GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.4

Based on 1.944 opinions finded in 2 websites

site_photo4

Nº 1317 in 1625 in Cardiff

Nº 162 of 179 British in Cardiff

CUSTOMERS TALK ABOUT DISHES WITH..cookedpotatobaconcoffeericesteaksaladladypiechickenhamcheesecurryoldpayfishfriedmustmeat

comment_iconOpinions

All in all, pretty meh, food was alright, service was only a tad bit better than the food, the interior of the establishment felt like it would do rounds in the modern Internet horror space.

site_logo

grimbles grimmhammer . 2025-03-19

MORE AT Google

No complaints, all a bit dated but not a bad breakfast for the price

site_logo

Gavin Holloway . 2025-03-15

MORE AT Google

Hadn't been here for a long time but decided to give it another go as we were after something cheap and value for money and this is the place to come if thats what you want. Will return.

site_logo

Joanne Saltfleet . 2025-03-10

MORE AT Google

Visited today with my wife and daughter we all had chicken curry rice and chips and it was absolutly lovely , and 36 pound for the three of us including dessert and drinks cant fault it

site_logo

marklloydthomas50 . 2025-03-07

MORE AT TripAdvisor

First time visiting pillars today with my wife and daughter and what a nice suprise we all had the chicken curry and rice and it was beautiful and at 36 pounds for the three of us (including dessert and drinks) it was well worth the money ...only thing i would say is to turn the air con off as it was a tad nippy lol , will definatly be returning

site_logo

mark thomas . 2025-03-07

MORE AT Google

Year after year, amazing food!!!

site_logo

Dan sendell . 2025-03-05

MORE AT Google

Fish chips peas sent back spot the fish

site_logo

Rosalie Howe . 2025-02-22

MORE AT Google

Asked for 2 plain coffees. One was white. Asked them to change it. Coffee was slammed on saucer by male till operator. Very rude. Food was cold. Cod goujons were OK. Steak and kidney pie had pieces of bone in it.The tiny amount of peas were tasteless. Asked to see Manager. There wasn't one. Assistant manager was dismissive. It used to be a good and buzzing place. Now, on a Saturday, it wasnt that busy at all. The place has gone downhill. Will never return.

site_logo

Anneke Thomas-Evers . 2025-01-25

MORE AT Google

He ido a los pilares (y ahora está cerrado The Louis) como mi primera opción desde la década de 1960. Nunca más volveré a ir allí. Gerente muy grosero. Aplastó mi café en el mostrador después de que me hizo esperar hasta que sirvieron a otros antes de que terminara mi pedido. Se hizo escaso cuando quise quejarme. Solía dar pilares y es el personal 10 de cada 10. No sé qué le ha pasado pero me costaría darle 0; 5 de cada 10 ahora. después de 50 años de ser cliente pueden cerrar la tienda realmente desearía poder hablar con el propietario. Solía ser muy. Bonito, pero ahora confía en el personal grosero. Si pudiera excavar algo. Despide al maldito personal actual y trae de vuelta a alguien que se preocupe por los pilares como solía hacer la familia. Señor y Lady Thomas - Evers

site_logo

Richard T . 2025-01-25

MORE AT TripAdvisor

Good quality food at a very fair price. Friendly staff, very clean, and the room temperature was comfortable.

site_logo

Patch . 2025-01-24

MORE AT Google

Nice place to go for food there

site_logo

James Byers . 2025-01-21

MORE AT Google

I love pillars, the vibe is so good.

site_logo

Sam Hickman . 2025-01-01

MORE AT Google

Fuimos ayer a desayunar fuera de casa. El desayuno cuando preguntamos dijo: "No, así que pedí otra comida cuando vinimos a pagar. El hombre que tomaba nuestro dinero le gritaba a una camarera joven sobre lo mal que estaba haciendo el café. Tan poco profesional, que los baños están sucios. Los asientos rotos del baño no volverán.

site_logo

Christine C . 2024-12-28

MORE AT TripAdvisor

Last Saturday, I had ordered corn beef pies, they had taken 30+ minutes to arrive. Upon arrival the woman delivering my food had dropped it and had made the statement "oops my bad, sorry love!" then ran off, I then had to wait a further 20 minutes to receive my new corn beef pies, the same woman had delivered my pies a second time (this time successfully) The food was not even all that great it was mediocre at most. The woman I wish to report had curly dark hair, the whole meal was a disaster, will not be coming back until this sort of thing is sorted!!!

site_logo

qhkrr . 2024-12-20

MORE AT Google

A fantastic restaurant offering fresh, vibrant flavors and generous portions. The service was exceptional, and the inviting ambiance made it a perfect dining spot.

site_logo

Alla Glover . 2024-12-17

MORE AT Google

First time in Cardiff, came from Australia, food tastes better than most from where I'm from, service was great, and just overall very Ni e

site_logo

Joshua Brewster . 2024-12-17

MORE AT Google

La comida era mediocre y solo cálida, la dirección era grosera, y esto se refleja en la actitud del personal, había pelo en la comida, así que tenía que devolverlo, esto solía ser un ir a como parte de nuestra experiencia de Navidad, pero si la dirección se cree Brexit y el precio de la comida y mantener al personal es el problema, de hecho, cualquier cosa menos la dirección, cuatro generaciones de familia, con más de 40 años de asistencia, durante el último año!

site_logo

Jet47245736086 . 2024-12-15

MORE AT TripAdvisor

Ok, fue un poco caótico para el personal que vi e incluso yo sentí su estrés. El servicio fue rápido, aunque todas las cosas consideradas. No empacado allí en este establecimiento de comida enteramente subterráneo, así que había suficientes mesas vacías para encontrar. En ese punto, algunas de las mesas eran un poco sabrosas, pero el personal las mantenía muy limpias en su mayor parte entre la búsqueda de comensales y gritar números en el establecimiento bastante cavernoso. Tenía jamón (jamón cortado adecuadamente), 2 huevos con patatas fritas que era muy agradable y mi esposa tenía una patata chaqueta grande con lo que describió como una lata entera de atún / mayonesa en ella y una ensalada. Sí, muy agradable a un precio de ganga para 2 comidas principales con 2 bebidas a unos £ 25.

site_logo

huw j . 2024-12-11

MORE AT TripAdvisor

Wasn't too busy like the rest of Cardiff. There was no one in front of me. I hadn't been here for a while. I ordered ham egg and chips took my slip with me. I am polite and ordered my coffee. Twice I said only 1 yet I was given two. I only took 1. And was charged for 1. I remarked about how busy the rest of Cardiff was. One of the manager's was abrupt saying how many there was sitting down. There wasn't. Food was okay. Table was OK Toilet was absolutely disgusting. One had no paper I think another was closed the door that was open. Had excrement all the way down the back of the pan from top to bottom. I had a wee and a shake and dry in the loo with no paper. I complained to a waiter near the till and he pointed to the manager's who were on the drinks. I didn't fancy another abrupt conversation with them. So I told the girls by the hot meals. About no toilet paper and the state and cleanliness of the one cubicle in question. There are other loos at the back of Pillars as well but I wanted a wee there and then. So Pillars failed on abruptness, cleanliness and simple things like more loo paper. It wasn't that busy so why couldn't staff keep an eye on the loos? And be polite Mr Manager. I didn't hang about. I myself have a 7 hour shift in Cwmbran to work today. I won't be abrupt whether the customer is nice or impolite!!

site_logo

Angela Sleeman . 2024-12-09

MORE AT Google

Tried here for breakfast the other day. Nice quick buffet style breakfast. Service was fairly friendly and prompt. Breakfast is outstanding value for money. Also tried lunch and the atmosphere and food is extremely cosy and homely. Would recommend for breakfast and lunch.

site_logo

Tristan Lawrie . 2024-11-30

MORE AT Google

Used to love this place too eat , Toilets omg absolutely filthy . As soon as you go into the restaurant your pressurised what do you want. Food came so did the flies . Shame this was a lovely place. Needs a bit of TLC

site_logo

Dione B . 2024-11-28

MORE AT TripAdvisor

Can’t fault the pillars in anyway .

site_logo

Julie Argent . 2024-11-24

MORE AT Google

El servicio al cliente es terrible. Un miembro del personal mintió haciéndose pasar por el gerente y de que estaban bien su servicio al cliente fue repugnante! Pedí 4 comidas, luego bebidas y me senté. Esperé una eternidad. Se lo dije al personal que llamaba a la mesa 47 y tenía 36 años, así que no cumplimos nuestro pedido solo para que sirvieran a 3 de cada 4 personas con su comida, dijo que el otro viene ahora y regresó 10 minutos después para decir el cuarto pedido, ¡no les queda ninguno! BS Manager no tenía ni idea. Personal auxiliar demostrando que no podían hacer frente y esto es en el centro de la ciudad en Navidad! Buena suerte con las próximas semanas, sorpréndete si todavía van después de Navidad. ¡Un montón de DoorKNoBs NUNCA VOLVERÁN A IR! ¡Olvidé mencionar que sirvieron pollo rosa a una mujer embarazada antes que nosotros!

site_logo

louise.caveill@hotmail.co.uk . 2024-11-24

MORE AT TripAdvisor

Place has gone down hill,visited this week ,before we could look menu we were asked what we wanted no smile or welcome . Ordered meal which took awhile to come out. When meals eventually came out they were on the same tray as another order which was ordered 5 orders after us .Meals cold asked if they could heat them up one was OK mine looked a mess baked potato looked like it been there ages and not hot .Asked to speak to manager and over heard waiter say that table there and we reheated it once . Now feeling like a nuisance the manager came over, I explained its still not hot .His reply sorry for that I'll give you your money back . Not even would you like something else. Not the Pillars it used to be , very disappointed and starving

site_logo

Johanne Gibson . 2024-11-22

MORE AT Google

My curry was awful. Can’t speak for other food. Cutlery dirty. Toilets locked. Really not good

site_logo

Beth Picton . 2024-11-21

MORE AT Google

Canteen style restaurant where you queue to order and collect your food. Some dishes are precooked but kept hot. We had the steak and kidney pie with fries and peas. Very affordable. Huge seatings.

site_logo

Bel . 2024-11-09

MORE AT Google

rude manager really rushed while ordering too. changed mind about a drink as the flavour we wanted wasn’t there so asked for a water and he slammed the water down on the table with a cup rolling his eyes. absolute joke. can see why it was so quiet in there

site_logo

Courtney Richards . 2024-11-06

MORE AT Google

Absolutely disgusting place! Wish I never touched any of the food here! Chips were freezing, burger was half the size of the bun and was undercooked. I even found a pea in my burger which was bit of a random find.. Staff are rude, espically one of the male members of staff who was at the checkout today. Couldn’t even finish listening to me what I wanted to order without him just wanting to finish up my order for me with an attitude! Also asked for a cheese burger and had a plain burger, asked one of the staff to sort out my order for me. After waiting for a piece of a cheap cheese slice to put on top of it, it got brought back out to me with the staff members hand in my chips.. DO NOT GO HERE IF YOU WANT A GOOD MEAL AND YOU VALUE A HYGIENIC RESTAURANT

site_logo

amy w . 2024-11-04

MORE AT TripAdvisor

Went here today me & my partner got told we were to early to order lunch by a member of staff and only breakfasts were being served when we asked what time they were serving lunch she replied 11.30 we said it was 11.35 and showed her the time she told us she would write down our order and bring it over to us when ready (with a bit of attitude) so I had chicken curry rice & chips & my partner only wanted a piece of corn beef pie and NOT a meal she wrote this down so we get to the till were a big mouth loud manager was taking payment so we passed him the paper from the ladie and he tried charging us £18.36 for 1 piece of cornbeef pie and chicken curry,rice & chips with a medium tango when we looked at the receipt he tried charging a meal with the cornbeef pie so we explained it's just a slice we wanted and not the meal and he took £2 off we still thought this was expensive but didn't say nothing and went to sit down and wait for our food he then came over and give us our ticket as we forgot it my partner then questioned a bit of cornbeef pie £6+ he said I could see by your faces you was shocked at the price then started walking away talking loudly around other people saying the chef worked hard to make that pie.he then brought us our food and slammed a £1 on the table after giving us our food as he knew he was ripping us off absolutely shocking behaviour and very rude..as we was leaving he said sarcastically have a nice day which we didn't reply then he shouted again have a nice day again sarcastically..you do not expect that from a manager and I will never return here again PS the rice was like mush & the breakfast looked terrible 🤮

site_logo

James Price . 2024-11-03

MORE AT Google

Awful terrible service , staff running around shouting orders out .asked for two jacket potatoes said they only had one left , this was 1.30 in the afternoon, then waitress came to table said we now have none left as they had burnt the last one , used to be a lovely place run by a guy think he was Italian who run a tight ship , can’t see us ever going back was awful .

site_logo

Nigel B . 2024-10-31

MORE AT TripAdvisor

Really bad breakfast. Bacon rock hard, sausages and hash browns dripping in oil, black pudding wet and soggy. Service terrible. Really rude server, huffed and puffed and slammed trays around.

site_logo

emily price . 2024-10-31

MORE AT Google

The order was difficult to make. We ended up with no extras in the burgers. The food is not great. Most of the chairs are destroyed or very nasty. The dirty fried are good. We paid 30£ for the whole which is too much in our opinion.

site_logo

Aurelien Voillot . 2024-10-27

MORE AT Google

Always come to pillars for breakfast whenever I'm in Cardiff and it's usually a very friendly service. However, shame about the unfriendly manager this time around who set a very bad example to his younger colleague who was doing her best.

site_logo

Ryan Davies . 2024-10-13

MORE AT Google

Terrible service, unclear/ false advertising, poor shift management and the shift manager didn’t care either. Visited on Sunday morning, understandably the city was busy due to the marathon. Big chalk menu boards outside advertising £4.60 for 5 items and £6.40 for 9 My partner ordered his chosen 9 items then for me to be told the 9 is a set menu. Challenged this to be told it’s a set menu, despite my partner choosing his. Manager didn’t seem to care at all. We walked out! Poor team organisation meant employees behind the counter didn’t know if they were coming or going. First and last time of visiting,

site_logo

Ben S . 2024-10-06

MORE AT TripAdvisor

Fruit flies everywhere food squished all over the carpets, ridiculous amounts of tables squished together, service was confusing and staff were unhelpful, meal was disappointing at best. Would not reccomend

site_logo

Josh Foster . 2024-09-28

MORE AT Google

Absolutely disgusting, first impression was not great,had never been there before and when I asked for help with ordering staff were completely unhelpful and rude. Tables were cramped together and you was basically eating your food at the same table as other people. was so unhygienic,tables and chairs were not cleaned properly,food was mushed into the floor and the so called 'chefs' where wheeling trolleys full of black bags through the restaurant. Plates of food where left on tables and not cleaned the whole time we was there. There was fruit flys EVERYWHERE,I personally do not want to eat my food surrounded by flys, old food and dirt

site_logo

Jersie Swain . 2024-09-28

MORE AT Google

Entrance leaves much to be desired, sticky floor, smells weird but we were going purely for the nostalgia as we hadn’t been there in many years! The young girl who served us was absolutely lovely, clearly very busy, trying hard, very helpful ( we amongst others were very confused by the set up) despite this still got criticised by a man who appeared to be more senior (yet slapping food on a plate taking absolutely no pride in it’s appearance) because we asked her a question, to which she’d already told us the answer previously it was just so loud in there we didn’t hear. Ordering system was so confusing, some items you pick up whilst your going past on your tray (like school dinners), some items you have to order and wait for the server to walk around the restaurant aimlessly and basically keep an eye out for your food being brought over. I ordered what was on the specials board, pulled pork loaded fries, my partner ordered chicken burger and chips. We honestly just laughed when the food came. The loaded fries were burnt pulled pork, on top of a small portion of chips, with a plastic cheese on top that had been whacked in the micro for what looked like 10 minutes. The chicken burger wasn’t much better very much a “make me a chicken burger with the absolute cheapest ingredients you could find” kind of vibe. If you’ve got money to waste and you’re not that hungry it’s a laughable experience, would I go back? Not if you paid me. Also our clothes stank when we left and we were barely there 35 mins.

site_logo

Jade a . 2024-09-21

MORE AT TripAdvisor

Had breakfast this morning and was really disappointed food was stone cold , unfortunately will not be returning after spending £18 for 2

site_logo

Emma Clark . 2024-09-21

MORE AT Google

This was our first time visiting it is also our last. The food was awful the jacket potato was so small it had been cooked in a microwave it wasn’t fresh or it had been in too long. The prawns were warm/cold, Rose Marie sauce was just awful. The garnish what was that. Definitely wasn’t kept in the fridge. My daughter had the pasta bolognese she did say it was ok, had better. Certainly wasn’t worth the money. Generous giving a 2star

site_logo

Tracey Davies . 2024-09-21

MORE AT Google

Always welcomed at pillars. My wife and I come here for breakfast whenever we're in Cardiff. We look forward to visiting this subterranean eatery as part of our visit. Buffet style, quality dining, at great prices. I enjoy the 9 piece myself, and the Bride goes for a veggie 7 piece. Never dissatisfied. 15 pounds for two peoples breakfast with tea and coffee? Can't turn your nose up at that.

site_logo

RNG . 2024-09-16

MORE AT Google

ridiculously cheap and cheerful breakfast, fast service. banging veggie sausages, always hot and well cooked. huge menu, clean cutlery. no complaints.

site_logo

Molly Cotton . 2024-09-16

MORE AT Google

In its price range this restaurant offers great home-cooked style comfort food and there can always be a healthy twist with the range of salads I normally go by myself after a heavy workout at the gym when my body needs instant fuel Highly recommended is this Cardiff institution of many years!

site_logo

Travelgenius123 . 2024-09-03

MORE AT TripAdvisor

Food is extremely rubbish, smell gross around the cashier and the floor is sticky. Not again.

site_logo

Jen Jen . 2024-08-31

MORE AT Google

Good choice of food and a large place underground in vaults. Can be very busy at times. Reasonable prices.

site_logo

Steve Goodland . 2024-08-23

MORE AT Google

1 star is a push! Food was freezing cold and they rush you to choose your items. Cant even see the food and they’re asking what you want. Never come back. Mushrooms tasted like they had washing up liquid on them

site_logo

kenzie beck . 2024-08-17

MORE AT Google

This food is terrible if you eat here you could get food poisoning. The prawns I ordered with my salad stank and the salad was wilted. The seats were uncomfortable and the toilets were unhygienic and stinky

site_logo

Oliver W . 2024-08-14

MORE AT TripAdvisor

I have been going here for many years but I have noticed how dirty the place is now and how rude the two managers are especially the short blonde one went to pay and he was on the phone shouting at someone no communication with the customer at all just continued his phone call and grabbed at my money on other occasions you are left at the till while your food is going cold waiting for one of the managers to turn up

site_logo

Vacation776502 . 2024-08-11

MORE AT TripAdvisor

Was surprised by the portion sizes, wasn’t expecting so much for an excellent price. Was also impressed by the managers desire to keep a clean and pleasant environment.

site_logo

Peter Acreman . 2024-08-10

MORE AT Google

I really enjoyed the vibes of this restaurant. The decorations, the service, the food, all are so nostalgic. We got jacket potatoe and cottage pie and cheesecake. They all were good quality and the prices are very reasonable. I highly recommend it and I will go back again x

site_logo

Faranak Gholampour . 2024-08-10

MORE AT Google

During our stop in Cardiff my wife and I went looking for a nice place that served a good breakfast and w found it at Pillsrs The breakfast are ala cart and you can choose 5 or 7 piece breakfast and pick what and how many items you want. The food is good and the prices are very reasonable. The owner is a very nice man and his staff is efficient and helpful. We ate here twice for breakfast during staff in Cardiff and would stop in again if we returned to Cardiff. The bathrooms and restaurant are very clean. A good place for breakfast and more than likely other meals also.

site_logo

Sundog . 2024-07-24

MORE AT TripAdvisor

The food is very honest, well made, not fancy, but good enough. And the best it is very cheap. Several options, fresh made, very good service. Indeed, a very good option for the amazing price.

site_logo

Erik Narazzaki . 2024-07-23

MORE AT Google

Fabulous venue - I would never had known by looking at the entrance, the sheer size of this restaurant. Huge servery, that took me back to my childhood - the restaurants that used to be in Littlewoods, C & A +Bhs departmental stores - in a good way. Breakfast was lovely - you can choose from 5 to 12 items, including bacon, sausage, fried bread, tomatoes etc. Really good value for money. A great variety of hot and cold drinks. Lunch looked amazing - homemade pies (sweet and savoury), vegetables, potatoes, salads, paninis, burgers and so much more. The seating area is vast and comfortable with music playing. Although you are in the basement, it's light and airy. Staff were attentive and couldn't be more helpful. Such a fabulous venue - I can imagine it being a cocktails bar and dancing location back in the day. Would absolutely recommend this venue - check it out and you'll be positively surprised!! Well done team 👏 👍

site_logo

Michelle Penny . 2024-07-17

MORE AT Google

Nice restaurant. Plenty of choice for breakfast.

site_logo

Raj Balasuriya . 2024-07-11

MORE AT Google

Disgusting how management speaks to they're staff, I came in today with my family for food and it was like an episode of Gordon Ramsey kitchen nightmares,I definitely would not recommend going here and the manager wants to be ashamed of himself.

site_logo

luke wilcox . 2024-07-06

MORE AT Google

Cheap and easy breakfast, hits the spot

site_logo

Alex French . 2024-07-04

MORE AT Google

Not only did we have to wait 20 minutes for food in a nearly empty cafe but when our fish and chips arrived the fish was so over cooked we had to try to eat it with our fingers, it was horrible, will never go back here, a lot better place's to eat in Cardiff, avoid.

site_logo

Susan H . 2024-06-12

MORE AT TripAdvisor

Friendly staff and good portions!

site_logo

SC . 2024-05-31

MORE AT Google

I haven’t been here for over 20 years but this place does the best lasagne I have ever had bar none and today didn’t disappoint, it’s chaotic it is what it is but honestly I’ll continue to come back just for this dish!! Thank you pillars I’m a very happy customer ❤️

site_logo

bt1979 . 2024-05-28

MORE AT TripAdvisor

A lot of choices with reasonable price compare to other restaurants in city centre.

site_logo

Charles Ma . 2024-05-23

MORE AT Google

This turned out to be one of the best value restaurants in our entire three week trip round Britain. Low key but comfortable decor as well as being very centrally located five minutes from the castle.

site_logo

Wingfield73 . 2024-05-13

MORE AT TripAdvisor

Great food & prices,how about a tip jar for waitresses always eaten there great service & never seen them hanging around chatting like other restuarants,always a help & always clearing up & cleaning up

site_logo

bluejodie . 2024-05-05

MORE AT TripAdvisor

Absolutel random find today.. stunning food.. have recommended it to my husband who works in Cardiff regularly

site_logo

Carlymarie Hill . 2024-04-25

MORE AT Google

I remember this restaurant from days gone by, how things have changed. The entrance is dirty and tired and the theme continues down to the restaurant. Walking in to find a table, you walk past the waste food and cleaning station and piles of trays, it’s vile. The food is presented like school dinners. The chef/cook came out of the kitchen in an apron that needed binning. The young girl washed the table and trays with just one dirty looking rang. For visitors coming to Cardiff this restaurant in a disgrace. Won’t be going back. A positive for this review is that the staff were very nice.

site_logo

Sharon M . 2024-04-23

MORE AT TripAdvisor

Visited while staying in Cardiff - Breakfast was good, priced competitively, staff were friendly. A positive experience all round

site_logo

rhyst776 . 2024-04-08

MORE AT TripAdvisor

3rd time visited pillars in cardiff in 3 month. Each time they have over charged me. I think each person you ask gives you different prices

site_logo

Pamela Ware . 2024-04-06

MORE AT Google

Had lovely chicken and chips staff friendly lovey place very good value don't get ripped off like posh food places we will definitely be back

site_logo

Dawn Macleod . 2024-04-05

MORE AT Google

A step back in time. Huge portions of school dinner type food. Value for money n great if you're on a budget. City centre location. Manager very rude to staff, but staff lovely to us.

site_logo

Lucy A . 2024-04-03

MORE AT TripAdvisor

The last serving my husband was polite, the last serving my was extremely rude. Not a good impression for a first (and never to be repeated) visit. This place has so much potential and I love the idea of the place. But unfortunately the food was awful and also the tables and chair needed to be better cleaned.

site_logo

Nicola Kaltak . 2024-03-26

MORE AT Google

Disgusting! How can someone call this food ?? 🤦 reading some reviews I’m shocked !! We took the food and as they were putting it on our plate we were shocked .. went and paid (clearly a reason why pay before you eat ) 😂 sat at the table , took a bite of microwaved scrambled egg and bite of sausage and bacon and decided to just leave .. Rank is not even the word !!! Disgusting is just a part 🤮🤮🤮🤮 avoid unless you are 70 years old as the rest of customers who don’t even care what is eatable

site_logo

A K . 2024-03-26

MORE AT TripAdvisor

Walked by and decided to have breakfast at Pillars .. only one friendly person that served me (buffet style ) and Second Lady was so rude to my wife .. older lady short hair .. anyways .. never mind that !! It’s the food that I want to mention! I laughed ! I laughed because this is officially the most disgusting “food” I’ve ever had and paid for ! I literally had half of sausage and half of bacon and tried microwaved “scrambled egg and I said to my wife let’s just leave . Now I know why they make you pay before you eat it 😂😂 honestly.. it’s horrible ! As we were sitting down I could see “chefs” with trollies up and down .. I’m sorry to say this as I have no intention to insult anyone but clearly poor hygiene and presentation of a person that “cooks” the food ! Basically we decided to instantly accept that we would rather lose the £20 we paid and simply walk out for our own health and safety. Not sure why we even continued to order the food since we were shocked walking in ! Lesson learned and guess . By the way , pictures on your website are misleading . It’s a yuck 🤮 place and food even worse

site_logo

A K . 2024-03-26

MORE AT Google

Me and my mum found this place and thought it would be a new experience, we went down the stairs and it felt empty, for a place that big there should have been more staff, speaking of the staff they looked like they didn't want to be there, once we got out food we ordered 2 chicken burgers, 1 plain and one with the salad the both came plain and the chips they came with got cold quickly and looked like they came from the freezer and the bun wasn't even toasted and the chicken was bland it tasted like something you would get at a BBQ, nun the less I had the red velvet cake as desert an all day its mediocre and best, I've hada better experience in Witherspoon's, not coming back again, try better next time.

site_logo

Michael Wood . 2024-03-24

MORE AT Google

Rude manager 5 beans as a portion ..messaged them no response. Stopped going here . Horrid manager is very very rude . AVOID AT EVERY COST loads of options in the city . Weatherspoons do much better food at a better price

site_logo

Kevin Hancock . 2024-03-08

MORE AT Google

Haven't been to Pillars for a long time but thought I would give it a go again. Sadly will not be returning My husband said his food was ok but the coffee was horrible. My food was luke warm at best and I found a dead fly in my tea. When I approached a member of staff ( older lady with blonde bob hair stlyle) the response was at least you did not swallow it and she laughed, then said sorry about that. No offer of refund or anything. Absolutle awful customer services you do get what you pay for.

site_logo

FRAZZLE0 . 2024-02-19

MORE AT TripAdvisor

Lovely food and lovely staff but I couldn’t help notice how rude the manager with the bald head was speaking to do some of his staff ( shockingly rude )

site_logo

Nomad44316533635 . 2024-02-17

MORE AT TripAdvisor

I visited this restaurant today with my family, very bad experience, one of the girls who ask for your order was unfriendly and very rude, we wanted to add something else to our order and very annoyed she told us to move forward to where it is cancelled. Definitely very bad at her job. The food was a little cold, we ordered a hot coffee and it was cold, but the gentleman very kindly changed it. But, anyway, the terrible experience was only by the girl.

site_logo

Yessica Molina . 2024-02-12

MORE AT Google

Terrible customer service, I wanted to order more food and the lady sent me straight to the till with bad mood.

site_logo

Rafael Molina mendoza . 2024-02-12

MORE AT Google

Called in during six nations game v Scotland service quick.home made steak and kidney pie was very good been coming to.pillars for a few years now since louis closed will.use again

site_logo

Martin L . 2024-02-04

MORE AT TripAdvisor

Took my two girls there order baked beans on toast and chips had 2 cakes and 3 drinks came to over £20 won't be going there again i can get a lot cheaper elsewhere and as a single parent money saving is everything! My partner is a vegetarian and they had little options available!

site_logo

master surfer . 2024-02-03

MORE AT Google

Where do I start!? This was single handedly, THE WORSE meal I have EVER had! The restaurant STANK of curry? Just stale curry? I ordered 2 lots of burger meals, 1 curry half and half, and a lasagne meal! We sat down - our daughter said it was “like being in prison feels like”? The food arrived, after hearing PINGS of microwaves, after about FOUR OR FIVE minutes? REALLY? So HOW do you cook burgers in that time? My lasagne was, quite frankly, HORRIFIC! It looked like my cat had been sick on my plate - AND it was tepid, at most! The jacket looked like it had been stood on! The skin? Was like Gandhi’s flip flop! My husband had the curry - which was VILE! One piece of chicken looked bloody. Then the rest was just chicken skin!? The two burger meals were slightly edible? But in the last mouthful - had a HUGE gristly lump? I DREAD TO THINK what it was?? All through the time we were in there, the flies in the restaurant were beyond a joke? I’m wondering if this was the missing protein from my lasagne!? My husband went to speak to someone - and fair play, our meals were refunded! But honestly, I still feel sickly now! We were then told to leave via a side door? I honestly thought Ant & Dec were going to jump out - as the WHOLE EXPERIENCE WAS HORRIFIC!

site_logo

663rachelh . 2024-01-27

MORE AT TripAdvisor

Food diabolical.service terrible. The place has gone down hill since the last time i came 2 years ago.

site_logo

Philip Speers . 2024-01-21

MORE AT Google

Probably the best value restaurant in Cardiff with good atmosphere.A wide variety of food on offer.british favourites like, pie and chips, curry and rice, fish and chips. Self service, orders taken and served quickly, plenty of room inside.

site_logo

Anthony Hill . 2024-01-13

MORE AT Google

A good value traditional breakfast - fresh, tasty and hot! Great to see crispy fried bread on the menu. Nice coffee as well. Only downside. a surly young server on counter who just seemed uninterested and, to be honest, I (and also my partner) had not a clue what she was actually saying (when she deemed to talk)! A “hello and what would you like” wouldn’t have gone a miss. And, the face on her!!

site_logo

jeremyhM1358TO . 2024-01-13

MORE AT TripAdvisor

Had lunch here yesterday. Cold hard chips and very few on a side plate. Over £3 for these. Disgusting. Will never eat here again. Couldn't be bothered to complain as with my son who's autistic so doesn't like any form of confrontation. His was inedible too. Just so horrible

site_logo

566joyf . 2024-01-12

MORE AT TripAdvisor

Love this place been going since I was a child, it hasn't changed. Yummy home cooked food 😀

site_logo

Emma JG . 2024-01-06

MORE AT Google

Lovely large restaurant with plenty of seating Good selection of food and drink Reasonable price

site_logo

Jeanette Harris . 2023-12-29

MORE AT Google

Lovely friendly place will definitely go back .

site_logo

Dawn Snooks . 2023-12-23

MORE AT Google

Always have to visit pillars whenever I go to Cardiff. Whether is breakfast or lunch the food is always delicious and excellent value for money

site_logo

Kate Lambert (Angelshadows85) . 2023-12-20

MORE AT Google

Good place not too expensive for a basic meal, staff helpful if you have food allergies, clean and tidy

site_logo

Steve Amos . 2023-12-20

MORE AT Google

Good value, cellar restaurant that's been in Cardiff for years. There is a buffet style eatery or you can order off the menu. Good value for money, especially if you drink tea as it's only £1.71 a pot!

site_logo

David Gillingham . 2023-12-16

MORE AT Google

It is what it is. No frills cattle market delivering ok food which is cheap but not so cheerful. Would go again if needing to adhere to a budget.

site_logo

Jamie L . 2023-12-13

MORE AT TripAdvisor

All my food was cold from a hot counter

site_logo

MATTHEW CRYER . 2023-12-09

MORE AT Google

I had the lasagna which was just warm. Otherwise it was a 5 star.

site_logo

Andrew Evans . 2023-12-07

MORE AT Google

Very poor service, quality and whole experience. Ordered an adult meal and it came on a side plate the size of a saucer. I sent it back saying it was child’s portion and I ordered and paid for an adults and it came back saying it was adult sized! The chips on that meal and my sons were soggy and raw! The place is like a cattle market, having never been there before I had no idea how it all worked and staff were unhelpful in explaining and I feel like and inconvenience for not knowing! All meals came out stone cold and the cutlery was filthy and so were the toilets! Definitely won’t be visiting again!

site_logo

lucy61_12 . 2023-12-02

MORE AT TripAdvisor

Still keeping up there standards

site_logo

James Webb . 2023-12-02

MORE AT Google

Used to go here years ago it was lovely. Returned there on the 29/11/2023 it was dirty looked like it hadn’t been deep cleaned for a while staff looked like they didn’t want to be there. toilets were disgusting with no toilet roll won’t be going back again.

site_logo

Clare Jones . 2023-11-30

MORE AT Google

Both myself and my Husband had the steak pie ,chips peas and gravy the food was OK but the service was awful the girl that served us practically threw the food on the plates there was gravy everywhere she was more interested in talking to the other girl that was also serving then serving us I felt like a inconvenience

site_logo

sian williams . 2023-11-29

MORE AT Google

Worst meal I've ever had. Ordered a cheese and onion toastie and fries. When it came, there was a white toastie that must have been toasted by a matchstick, and a lettuce leaf with a bit of coleslaw. When I asked where were the fries, a member of staff, a young girl with long red hair, rolled her eyes and just walked off with a terrible attitude. She came back after about 3 minutes with a small bowl of fries and almost threw them at me. Disgusting attitude and way of treating customers, and I will never go there again.

site_logo

Karen P . 2023-11-28

MORE AT TripAdvisor

Oh my God! Large Durty fires are something really special! My brother tried a bacon bree and cranberry panini and was as pleased as l Very good food for very good price

site_logo

Tomyslav . 2023-11-27

MORE AT TripAdvisor

Really awful first experience !! Was asked what we wanted when we were nowhere near the breakfast items so had to say we don’t know as have never been here before and don’t know what breakfast items they had . Then when we did get there and chose the 9 items the first piece of toast he offered me was white which I refused so he got more from somewhere which was barley any better he brought fresh bacon out and I had sausage egg black pudding and beans to make it up to 9 items I had a pot of tea as well and I don’t know if it was the time it took to get the tea and then go to another place to pay for it all but everything was stone cold by the time I tried to eat it !!! The black pudding was a chunk of about 4-5 inches big which was barely cooked on the outside and raw all the way through !! The pale bacon he had brought out from the kitchen was freezing and even the tea was only Luke warm The place should be called Shambles !! When u get to the ladies toilets you find that u have to put a number into the lock on the door that u find on your reciept but no one tells u this and I didn’t spot any signs telling me this and most other ladies seemed to be unaware of it as well !!! What an awful place first and last time for my daughter and i, oh and her food and coffee was as cold as mine was obviously !!! The whole place felt like a works canteen I wouldn’t take a cat there !!

site_logo

chrikearney . 2023-11-26

MORE AT TripAdvisor

It was just for a cup of tea and carrot 🥕 cake .I loved it

site_logo

Ngatchou Henriette Bertine . 2023-11-22

MORE AT Google

Similary restaurants in South Wales

restaurant_img
3.4

326 Opinions

location-iconThe Hayes
British
outdoor_seating_181286takeaway_181286delivery_181286

Me lastimé el brazo y la muñeca recientemente, así que no podía levantar la bandeja después de hacer mi pedido. Así que la señora detrás del mostrador salió y llevó mi bandeja a una mesa para mí. Incluso recogió cubiertos para mí. Servicio brillante, café, pastel y patatas fritas eran encantadores.

restaurant_img
3.5

2042 Opinions

location-iconCaerphilly Road
British
outdoor_seating_181255takeaway_181255delivery_181255

Breakfast was awful cold not very good at all We were not the only ones there were others who sent there’s back Not very good

restaurant_img
3.5

1202 Opinions

location-icon353B Grand Avenue
British
outdoor_seating_181504takeaway_181504delivery_181504

Good food as for the kabab it you want a kabab it will be in a pitta bread unless you request a naan bread but they don't ask if you have a preference

restaurant_img
3.5

902 Opinions

location-iconCardiff Bay
British
outdoor_seating_181288takeaway_181288delivery_181288

Ordered a jacket potatoe, chips were given. No fried onions or tomatoes as the menu states. Extremely short staffed. Miserable dire atmosphere due to the fact they are closing down soon. Noone came to ask if everything was OK. Food poorly presented and luke warm. We feel ripped off. Hoping it gets taken over and turned around. Waste of money.

restaurant_img
3.5

1667 Opinions

location-iconThornhill Road
British
outdoor_seating_181522takeaway_181522delivery_181522

Debbie was absolutely fantastic, recommended an Apple Jack Daniel’s and it was lush. Fair play an absolute credit to the pub 🫶🏻 will definitely return