff are incredibly helpful and friendly, particularly Anya and Douglas, although everyone is brilliant. The food is generally very good, perhaps more vegetarian or vegan options would be appreciated, if there is a rare issue, they are quick to rectify this....

site_logo

Pamkirk . 2024-01-08

MORE AT TripAdvisor

Food was outstanding, so fresh and tasty! Alan gave us great service, even with a smile! Highly recommend

site_logo

GillGlasgow1 . 2024-01-07

MORE AT TripAdvisor

Food was amazing as always and a brilliant service from the bar staff Alan. We will all definitely be back.

site_logo

Jacqueline N . 2024-01-07

MORE AT TripAdvisor

We have been here a number of times and the staff have always been friendly, attentive and service excellent. In particular Anya has went out of her way to ensure our visit was special, a lovely lady.

site_logo

Joe Q . 2024-01-07

MORE AT TripAdvisor

The food was great, but the fantastic service was what set our experience out from the crowd. Anya was wonderful at helping my disabled wife find a table in close proximity to the carvery and has offered to help carry her plate back to the...

site_logo

andrewcX4221AC . 2024-01-07

MORE AT TripAdvisor

Great service and food. No faults with the place. Staff were great and breakfast and lunch was served at convenient times.

site_logo

John M . 2024-01-06

MORE AT TripAdvisor

Late afternoon Meal with the family, had a great time at the Redburn Farm, Cameron served us on the bar & had great banter with the kids. Brodie brought our food & was a lovely young lady too & was very attentive & polite. She...

site_logo

Colin M . 2024-01-06

MORE AT TripAdvisor

We ordered breaded mushrooms and cheesey garlic bread they were delicious for mains I had fish and chips partner had gammon steak can't fault either of them hot and taste our server Anya was very pleasant and helpful

site_logo

Mary L . 2024-01-06

MORE AT TripAdvisor

Came for some of the huge slices of cake and coffee with the family. Cake did not disappoint and as usual our eyes were bigger than our bellies. Had the pleasure of being served by Alan who was really welcoming, friendly and helpful. I don’t...

site_logo

CarMath15 . 2024-01-06

MORE AT TripAdvisor

A great little carvery go-er and very relaxed atmosphere - the manager Karen and staff were very friendly and helpful and went out her way to assist my family when by chance we had to add an extra member to our booking - very impressive...

site_logo

xlolx . 2024-01-06

MORE AT TripAdvisor

Went for a meal with the family had a lovely experience. Food was enjoyable and the service provided by our waitress Brody was excellent.

site_logo

R7472YNclaudiag . 2024-01-06

MORE AT TripAdvisor

First time here and it didn't disappoint! Large food portions, good for money and great customer service especially from Alan. He gave the kids extra ice cream amd fudge cake yummy! Thanks for a great experience Alan, keep up the great work! :-)

site_logo

Reena G . 2024-01-06

MORE AT TripAdvisor

Great lunch today, lovely friendly atmosphere. Kids area great again for the kids to play whilst awaiting meals- which is not a long wait at all. Very kind server Brody who even wished us all a Happy New year! Lovely x

site_logo

T C . 2024-01-06

MORE AT TripAdvisor

Great value, plenty choice on menu and service with a smile. Local place, good value for money, good parking facilities. Had service with a smile from Karen.

site_logo

Karen B . 2024-01-06

MORE AT TripAdvisor

Similary restaurants in South West Scotland

restaurant_img
4.3

671 Opinions

location-iconHope Street
British
outdoor_seating_115211takeaway_115211delivery_115211

Popped in for a late lunch on a Friday. It was a beautiful day so we sat outside with the dog, though I'm assured they are very dog friendly inside too. As soon as staff saw the dog they brought a water bowl without being asked (top service for the dog). Food was lovely and atmosphere very welcoming. Prices were very reasonable and portions generous. We'll definitely be back.

restaurant_img
4.3

985 Opinions

location-iconCoulter
British
outdoor_seating_117465takeaway_117465delivery_117465

Recently had our wedding at Cornhill Castle. The location is stunning. The castle is also to a high standard and the rooms were amazing, luxurious and comfortable (especially the honeymoon suite). The staff went over and above and made sure the wedding went smoothly and that we were looked after at all times. We can't thank the staff enough, they really added a personal touch and made us relax knowing everything was in hand. Rooms, service and location all 5 stars. Unfortunately I have to remove 1 star as the food was not good. We paid extra for the beef and the majority of the guests have given feedback that it wasn't good. Groom was served an overcooked end piece which was barely edible so it was sent back. The next piece was edible but for a beef fillet at a wedding, just being edible is not really what we were hoping for. Other guests did say theirs was overcooked, tough and tasteless. The veg and brownie were also not to a high standard. We regret paying the extra charge for an upgraded meal. We advise future weddings to stick to the standard menu.

restaurant_img
4.3

2715 Opinions

location-iconBy Lanark Loch, 179 Hyndford Road
British
outdoor_seating_115203takeaway_115203delivery_115203

Walked in at 20 past nine to be told the place was shut and staff were going home. Even although it says online it closes at 10.

restaurant_img
4.3

2913 Opinions

location-icon114 Main Street
British
outdoor_seating_118348takeaway_118348delivery_118348

Went there for a work staff meet whilst in the area. Fantastic meal and great staff, especially Ellie B. Thank you. Will be back soon

restaurant_img
4.4

2101 Opinions

location-icon296 Glasgow Road
British
outdoor_seating_104027takeaway_104027delivery_104027

Great food and good service. Lasagna and Carbonara were excellent but let down by Garlic Bread (cold). Cajun Chicken, Gammon and Burger all very good. Service was pleasant but attracting attention for more drinks was challenging.