GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 629 opinions finded in 1 websites

site_photo3

Nº 568 in 1060 in Wirral

Nº 15 of 27 Italian in Wirral

CUSTOMERS TALK ABOUT DISHES WITH..steakcookedpuddingoldpizzafilletpastapaycarbonaraprawnschickenfishspaghettimushroomshamcheesegarlic
Score
OpinionsNoteTripAdvisor6294.0

comment_iconOpinions

We visited the restaurant a few weeks ago, and the manager, Sean, recommended few places to visit in Wallasey. We came back today for lunch and the food was delicious, and very friendly staff.

site_logo

Jeniffer B . 2025-03-02

MORE AT TripAdvisor

How this place has fallen!! Anyone that likes Italian would be ashamed to see sliced ham in a Carbonara! My 7 year anniversary of could have made a better dish. To start we booked a table for 13 and didn’t have enough places spare when we got there. We then waited for 15 mins to order a drink. We then had to remind them constantly about the drinks order and they forgot about 4 of them. The food ordering process was a Joke the waiters didn’t know what they were doing and had to ask for help from their manager. When the meals came out they were all unrecognisable from what was ordered. We had to ask for salt and pepper and it took 10 mins to get it. Then we checked the bill after we had left to find we had been charged twice for one of the meal. Never again will I go here. It used to be amazing shame really.

site_logo

Gareth Anderton . 2025-02-24

MORE AT TripAdvisor

Sarcastic and very slow service - one of our party asked for pineapple on his pizza which was advertised on their menu and was bombarded with criticism and sarcastic snatching away of his menu; he obviously thinks he’s a great dramatic actor but no it came across as nasty and embarrassing. Food came, meat all pasta was basically tasteless and whilst the pizza topping tasted good the base tasted like pastry (tasteless). We were going to order dessert until we’d waited 20 minutes after being given the menu for the waiter to return and they never did so we paid and left. Afterwards I looked this place up on Food Standards and was shocked to see it is GRADED 1 STAR FOR FOOD HYGIENE!!! We will never return.

site_logo

claudiaWirral . 2024-11-14

MORE AT TripAdvisor

Visiting the area and this looked like a geniune italian ristorante. Boy were we disaapointed. Reheated supermarket food at best with a splash of additive to try to throw you off. The pizza base was,shop bought,under cooked and served on a wooden board which when removed from the table left an unpleasant greasy residue behind. The other dish was average at best. Staff were pleasant enough.

site_logo

Kim A . 2024-10-12

MORE AT TripAdvisor

Really tasty food but such small portions of pasta. Very nice staff. Restaurant was bitterly cold. Had to eat with our coats on.

site_logo

Cheryl D . 2024-10-10

MORE AT TripAdvisor

Family gathering events, lovely atmosphere, very unique place loved the decorations. We enjoyed our starter mainly Gamberi in Padella. Main course was perfectly cooked. Gamberoni Picante I had. Couldn't mange to order dessert. Very professional service, lovely waiting waiting staff , warm welcoming. Definitely recommend...

site_logo

607sharonss . 2023-08-20

MORE AT TripAdvisor

Good service, Good food, no complaints . Staff were attentive .the place was clean and smelt fresh

site_logo

leecY7359DN . 2023-06-02

MORE AT TripAdvisor

Awful, waited 45 minutes after ordering our drinks which we had to collar a staff member to take our order! The restaurant was not busy at all but I think only 3 staff working the floor so service was shocking All I can say about...

site_logo

Nigel51 . 2023-05-06

MORE AT TripAdvisor

As we arrived for our meal, we were greeted by the restaurant manager who was very friendly and compliment¹ary on our appearance. After sitting at the table for a while it took some time for the waiter to take our order, we ordered 2 glasses...

site_logo

Germaine O . 2023-05-05

MORE AT TripAdvisor

My parents are regulars here but walked out last Saturday evening due to the poor/rude customer service from the seemingly new staff.

site_logo

gemmamU8796QW . 2023-04-26

MORE AT TripAdvisor

We went here after hearing good things but img it was shocking the starter was lovely don’t get me wrong but the mains were awful we were told it would be a half an hour wait for a calzone and when it arrived it was...

site_logo

Kerry T . 2023-04-11

MORE AT TripAdvisor

Great authentic Italian food, attentive service from all staff. Inside is big and very nicely done. 2 mains 4 drinks 45 pounds , reasonably priced. Will be back for more.

site_logo

Stephb43 . 2023-01-15

MORE AT TripAdvisor

It's the second time I have been here in 3 months. Loved it so much the first time I had to go back. I'm travelling alone and a big fan of Fillet steak Medium rare, no sauces, just a few chips. I've had it in...

site_logo

neil f . 2023-01-11

MORE AT TripAdvisor

We are a family of two adults and one child. We enjoyed a delicious meal here last night. We shared the antipasto stater which was delicious, and the mains were gorgeous. There is a lovely warm ambience in the restaurant and the staff were friendly....

site_logo

DrBWirral . 2022-12-30

MORE AT TripAdvisor

A review with only one word in the title because nothing more needs to be said. This place is excellent and it is all down to the staff who have good manners, people skills and good food. I had Lasagna and it was delicious, my...

site_logo

sjohnleslie . 2022-12-29

MORE AT TripAdvisor

We arrived told the bar maid we had booked a table 2:30, she was not pleasant at all, told us to sit by the window. Waited 20mins for someone to take our drinks order. Then another 10mins someone took our order , read it back...

site_logo

Clairliamduke . 2022-12-29

MORE AT TripAdvisor

Amazing food and service as always. Always a great place to go for food Atmosphere is great and service is so nice

site_logo

Chelletranx . 2022-12-19

MORE AT TripAdvisor

Our uncle chose Portofino because they did a good selection of gluten free dishes. We were warmly welcomed and shown to our table. I was amazed at the selection of g/f meals - spoilt for choice! The food was delicious, beautifully presented and served by...

site_logo

CadmansKent . 2022-12-18

MORE AT TripAdvisor

Came today with the family. Couldn’t fault the place the manager was super friendly and very accommodating We had a kid’s spaghetti which is now his “favourite ever!” Carbonara which was really nice and tasted so fresh! But the steak was another level better than...

site_logo

Z3608AFdavidt . 2022-11-25

MORE AT TripAdvisor

I don't pretend to find Italian food in the UK but as an Italian I can say after several Italian restaurants in the UK one of the poorest. We told the owner that the sauce was from supermarket jars and what did he do? He...

site_logo

luisalF855VY . 2022-10-13

MORE AT TripAdvisor

Booking was quick and easy even though I had left it late to eat for me. Food and Service excellent very good pleasant easy and relaxing atmosphere. Perfect when you don’t feel to good yourself.

site_logo

Keith F . 2022-09-25

MORE AT TripAdvisor

We were a little concerned that we were the only one in the restaurant on a Saturday lunchtime, but it was the ending of the COVID hysteria. However the food arrived it was superb probably one of the best Italian restaurant meals we had experienced

site_logo

russellandann . 2022-09-25

MORE AT TripAdvisor

On arrival shown to table given menus which I might add were full of dirty and very sticky marks obviously hadn’t been cleaned recently Looked at menus drinks order given. We all knew what we wanted to order from menu but when drinks order taken...

site_logo

Jennifer C . 2022-08-22

MORE AT TripAdvisor

My Calzonie Vegetariana was terrible, just a few vegetables on thick pastry, more like a pastie. It was totally tasteless. The service for our group was incredibly slow, we asked so many times for water refills that it became a joke to the manager, but...

site_logo

AnyaC . 2022-08-17

MORE AT TripAdvisor

Spectacular food and great service. We came for a family celebration and it was magnificent. We loved the food and the service was great, they dealt with a table of 12 with ease and were so pleasant. The food was great. Fantastic quality and beautifully...

site_logo

jomorgan20 . 2022-07-30

MORE AT TripAdvisor

Portifino New Brighton has left me a little underwhelmed. From greasy, sticky tables to slow bar service. Ok it was a warm Sunday and the restaurante was about half full, but I was dissapointed. Not wanting an undercooked steak, I ordered a tenderised sirloin steak....

site_logo

Malcolm E . 2022-07-18

MORE AT TripAdvisor

We havent been here for a while after we always had to complain abiut them bringing the next course too quickly. Thought we'd give them another try. So, the food was really great. But despite specifically saying to the waiter that took our order AND...

site_logo

lizzy072 . 2022-07-10

MORE AT TripAdvisor

To celebrate our sons birthday we had planned on popping into Pizza Express in New Brighton only to find out they had closed during lockdown,. We were looking for something a little special and to our delight, found Portofino. What a joy of a restaurant...

site_logo

susanbA2793PB . 2022-07-09

MORE AT TripAdvisor

I just popped in because I needed a quick meal and I love Italian food but hadn’t had any for a while. The last time I came was some 8 years ago and I was pleased to see how bright and airy it was as...

site_logo

Sherpa09256246621 . 2022-06-27

MORE AT TripAdvisor

Wow! What an amazing meal that was. The taste the presentation, the service was just amazing. I’ve been craving a meal that would leave me 100% satisfied. And this place fulfilled that need. Thank you for tonight.

site_logo

Escape824587 . 2022-06-02

MORE AT TripAdvisor

A quick dinner before a visit to the cinema. Great food, very attentive service and great atmosphere. This is the second visit and both times great. I had their lasagne on both occasions an it's excellent. Well worth a visit.

site_logo

phil5566 . 2022-05-30

MORE AT TripAdvisor

Enjoyed a lovely meal here with family and youngest granddaughter on Saturday. The staff were very attentive and friendly, all making us feel welcome. We were not rushed which was great for us and the meals were all excellent. I would recommend here and we...

site_logo

midd014 . 2022-05-04

MORE AT TripAdvisor

Very underwhelmed by the food. Ordered the tricolore salad to start with. Tomatoes were not ripe at all, one basil leave (which wasn’t fresh) and the mozzarella was very watery. Ordered the prosciutto ham pizza with parmesan cheese and rocket to share. The pizza was...

site_logo

lilbacha . 2022-04-22

MORE AT TripAdvisor

We had the knock back from Prezzo, as we hadn’t booked, crazy as it was empty but it prompted 5 of us to cross the road to Portofino Three Italian priests were dining there, “always a good sign”. The food was simply outstanding. Stay away...

site_logo

spena . 2022-04-18

MORE AT TripAdvisor

Beautiful food and beautiful place. Had the most amazing salmon, that was perfectly flaky and with beautifully cooked linguini. The flavouring is so cohesive and went together wonderfully. The sea bass was perfectly cooked and went really lovely with the veg. Service was lovely and...

site_logo

0kadril . 2022-04-17

MORE AT TripAdvisor

Came for a family birthday and we had a lovely time. Great service & delicious food! The menu is big and there’s something for everyone. 🙌

site_logo

sophiebN3803GZ . 2022-04-12

MORE AT TripAdvisor

We visited as a family group of 22 for an 80th birthday. All food was delicious and presented beautifully. Staff were very helpful and attentive as always. Can’t fault it. Like to support local businesses and Portofino is one of our favourite restaurants.

site_logo

steph186337 . 2022-04-09

MORE AT TripAdvisor

I picked for location & positive reviews here ... really good food and time with family, friends and relations living in area. Thanks M, Dublin

site_logo

amap m . 2022-04-03

MORE AT TripAdvisor

Visited on 26th March for our anniversary meal with my wife and 2 year old daughter, food was fantastic as always and service was spot on. Was so glad to see Luke was still there who had been made manager. Good things happen to good...

site_logo

Christopheredwards87 . 2022-03-26

MORE AT TripAdvisor

Thank you to an amazing Team at the Portofino, for the fantastic food, caring service and hard work. You made it a very special day for family and friends on Saturday 19th March 2022.

site_logo

handicrafter . 2022-03-22

MORE AT TripAdvisor

Had a lovely meal, and there were gluten free options for me. Quality of food was good and we both enjoyed the whole experience. The staff were friendly & Enzo recommended a lovely red wine.

site_logo

Brenda T . 2022-03-16

MORE AT TripAdvisor

Visited for a meal on 26th Feb. The restaurant was packed and the atmosphere warm and welcoming. The whole experience was excellent from the food to the service from the lovely staff. My guests who were new to the area loved it. We will be...

site_logo

robbiec537 . 2022-02-27

MORE AT TripAdvisor

Went here after family members highly recommended and we was not disappointed warm welcome as you enter the restaurant and appeared clean we were showed to our table and given time to settle before our drinks order was taken. Food was really nice and filling...

site_logo

O6740UUrayr . 2022-02-16

MORE AT TripAdvisor

Being a coeliac with a dairy allergy, eating out can be difficult. But the lovely folk at Portofino made it a dream. Very attentive when taking the order, followed by going into the kitchen and chatted to the chef, nothing was left to chance (very...

site_logo

AnneW76 . 2022-02-05

MORE AT TripAdvisor

An absolutely lovely evening was had at Portofino for my 40th birthday. We were a party of 12, including 3 children and the staff couldn't have been more accommodating or attentive, even when one of our guests had arrived late it was no trouble to...

site_logo

beccad2015 . 2022-01-15

MORE AT TripAdvisor

My 10 year old Son came here during the week with friends for a birthday and loved it so much he made me bring him again. The Staff are lovely and remembered him and were very attentive for the whole of our visit. We both...

site_logo

Karlie S . 2022-01-09

MORE AT TripAdvisor

It’s second time I visited this restaurant and I have not been disappointed! Amazing and fresh food , great atmosphere and very friendly staff ! I will definitely be back !!

site_logo

nataliapE4756HV . 2021-12-22

MORE AT TripAdvisor

Visited on Friday night and left feeling very impressed. The food was delicious, service was great and the atmosphere was perfect for this time of year. Would definitely recommend!

site_logo

sophieehall . 2021-12-21

MORE AT TripAdvisor

Won't be going back! Place was covered in bar flies all over food & drinks Service was terrible Food was cold & tastless Staff were not bothered about you just left you we couldn't wait to get out. Staff didn't say anything about flies apologise...

site_logo

Samham456 . 2021-12-17

MORE AT TripAdvisor

First time eating here and probably won’t rush back. Setting is nice, well decorated. No diet cola in stock and no diet lemonade on menu (good job not diabetic!) We shared the meat antipasto: ‘a selection of cured meats, bruschetta, pate, cheeses, marinated olives and...

site_logo

misscwright . 2021-12-13

MORE AT TripAdvisor

My fried and see I had lunch here before going to the to Light cinema. Staff very friendly and welcoming and the food was excellent Would visit again

site_logo

Sacha10 . 2021-12-05

MORE AT TripAdvisor

Visit to New Brighton to watch a show on the Floral Pavilion and had a meal with my wife before the show. My wife had carbonara and I had the lasagne with a side of chips and cheese garlic bread to share. Both meals were...

site_logo

jheesom . 2021-11-25

MORE AT TripAdvisor

We booked here before we went to watch a show at the floral pavilion. The host made us feel amazingly welcome and offered to recommend some meals for myself and my partner which were perfect for our tastes. I can’t recommend this place enough! Best...

site_logo

garytommo . 2021-11-11

MORE AT TripAdvisor

Our second visit here and already cannot wait to come again. Attentive, friendly staff and we absolutely loved ‘Mr Sicily,’ whose Italian charm won over the mother-in-law and aunties! The food is to die for - fresh and authentic - we all thoroughly enjoyed our...

site_logo

176jaynep . 2021-10-30

MORE AT TripAdvisor

I’ve been to this restaurant a couple of times now and haven’t been blown away by the service when it’s empty. However, when it’s not even half full the staff are way out of their depth. Very very disappointing customer service. Staff walked past three...

site_logo

Anna B . 2021-10-26

MORE AT TripAdvisor

We had a look around at all the dining establishments that New Brighton had to offer and plumped for this one because it looked the nicest and had a wide ranging menu. We visited on a dreary late Saturday afternoon and felt immediately warmed up...

site_logo

Karen R . 2021-10-09

MORE AT TripAdvisor

Excellent food with great service. Ate here in July and really enjoyed the food. The pesto tagliatelle special was just beautiful. Would recommend to others over the nearby competitor

site_logo

manbearpig9 . 2021-09-21

MORE AT TripAdvisor

Excellent service staff very attentive food was excellent soup main course was delicious also wine merlot was excellent Sarah Lloyd and maitre- d very attentive enjoyed our night.Will be back from bonnie Scotland .

site_logo

helencW8218IG . 2021-09-11

MORE AT TripAdvisor

This was the best dining experience I have had in a long time. Excellent food and superb service from attentive staff. The girl who served us, Sarah Lloyd and the native Sicilian who made the posset and canoli were brilliant. Steaks were great and fish...

site_logo

robbiec537 . 2021-09-11

MORE AT TripAdvisor

Excellent food and service, staff were lovely and very attentive. The lemon possett was fabulous. Will definitely be back.

site_logo

H6763KUlaurac . 2021-09-11

MORE AT TripAdvisor

Been here a few times with family when we come to see them but this is the last time. The food is hit or miss but mostly miss. The carbonara was ok at the most but the sauce was runny as hell and was like...

site_logo

mfd200 . 2021-09-04

MORE AT TripAdvisor

Great place for a family visit. Upon entry i was greeted and welcomed. Rapidly they was over to make sure we was ready to order suggestions were amazing. Was able to have a friendly conversation with the manager. Once we had finished our food. Which...

site_logo

Under95dawg . 2021-09-02

MORE AT TripAdvisor

Not going to go Into a mad rant with essays pizza had a dead fly in it... No apologies from any member of staff... A massive hair in the risotto! Not one person / manager apologised for anything only asked if we wanted another meal...

site_logo

Nick_w1987_12 . 2021-08-30

MORE AT TripAdvisor

Evening meal with friends, the drinks waitress was very good not once did we have to catch her eye to order more, she was very helpful with the wine suggestions and her recommendation went down well Our waiter was brilliant, again offering suggestions. Everyone enjoyed...

site_logo

cjrach0803 . 2021-08-22

MORE AT TripAdvisor

Came here with my Son on date night! I live in Spain and am used to good food and have had terrible experiences in the last two weeks. This place is the only one I want to write a review about as so so good!...

site_logo

9KarrieG . 2021-08-17

MORE AT TripAdvisor

Food and service was great. The staff seem really happy in their work which made my wife and feel very welcome. Some bad reviews on here. Our experience was the opposite. Well done Enzo and the team, we really enjoyed ourselves. Especially the after dinner...

site_logo

Loveablerogue40 . 2021-08-16

MORE AT TripAdvisor

Very disappointing visit this weekend to a place we have loved over the years. Theyve changed the menu so couldnt do a meal i have been having for years in this resteraunt and the one in stoke. First of all i have to say the...

site_logo

fitfatj0nn0 . 2021-08-15

MORE AT TripAdvisor

The worst Italian restaurant I've ever been to. Risotto Pescatore NOT a risotto. They used boiled Indian Basmati rice, and not a proper Italian risotto rice. Terrible.

site_logo

fmgorgon . 2021-07-22

MORE AT TripAdvisor

In times of overpriced and average food served at some restaurants, Portofino is a breath of fresh air. For our recent wedding reception, service was personal, professional and attentive and the food varying from sea bass to Fillet steak was excellent. They went the extra...

site_logo

A9816DBjohnr . 2021-07-11

MORE AT TripAdvisor

Visited here yesterday sat outside. Food was very nice staff attentive, surprisingly big inside. My only criticism was that I thought the wine was expensive. Bit short sighted because it it is sited next to Wetherspoons so rather than stay there for more wine we...

site_logo

Q9626YMpamd . 2021-06-30

MORE AT TripAdvisor

All of us heard really good things about Portofino before booking so we thought “Let’s book it and give it a try” Acknowledged really quickly on arrival. Glasses were cleaned and polished. Prompt taking of drinks and delivery of said drinks. Very attentive staff (shout...

site_logo

gemmalowe . 2021-06-19

MORE AT TripAdvisor

3 of us ate and the food was lovely, I had the spicy prawns, very generous with the prawns and the sauce was nice. One had the seafood linguine and they loved it. But im giving it 3 stars as 1 of us had the...

site_logo

T9170LBscottb . 2021-06-13

MORE AT TripAdvisor

We booked as a treat, due to finally being able to sit inside with our family again. We were seen to promptly for drinks orders and soon after for food. Our starters were delicious & beautifully presented, then so were our mains. We all got...

site_logo

302098KVB . 2021-06-11

MORE AT TripAdvisor

Bloody awful! If you like overcooked food this is the place for you. Would of been nice if anyone asked if we enjoyed our meal. Go Wetherspoons for half the price

site_logo

stevewhite19662020 . 2021-06-06

MORE AT TripAdvisor

We have often ordered the takeaway menu throughout COVID and always found the food to be excellent quality. We called in last night without booking and were accommodated. It took 3 asks to get the correct drinks we ordered a bottle of wine, soda water...

site_logo

karenabbott106 . 2021-06-05

MORE AT TripAdvisor

Visited during a midweek lunchtime during half term when the weather has improved. On arrival, new tables and chairs have been bought for the outside dining area - an improvement from our last visit. However, having told the greeter that we wanted to sit outside...

site_logo

Spenno1971 . 2021-06-03

MORE AT TripAdvisor

Firstly, we have been to Portofinos many times and always enjoyed the food there. Today the service was terrible and we felt totally unsafe. No staff were wearing masks, this is illegal. On entering the restaurant nobody was at the door meeting customers as they...

site_logo

Anne W . 2021-05-31

MORE AT TripAdvisor

We decided to go to this restaurant because of the extensive menu as there were eleven of us from the ages of 10 to 78 years old all with different tastes. We were celebrating being able to get together as a family again. I can...

site_logo

PatcyPR . 2021-05-22

MORE AT TripAdvisor

Been looking forward to this soecial occasion for mths,very very disappointed staff werent great considering it was Christmas eve, Luke was great and a joy, other servers were rude and kept coming over asking if we wanted the bill!! Sarah was rude and miserable we...

site_logo

samsonWirral . 2020-12-25

MORE AT TripAdvisor

Came for a family members birthday, had an amazing time service is great atmosphere really uplifting, even in the middle of a pandemic felt completely safe and comfortable throughout visit

site_logo

ShivCarter13- . 2020-12-19

MORE AT TripAdvisor

lovely first me out, since lockdown. Lively good and exemplary service from Sarah, ably assisted by Luke. Sarah was very attentive, and intuitive in her customer service. Will be back again soon!

site_logo

Denise2700 . 2020-12-04

MORE AT TripAdvisor

Food was hot and delicious great value for money and really good service highly recommend best Italian in New Brighton

site_logo

jensX1702SY . 2020-11-02

MORE AT TripAdvisor

Best pizza EVER! Nice restaurant, staff friendly, food was delicious ! Covid friendly would go back when visiting New Brighton.

site_logo

191victoriad . 2020-10-10

MORE AT TripAdvisor

Don't do meerkat meals any more since new owners took over. Had filet steak which was well cooked but couldn't have fried onions as new owners didn't think they are Italian. Wife asked for steak strips with chips instead of potatoes. Apparently chef thinks full...

site_logo

Gilly0812 . 2020-09-06

MORE AT TripAdvisor

Had lovely meal with friends. No Tiramisu though so disappointed there. Had steak with blue cheese sauce was delicious. Highly recommend and will be back

site_logo

susansK9719IU . 2020-09-06

MORE AT TripAdvisor

Went for an early evening meal, I ordered a meal which was advertised as strips of beef also asked for chips instead of potatoes- veg was also on the description. Meal came with one solid piece of steak and chips . When I asked about...

site_logo

cathy544 . 2020-09-06

MORE AT TripAdvisor

We visited new Brighton bank holiday Monday and stumbled upon this place . The food and service were both fantastic, the staff so attentive and welcoming. The restaurant had every table full and yet the service was still great . We sat near the kitchen...

site_logo

r12nes . 2020-08-31

MORE AT TripAdvisor

A local restaurant with great service and food. We regularly visit with family and friends and always find it spot on. We will be back.

site_logo

461niccid . 2020-08-30

MORE AT TripAdvisor

Food was absolutely beautiful! It came exactly to the specifications that we had ordered despite us asking for some alterations and came very fast. We were served by jade who was very friendly and bubbly and also Luke who went above and beyond for us!...

site_logo

Laurenb920602 . 2020-08-29

MORE AT TripAdvisor

Amazing food and such an elegant setting. And more to the point the staff were absolutely incredible! Sarah, Charlotte and Luke by far made our night more special. Couldnt do enough for us and treated us like friends xx Cannot thanks you guys enough for...

site_logo

K2391QMjasonb . 2020-08-26

MORE AT TripAdvisor

Poor service had to at for drinks tables not cleaned between customers,no soap in toilets staff didn't appear to care

site_logo

B674CDjohnf . 2020-08-23

MORE AT TripAdvisor

I visited this restaurant last night with a group of 5 ladies including myself and we had a simply wonderful meal and evening in general. The food was delicious and cooked exactly to our liking. I asked for a slight variation of the Carbonara and...

site_logo

Stephanie S . 2020-08-23

MORE AT TripAdvisor

Visited here this afternoon/evening. We couldn’t get in anywhere but they agreed we could take a table outside as we are a large family group who live in same house. They were only allowing groups of six indoors. Which was fine for us as we...

site_logo

alisonl592 . 2020-08-17

MORE AT TripAdvisor

We had a great Sunday lunch with very tasty pastas and pizzas. The waiting staff were very patient and good with our kids.

site_logo

andymJ6624SS . 2020-08-16

MORE AT TripAdvisor

I’m not sure what some of these negative reviews are about but Portofino is our favourite restaurant. This was our first meal out since lockdown and the food was amazing as per usual. This is the first time we’ve actually put a review on here...

site_logo

Christopheredwards87 . 2020-08-15

MORE AT TripAdvisor

Very nice meal. The food was well cooked. The restaurant was very organised and really helpful and efficient waitress.

site_logo

breadpud . 2020-08-15

MORE AT TripAdvisor

Arrived for pre booked meal. Waited 45mins to be asked if we wanted a drink (decided to order food immediately as not to wait any longer- and thought best to skip the starter as we had two kids with us who were already being so...

site_logo

KatiePJ89 . 2020-08-13

MORE AT TripAdvisor

We was in new Brighton today and wanted a nice bite to eat hadn't booked anywhere so this place had availability it was me my cousin and our 2 children we got there at 1pm and waited 40 mins for our garlic bread it wasnt...

site_logo

aimloux . 2020-08-11

MORE AT TripAdvisor

Trying to be something it's nkust not. Very overpriced and just not good enough. Food average at best

site_logo

124camd . 2020-08-10

MORE AT TripAdvisor

Great to see this place open again, we had a few takeaways over the lockdown and the food was great. Missed going to the restaurant so booked a table and they never let us down.

site_logo

O8150KDkevinb . 2020-07-06

MORE AT TripAdvisor

Similary restaurants in North West

restaurant_img
4.2

796 Opinions

location-iconBanks Road
Italian
outdoor_seating_197273takeaway_197273delivery_197273

Took my daughter and her friends to celebrate her 13th Birthday , so 2 tables , one for the girls , one for my wife and step mum. The staff were amazing , welcoming and friendly as always, the food was delicious , they allowed us to serve my wife's home made cake , sing happy birthday etc . Couldn't nor have asked for a better time , so a huge thank you to Est for a brilliant day

restaurant_img
4.3

906 Opinions

location-icon14-16 Prenton Road West
Italian
outdoor_seating_151237takeaway_151237delivery_151237

Best Italian around the Wirral service is exceptional 5 star establishment

restaurant_img
4.3

312 Opinions

location-icon49 Wallasey Road
Italian
outdoor_seating_155525takeaway_155525delivery_155525

Our favourite place for date night, cosy, great music, lovely friendly service, and pride in serving gorgeous food. Reccommend the King Prawns (perfectly cooked), any of the sauces, steak, and pasta. ⭐️⭐️⭐️⭐️⭐️

restaurant_img
4.4

170 Opinions

location-icon2A Bromborough Road
Italian
outdoor_seating_235937takeaway_235937delivery_235937

The food was absolutely delicious! Every dish was fresh, full of flavor, and beautifully plated. The service was outstanding, and the atmosphere was warm and inviting.

restaurant_img
4.4

907 Opinions

location-icon140 Banks Road
Italian
outdoor_seating_208708takeaway_208708delivery_208708

Absolutely love it! My first time and definitely not my last. Staff are friendly, Great atmosphere and the food devine